Kinesin protein

Overview
NameKinesin protein
Smed IDSMED30029805
Length (bp)5864
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin protein (SMED30029805) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin protein (SMED30029805) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin protein (SMED30029805) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin protein (SMED30029805) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029805

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029805h1SMcG0013191 SmedASXL_017094SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30029805h1SMcG0013191 Contig30769uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029805h1SMcG0013191 Contig30769newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30029805h1SMcG0013191 dd_Smed_v4_13562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029805h1SMcG0013191 dd_Smed_v4_13562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029805h1SMcG0013191 dd_Smed_v4_13562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029805h1SMcG0013191 dd_Smed_v4_13562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30029805h1SMcG0013191 dd_Smed_v4_13562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029805h1SMcG0013191 dd_Smed_v4_13562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029805h1SMcG0013191 dd_Smed_v4_13562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029805h1SMcG0013191 Contig53457newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029805h1SMcG0013191 Contig53457uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30029805h1SMcG0013191 dd_Smed_v6_13562_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF26A (kinesin family member 26A [Source:HGNC Symbol;Acc:HGNC:20226])

HSP 1 Score: 308.916 bits (790), Expect = 4.556e-84
Identity = 209/478 (43.72%), Postives = 295/478 (61.72%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKT-SLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRV-NANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRAS-RHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS +L+  PPP PP LL+  S T+    + GK+KV++++   + +     Q  + +   + VD  KKQ+ +++  +    ++ PRR   A +PK++AFDAV+  D +  E+CS  + D++QSVVSG DGC+FSFGH+    +  MIG D   + LG++PCAISWLFRLI E++E+TG RFSVRVSA+EV G+ + L+DLL+++         SPGVYLR+DPV G QLQNQSELRAPTAEKAA+YLDAALAAR+ S     E+  R SH LFTLHVYQYR+E+      ++GGRSRLH++D GS    +                         LSLSA  +V+LALVNG +H+PYR  +L+ LLRE++++  CRT M+AHV+      A+++  +Q A+++ RL+R+K    S +S  +SS  +    R    R             T      + DY+SSSEQSCDTVIY+G
Sbjct:  197 YPTDFSGVLQLWPPPAPPCLLRAASKTKDNPGSIGKVKVMLRIWPAQGA-----QRSAEAMSFLKVDPRKKQVILYDPAAGPPGSAGPRRAATAAVPKMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIEERRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPGSLQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRSSHMLFTLHVYQYRMEK-CGRGGMSGGRSRLHLIDLGSCEAAAGRAGEAAGGP-------------LCLSLSALGSVILALVNGAKHVPYRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAARIHRLRRKKAKYASSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYSSSSEQSCDTVIYVG 655          

HSP 2 Score: 64.6994 bits (156), Expect = 2.156e-9
Identity = 55/212 (25.94%), Postives = 101/212 (47.64%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPV----------------------------SVRKLS-PKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES+ RDSE     SS  DS SES    +P A+T   +  +  ++  ++ R  P    +T+   + P                              V +L  P+ + +  P   L   +   ++A++ Q +++ ++ A+   L  EL +++ R++++P  W     V  +++PE + ++ ALE+ T  L + V  CK+HV+++T FDI
Sbjct: 1518 SSGYESLRRDSEATGSASSAPDSMSESG-AASPGARTRSLKSPKKRATGLQRRRLIPAPLPDTTALGRKPSLPGQWVDLPPPLAGSLKEPFEIKVYEIDDVERLQRPRPTPREAPTQGLACVSTRLRLAERRQ-QRLREVQAKHKHLCEELAETQGRLMLEPGRWLEQFEVDPELEPESAEYLAALERATAALEQCVNLCKAHVMMVTCFDI 1727          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF26A (kinesin family member 26A [Source:HGNC Symbol;Acc:HGNC:20226])

HSP 1 Score: 308.531 bits (789), Expect = 8.512e-84
Identity = 209/478 (43.72%), Postives = 295/478 (61.72%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKT-SLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRV-NANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRAS-RHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS +L+  PPP PP LL+  S T+    + GK+KV++++   + +     Q  + +   + VD  KKQ+ +++  +    ++ PRR   A +PK++AFDAV+  D +  E+CS  + D++QSVVSG DGC+FSFGH+    +  MIG D   + LG++PCAISWLFRLI E++E+TG RFSVRVSA+EV G+ + L+DLL+++         SPGVYLR+DPV G QLQNQSELRAPTAEKAA+YLDAALAAR+ S     E+  R SH LFTLHVYQYR+E+      ++GGRSRLH++D GS    +                         LSLSA  +V+LALVNG +H+PYR  +L+ LLRE++++  CRT M+AHV+      A+++  +Q A+++ RL+R+K    S +S  +SS  +    R    R             T      + DY+SSSEQSCDTVIY+G
Sbjct:  336 YPTDFSGVLQLWPPPAPPCLLRAASKTKDNPGSIGKVKVMLRIWPAQGA-----QRSAEAMSFLKVDPRKKQVILYDPAAGPPGSAGPRRAATAAVPKMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIEERRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPGSLQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRSSHMLFTLHVYQYRMEK-CGRGGMSGGRSRLHLIDLGSCEAAAGRAGEAAGGP-------------LCLSLSALGSVILALVNGAKHVPYRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAARIHRLRRKKAKYASSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYSSSSEQSCDTVIYVG 794          

HSP 2 Score: 64.6994 bits (156), Expect = 2.043e-9
Identity = 55/212 (25.94%), Postives = 101/212 (47.64%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPV----------------------------SVRKLS-PKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES+ RDSE     SS  DS SES    +P A+T   +  +  ++  ++ R  P    +T+   + P                              V +L  P+ + +  P   L   +   ++A++ Q +++ ++ A+   L  EL +++ R++++P  W     V  +++PE + ++ ALE+ T  L + V  CK+HV+++T FDI
Sbjct: 1657 SSGYESLRRDSEATGSASSAPDSMSESG-AASPGARTRSLKSPKKRATGLQRRRLIPAPLPDTTALGRKPSLPGQWVDLPPPLAGSLKEPFEIKVYEIDDVERLQRPRPTPREAPTQGLACVSTRLRLAERRQ-QRLREVQAKHKHLCEELAETQGRLMLEPGRWLEQFEVDPELEPESAEYLAALERATAALEQCVNLCKAHVMMVTCFDI 1866          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF26B (kinesin family member 26B [Source:HGNC Symbol;Acc:HGNC:25484])

HSP 1 Score: 307.76 bits (787), Expect = 1.074e-83
Identity = 182/420 (43.33%), Postives = 255/420 (60.71%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-------------GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            F T FS IL+ SPPP PP LL+           GK+KV++++           ++ S S   + VD  KKQIT+++  +    N+  +R N   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVRVSA+EV+GK+E L+DLLS++         SPGVYL +DP+ GTQLQNQSELRAPTAEKAA++LDAA+A+R       +E+D R SH  FTLH+YQYR+E+ +    ++GGRSRLH++D              GSG  LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++      A+++  IQ AS++ R+
Sbjct:   35 FATSFSGILQTSPPPAPPCLLRAVNKVKDTPGLGKVKVMLRICSTLA------RDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRGNQVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVN---------------------------GSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISAAVGSYAETLSTIQIASRVLRM 420          

HSP 2 Score: 64.3142 bits (155), Expect = 2.964e-9
Identity = 69/216 (31.94%), Postives = 108/216 (50.00%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSESSLGVAPRA---QTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSP---VSVR------KLSPKT--------SHKTPPNDQLKRE-----------NEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSW--SYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES++RDSE     SS  DSTSE+S  V  R    +TP+K+ +  S       R  P  S +TS   + P     VR      + SP+          ++    ++L+R            N   KI +  Q ++I ++ A+ + L  EL  +K+ +++DP  W   +DL  V ++D  +  ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1514 SSGYESVMRDSEATGSASSAQDSTSENSSSVGGRCRSLKTPKKRSNPGSQRR----RLIPALSLDTSSPVRKPPNSTGVRWVDGPLRSSPRGLGEPFEIKVYEIDDVERLQRRRGGASKEAMCFNAKLKILEHRQ-QRIAEVRAKYEWLMKELEATKQYLMLDPNKWLSEFDLEQVWELDSLE--YLEALECVTERLESRVNFCKAHLMMITCFDI 1722          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF26B (kinesin family member 26B [Source:HGNC Symbol;Acc:HGNC:25484])

HSP 1 Score: 308.145 bits (788), Expect = 1.168e-83
Identity = 182/420 (43.33%), Postives = 255/420 (60.71%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-------------GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            F T FS IL+ SPPP PP LL+           GK+KV++++           ++ S S   + VD  KKQIT+++  +    N+  +R N   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVRVSA+EV+GK+E L+DLLS++         SPGVYL +DP+ GTQLQNQSELRAPTAEKAA++LDAA+A+R       +E+D R SH  FTLH+YQYR+E+ +    ++GGRSRLH++D              GSG  LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++      A+++  IQ AS++ R+
Sbjct:  262 FATSFSGILQTSPPPAPPCLLRAVNKVKDTPGLGKVKVMLRICSTLA------RDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRGNQVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVN---------------------------GSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISAAVGSYAETLSTIQIASRVLRM 647          

HSP 2 Score: 64.6994 bits (156), Expect = 2.494e-9
Identity = 69/216 (31.94%), Postives = 108/216 (50.00%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSESSLGVAPRA---QTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSP---VSVR------KLSPKT--------SHKTPPNDQLKRE-----------NEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSW--SYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES++RDSE     SS  DSTSE+S  V  R    +TP+K+ +  S       R  P  S +TS   + P     VR      + SP+          ++    ++L+R            N   KI +  Q ++I ++ A+ + L  EL  +K+ +++DP  W   +DL  V ++D  +  ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1741 SSGYESVMRDSEATGSASSAQDSTSENSSSVGGRCRSLKTPKKRSNPGSQRR----RLIPALSLDTSSPVRKPPNSTGVRWVDGPLRSSPRGLGEPFEIKVYEIDDVERLQRRRGGASKEAMCFNAKLKILEHRQ-QRIAEVRAKYEWLMKELEATKQYLMLDPNKWLSEFDLEQVWELDSLE--YLEALECVTERLESRVNFCKAHLMMITCFDI 1949          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF26B (kinesin family member 26B [Source:HGNC Symbol;Acc:HGNC:25484])

HSP 1 Score: 308.145 bits (788), Expect = 1.315e-83
Identity = 182/420 (43.33%), Postives = 255/420 (60.71%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-------------GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            F T FS IL+ SPPP PP LL+           GK+KV++++           ++ S S   + VD  KKQIT+++  +    N+  +R N   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVRVSA+EV+GK+E L+DLLS++         SPGVYL +DP+ GTQLQNQSELRAPTAEKAA++LDAA+A+R       +E+D R SH  FTLH+YQYR+E+ +    ++GGRSRLH++D              GSG  LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++      A+++  IQ AS++ R+
Sbjct:  416 FATSFSGILQTSPPPAPPCLLRAVNKVKDTPGLGKVKVMLRICSTLA------RDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRGNQVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVN---------------------------GSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISAAVGSYAETLSTIQIASRVLRM 801          

HSP 2 Score: 64.3142 bits (155), Expect = 2.791e-9
Identity = 69/216 (31.94%), Postives = 108/216 (50.00%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSESSLGVAPRA---QTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSP---VSVR------KLSPKT--------SHKTPPNDQLKRE-----------NEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSW--SYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES++RDSE     SS  DSTSE+S  V  R    +TP+K+ +  S       R  P  S +TS   + P     VR      + SP+          ++    ++L+R            N   KI +  Q ++I ++ A+ + L  EL  +K+ +++DP  W   +DL  V ++D  +  ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1895 SSGYESVMRDSEATGSASSAQDSTSENSSSVGGRCRSLKTPKKRSNPGSQRR----RLIPALSLDTSSPVRKPPNSTGVRWVDGPLRSSPRGLGEPFEIKVYEIDDVERLQRRRGGASKEAMCFNAKLKILEHRQ-QRIAEVRAKYEWLMKELEATKQYLMLDPNKWLSEFDLEQVWELDSLE--YLEALECVTERLESRVNFCKAHLMMITCFDI 2103          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: vab-8 (Kinesin-like protein vab-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21441])

HSP 1 Score: 73.1738 bits (178), Expect = 2.183e-12
Identity = 84/310 (27.10%), Postives = 139/310 (44.84%), Query Frame = 3
Query: 1263 FDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKF 2192
            FD ++  D    ++ +  L+D I SV +G D  V + G      +  + G+     + GL+  AI+ L   + + K+ +  R  VR+SAI V   +  + DLLS      N       V + DD  +G  + N+SE+R  T ++A +YL+ A+  R M  +E   R SH   +L +Y Y++     G  + GGR RL  LD G G    + + +N  +T         P+  + L                +HIP R S + QL+R A+S+    T + +  A +     D+  I   A K+ R + +  
Sbjct:   57 FDHIFRTDATQDDMYTAFLSDTINSVFAGNDATVLAMGAKTNGKDERLYGN--SVSRNGLVQMAITQLMNALDDNKD-SEERIQVRMSAIMVSQNESSIVDLLSPF----NPDPRHRVVKIVDDARTGVFIDNESEIRVETIDQALFYLNTAVDHR-MIQDEHTHRTSHVFISLSLYSYKM-----GDKMQGGRRRLCFLDMGIG----ERNSTNGGMT--------MPALGSILLAMVQR---------NKHIPSRDSSVCQLIRCALSTSRFTTFVFSFGAKSD----DNENIAHLACKIARTRAKSM 328          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-11 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:E5QCG4])

HSP 1 Score: 67.3958 bits (163), Expect = 8.607e-11
Identity = 72/317 (22.71%), Postives = 146/317 (46.06%), Query Frame = 3
Query: 1251 KIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTM---SFNEEDTRLSHFLFTLHVYQYRV-ERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSN---KEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            K + FDA+Y ++   ++L      D++ SV++G +  +F++G         M G      + G+I   I  +F  +     +    + VR S +E+Y  QE L+DLL          + +  + +++ P  G  +++ +     T  +    +      R++   + NE  +R SH +F + V   R+ E G +   V     RL+++D       S+T  +    KE T  + S     +  +AL  + +A           HIPYR SKL++LL++++   + +T MVA +   + +  +++  +++A++ + +K
Sbjct:   58 KDFTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMAASHNQ---EYLVRASYLEIY--QEELRDLLE--------AESNKKLEIKERPDGGVYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSR-SHAIFIITVECSRIGEDGESHITVG----RLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSA-----------HIPYRDSKLTRLLQDSLGG-NSKTVMVACIGPASYNFEETLGTLRYANRAKNIK 344          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 65.4698 bits (158), Expect = 3.848e-10
Identity = 72/328 (21.95%), Postives = 150/328 (45.73%), Query Frame = 3
Query: 1230 RVNANIP----KIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLS--DIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSN---KEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR 2186
            +VN N P    K + FD  Y  D    ++ ++ +  ++++V+ G +G VF++G         M G +    + G+IP A   +F      +     +F V  S +E+Y ++  ++DLL   + + ++   Q   GVY     V+G  +    ++  P  ++                N++ +R SH +FT++V         TGS   G   +L+++D       S+T  +    KE T  + S             +    +   +    +HIPYR SKL++LL++++   + +T M+A V+ ++ +  +++  +++A++ + +K +
Sbjct:    7 QVNLNAPDGAAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTE---NVKFLVHCSYLEIYNEE--VRDLLGADNKQKLEIKEQPDRGVY-----VAGLSMHVCHDV--PACKELMTRGFNNRHVGATLMNKDSSR-SHSIFTVYVEGMT----ETGSIRMG---KLNLVDLAGSERQSKTGATGDRLKEATKINLS-----------LSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGG-NTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNK 302          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 65.0846 bits (157), Expect = 5.015e-10
Identity = 72/328 (21.95%), Postives = 150/328 (45.73%), Query Frame = 3
Query: 1230 RVNANIP----KIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLS--DIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSN---KEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR 2186
            +VN N P    K + FD  Y  D    ++ ++ +  ++++V+ G +G VF++G         M G +    + G+IP A   +F      +     +F V  S +E+Y ++  ++DLL   + + ++   Q   GVY     V+G  +    ++  P  ++                N++ +R SH +FT++V         TGS   G   +L+++D       S+T  +    KE T  + S             +    +   +    +HIPYR SKL++LL++++   + +T M+A V+ ++ +  +++  +++A++ + +K +
Sbjct:   35 QVNLNAPDGAAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTE---NVKFLVHCSYLEIYNEE--VRDLLGADNKQKLEIKEQPDRGVY-----VAGLSMHVCHDV--PACKELMTRGFNNRHVGATLMNKDSSR-SHSIFTVYVEGMT----ETGSIRMG---KLNLVDLAGSERQSKTGATGDRLKEATKINLS-----------LSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGG-NTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNK 330          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: unc-116 (Kinesin heavy chain [Source:UniProtKB/Swiss-Prot;Acc:P34540])

HSP 1 Score: 58.151 bits (139), Expect = 6.256e-8
Identity = 67/286 (23.43%), Postives = 126/286 (44.06%), Query Frame = 3
Query: 1251 KIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMV 2099
            K+Y FD V+  +    ++   A   I+Q V+SG +G VF++G         M G        G+IP  ++ +F  I    E    +F ++VS  E+Y   E ++DLL D E ++        + + +D      ++  +E      ++    ++   + R ++    NE  +R SH +F + V Q   E  TT   + G   +L+++D      +S+T       T  + +K     N      +    +       + H+PYR SKL+++L+E++   S  T ++
Sbjct:   47 KVYVFDKVFKPNTTQEQVYKGAAYHIVQDVLSGYNGTVFAYGQTSSGKTHTMEGVIGDNGLSGIIPRIVADIFNHIYSMDE--NLQFHIKVSYYEIYN--EKIRDLL-DPEKVN--------LSIHEDKNRVPYVKGATERFVGGPDEVLQAIEDGKSNRMVAVTNMNEHSSR-SHSVFLITVKQ---EHQTTKKQLTG---KLYLVDLAGSEKVSKTGAQG---TVLEEAK-----NINKSLTALGIVISALAEGTKSHVPYRDSKLTRILQESLGGNSRTTVII 304          
BLAST of Kinesin protein vs. Ensembl Fly
Match: CG14535 (gene:FBgn0031955 transcript:FBtr0343421)

HSP 1 Score: 197.593 bits (501), Expect = 1.453e-50
Identity = 156/512 (30.47%), Postives = 251/512 (49.02%), Query Frame = 3
Query:  987 FSEILKNSPPPVPPTLLKTSLTRPLGC-NTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTP-----RRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTR------------KLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQC--SPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRL--------SHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS----GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFIL 2426
            F   L+ +PPP+PPTL++   +R   C   GK+KV++++   + +   +  +       + +D  K+Q+T+ +  +A   P     R      PK++AFD ++T +D  +++C++AL+++I +V+ G DGC+ + G+        ++G                   LG  PCAI+WL++ I E+++K+GARFSVRVSA+ V   +    D LS   +I +  +   SPG+YLRDD + G      +ELRAPTAE+AA +LD+ALA R  S     +          S  +FTLHVYQY + R      VAGGRSRLH++D G        L  + + N  +                            +++GQRH P++   L+ LL++ ++ ++C   +VAHV    ++  D++  IQ AS++ RL+RRK       +                       G + G   NG ++      SSSE S DTVIY+G + +    EH    L
Sbjct:   15 FCGALQRAPPPMPPTLIRRLSSRE--CYGVGKVKVMLRVADRDRNSGGTEPDF------MALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFAFDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSGVACSLGAAPCAIAWLYKGIQERRQKSGARFSVRVSAVGVSATK---PDALSQDLLISHAAESDDSPGIYLRDDFLGGP-----TELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVYQYSLSR---KGGVAGGRSRLHIIDLGGCANRNGGLPLSGIGNILLA---------------------------ILSGQRHPPHKDHPLTPLLKDCLAPITCHVAIVAHVRPEQSY-QDALSTIQIASRIHRLRRRKHRVPMPLA----------------------VGLAQGLGGNGSSAGSGADPSSSEISADTVIYMGPNDDATDGEHPPVYL 457          
BLAST of Kinesin protein vs. Ensembl Fly
Match: CG14535 (gene:FBgn0031955 transcript:FBtr0079564)

HSP 1 Score: 197.593 bits (501), Expect = 1.453e-50
Identity = 156/512 (30.47%), Postives = 251/512 (49.02%), Query Frame = 3
Query:  987 FSEILKNSPPPVPPTLLKTSLTRPLGC-NTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTP-----RRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTR------------KLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQC--SPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRL--------SHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS----GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFIL 2426
            F   L+ +PPP+PPTL++   +R   C   GK+KV++++   + +   +  +       + +D  K+Q+T+ +  +A   P     R      PK++AFD ++T +D  +++C++AL+++I +V+ G DGC+ + G+        ++G                   LG  PCAI+WL++ I E+++K+GARFSVRVSA+ V   +    D LS   +I +  +   SPG+YLRDD + G      +ELRAPTAE+AA +LD+ALA R  S     +          S  +FTLHVYQY + R      VAGGRSRLH++D G        L  + + N  +                            +++GQRH P++   L+ LL++ ++ ++C   +VAHV    ++  D++  IQ AS++ RL+RRK       +                       G + G   NG ++      SSSE S DTVIY+G + +    EH    L
Sbjct:   15 FCGALQRAPPPMPPTLIRRLSSRE--CYGVGKVKVMLRVADRDRNSGGTEPDF------MALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFAFDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSGVACSLGAAPCAIAWLYKGIQERRQKSGARFSVRVSAVGVSATK---PDALSQDLLISHAAESDDSPGIYLRDDFLGGP-----TELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVYQYSLSR---KGGVAGGRSRLHIIDLGGCANRNGGLPLSGIGNILLA---------------------------ILSGQRHPPHKDHPLTPLLKDCLAPITCHVAIVAHVRPEQSY-QDALSTIQIASRIHRLRRRKHRVPMPLA----------------------VGLAQGLGGNGSSAGSGADPSSSEISADTVIYMGPNDDATDGEHPPVYL 457          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 87.4261 bits (215), Expect = 8.343e-17
Identity = 86/373 (23.06%), Postives = 176/373 (47.18%), Query Frame = 3
Query: 1080 IKVIIKLKYLETSKPESHQNISPSQM-CITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQ--EIL-KDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR 2186
            ++V+++      ++P     +S   +  I+VD   + ITV + ++  + P       PK Y FD V+    +  +L  +    I+  V+ G +G + ++G         M G+    +  G+IP A + +F  I + KE    +F VRVS +E+Y ++  ++L KD+   +EV +   +   GV+++D  +SG  + N  +L     E      +   A      N+E +R SH +F++ V +  +  G       G   +L ++D       S+T  S + +   +++K +   +     +SA             HIPYR SKL++LL++++   + +T M A ++   ++  +++  +++AS+ + ++ R
Sbjct:   21 VRVVVR------TRPMDKNELSAGALSAISVDKINRAITVMKPNATANEP-------PKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKE--NQKFLVRVSYMEIYNEEVRDLLGKDVGKSLEVKE---RPDIGVFVKD--LSGYVVHNADDL-----ENIMRLGNKNRAVGATKMNQESSR-SHAIFSITVERSELGEGDVQHVRMG---KLQLVDLAGSERQSKTQASGQRL--KEATKINLSLSVLGNVISALVDGKST------HIPYRNSKLTRLLQDSLGG-NSKTVMCATISPADSNYMETISTLRYASRAKNIQNR 355          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0332129)

HSP 1 Score: 69.707 bits (169), Expect = 2.310e-11
Identity = 72/313 (23.00%), Postives = 137/313 (43.77%), Query Frame = 3
Query: 1251 KIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSF---NEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            K++ +DA Y      T L    +  ++ SV+ G +GC+F++G         M G       +G+IP     ++  I         +F V VS +E+Y   E L+DLL        V +   GVY          + N   +   + E     +      RT+ F   NE  +R SH +F + +     E  T          +L+++D       S+T  S + +   ++SK +   +S    +SA A           H+PYR SKL++LL++++   + +T M+A++  +  +  +++  +++AS+ + ++
Sbjct:   65 KVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHI---NRTENFQFLVDVSYLEIY--MEELRDLLKPNSKHLEVRERGSGVY----------VPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSR-SHAIFMIKIEMCDTETNTIKVG------KLNLIDLAGSERQSKTGASAERL--KEASKINLALSSLGNVISALAESSP-------HVPYRDSKLTRLLQDSLGG-NSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQ 345          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0076030)

HSP 1 Score: 69.707 bits (169), Expect = 2.310e-11
Identity = 72/313 (23.00%), Postives = 137/313 (43.77%), Query Frame = 3
Query: 1251 KIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSF---NEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            K++ +DA Y      T L    +  ++ SV+ G +GC+F++G         M G       +G+IP     ++  I         +F V VS +E+Y   E L+DLL        V +   GVY          + N   +   + E     +      RT+ F   NE  +R SH +F + +     E  T          +L+++D       S+T  S + +   ++SK +   +S    +SA A           H+PYR SKL++LL++++   + +T M+A++  +  +  +++  +++AS+ + ++
Sbjct:   65 KVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHI---NRTENFQFLVDVSYLEIY--MEELRDLLKPNSKHLEVRERGSGVY----------VPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSR-SHAIFMIKIEMCDTETNTIKVG------KLNLIDLAGSERQSKTGASAERL--KEASKINLALSSLGNVISALAESSP-------HVPYRDSKLTRLLQDSLGG-NSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQ 345          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif26ba (kinesin family member 26Ba [Source:ZFIN;Acc:ZDB-GENE-070521-4])

HSP 1 Score: 328.561 bits (841), Expect = 4.212e-90
Identity = 210/482 (43.57%), Postives = 297/482 (61.62%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHS---ANSTPRRVNAN--IPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSG-RILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASR----HKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            F T FS IL+ SPPP PP LL+           GK+KV++++       P S  + + S   + VD+ KKQ+T+ +  +    N T +R ++N   PK++AFDA ++ D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E KEKTGARFSVRVSA+EV+GK E LKDLLS++         SPGVYL +DP+ G QLQNQSELRAPTAEKAA++LDAA+A+R  S    +EE+ R SH LFTLH+YQYR+E+   G  ++GGRSRLH++D GS  ++LS+   S   +  + S+  +                +LALVNG +HIPY+ SKL+ LLRE++ +++CRT M+AH++ +  + ++++  +Q AS++ RLK++K       +S  S    S    R  R        +             SS+ +  SSSEQSCDTVIY+G
Sbjct:  433 FPTNFSGILQVSPPPAPPCLLRAVNKVKDTPGMGKVKVMVRVC------PSSPASTAESSSFLKVDSRKKQVTIMDPAANSQQNQTQKRASSNQAPPKMFAFDAAFSHDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQSLGIIPCAISWLFKLINECKEKTGARFSVRVSAVEVWGKDENLKDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRYSSKPDCDEEEHRNSHMLFTLHIYQYRMEKTGKG-GMSGGRSRLHLIDLGSCVKVLSKIRDSATGLCLSLSALGNV---------------ILALVNGSKHIPYKDSKLTMLLRESLGNMNCRTTMIAHISSSPNNFSETLSTLQIASRVLRLKKKKAKVTMQYTSSSSGGESSCEEGRMRRPTQLRTIHSRNVVDSEMPLLHLSSDPEDYSSSEQSCDTVIYVG 892          

HSP 2 Score: 63.5438 bits (153), Expect = 3.573e-9
Identity = 57/208 (27.40%), Postives = 98/208 (47.12%), Query Frame = 3
Query: 4812 SSGYESILRDSEVSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRS--APNRSEETSEDTQSPV---SVR----KLSPKTSHKTPPN-------DQLKRENEIKKIA-KQIQF------------EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES++RDSE +    S  +S    +         ++    S++   R    PN S +TS   + PV    VR     L P       P        D ++R    + I  K++ +            ++I ++ A+ D LK EL Q+K+ ++++P  W+ +  + +  + +   ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1917 SSGYESMIRDSEATGSTSSAQDSMSENSSSVSGRRSLKNSKKRSNTGSQRRRLIPNLSLDTSSPIRKPVISPGVRWVDGPLRPTQRGLAEPFEIKVFEIDDVERLQRRRTIGNKEVVYFSAKLKILEHRQQRISEVRAKYDWLKKELEQTKQHLMLEPEKWTTEFDLQQTFEVDSLEYLEALEFVTERLENRVNFCKAHLMMITCFDI 2124          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif26ab (kinesin family member 26Ab [Source:ZFIN;Acc:ZDB-GENE-100716-6])

HSP 1 Score: 327.405 bits (838), Expect = 9.925e-90
Identity = 213/492 (43.29%), Postives = 295/492 (59.96%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIK----LKYLETSKPESHQNISPSQMCITVDNTKKQITVFESH---SANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSF---NEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS +L+ SPPP PP LL+           GK+KV+++    L  +++S+         S   + VD  KKQ+T+++        S  RR     PK++AFDAV++ D    E+CS  + ++IQSVV+G DGC+F FGH++      MIG+D   + LG+ PCAISWLF+LI E+KEKTG RFSVRVSA+E+YGK E L+DLLSD+         SPGVYLR+DP+ GTQLQNQ ELRAPTAEKAA +LDAA+AAR+ +    +EED R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G  LS T L N  +                            L NG +H+PYR SKL+ LLR+++ +++CRT M+AH++ +  + A+S+  IQ AS++ R+ R+K SK + +SS   SSCD    RR    +  +    +         S+ DY+SSSEQSCDTVIY+G
Sbjct:  341 YPTNFSAVLQFSPPPAPPCLLRAGSKAKENPGMGKVKVMMRICPSLGVVDSSE---------SMSFLKVDMRKKQLTLYDPSLHTQPTSVHRRAVLPAPKMFAFDAVFSQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKVGKTYTMIGTDSSMQSLGIAPCAISWLFKLINERKEKTGTRFSVRVSAVEIYGKDESLQDLLSDVPTGSLQDGQSPGVYLREDPICGTQLQNQCELRAPTAEKAALFLDAAIAARSTNHPDADEEDRRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCEKVLCKSRDAGGGLCLSLTALGNVILA---------------------------LANGAKHVPYRDSKLTMLLRDSLGNINCRTTMIAHISDSPANYAESLTTIQLASRIHRM-RKKKSKYASSSSGGESSCDEGRIRRPPHLRPFHPRTVALDPDLPSFLSDPDYSSSSEQSCDTVIYVG 794          

HSP 2 Score: 67.0106 bits (162), Expect = 3.145e-10
Identity = 31/79 (39.24%), Postives = 50/79 (63.29%), Query Frame = 3
Query: 5115 EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIK 5351
            ++I DL A+   LK EL  +K R+++DP+ W+ +  V + +D E   ++EALE+ T  L   V  CKS V+++T FDI+
Sbjct: 1930 QQIRDLRAKHKTLKEELDDTKSRLMMDPSKWTGEFEVDQDLDQESQEYLEALEQATADLEYCVNLCKSRVMMVTCFDIR 2008          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif26ba (kinesin family member 26Ba [Source:ZFIN;Acc:ZDB-GENE-070521-4])

HSP 1 Score: 305.064 bits (780), Expect = 3.633e-83
Identity = 194/447 (43.40%), Postives = 279/447 (62.42%), Query Frame = 3
Query: 1080 IKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHS---ANSTPRRVNANI--PKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSG-RILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASR----HKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            +KV++++       P S  + + S   + VD+ KKQ+T+ +  +    N T +R ++N   PK++AFDA ++ D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E KEKTGARFSVRVSA+EV+GK E LKDLLS++         SPGVYL +DP+ G QLQNQSELRAPTAEKAA++LDAA+A+R  S    +EE+ R SH LFTLH+YQYR+E+   G  ++GGRSRLH++D GS  ++LS+   S   +  + S+  +                +LALVNG +HIPY+ SKL+ LLRE++ +++CRT M+AH++ +  + ++++  +Q AS++ RLK++K       +S  S    S    R  R        +             SS+ +  SSSEQSCDTVIY+G
Sbjct:   28 VKVMVRVC------PSSPASTAESSSFLKVDSRKKQVTIMDPAANSQQNQTQKRASSNQAPPKMFAFDAAFSHDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQSLGIIPCAISWLFKLINECKEKTGARFSVRVSAVEVWGKDENLKDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRYSSKPDCDEEEHRNSHMLFTLHIYQYRMEKTGKG-GMSGGRSRLHLIDLGSCVKVLSKIRDSATGLCLSLSALGNV---------------ILALVNGSKHIPYKDSKLTMLLRESLGNMNCRTTMIAHISSSPNNFSETLSTLQIASRVLRLKKKKAKVTMQYTSSSSGGESSCEEGRMRRPTQLRTIHSRNVVDSEMPLLHLSSDPEDYSSSEQSCDTVIYVG 452          

HSP 2 Score: 63.929 bits (154), Expect = 2.698e-9
Identity = 55/208 (26.44%), Postives = 98/208 (47.12%), Query Frame = 3
Query: 4812 SSGYESILRDSEVSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRS--APNRSEETSEDTQSPV--------------SVRKLSPKTSHKTPPNDQLKRENEIKKIA-KQIQF------------EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES++RDSE +    S  +S    +         ++    S++   R    PN S +TS   + PV              + R L+     K    D ++R    + I  K++ +            ++I ++ A+ D LK EL Q+K+ ++++P  W+ +  + +  + +   ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1477 SSGYESMIRDSEATGSTSSAQDSMSENSSSVSGRRSLKNSKKRSNTGSQRRRLIPNLSLDTSSPIRKPVISPGVRWVDGPLRPTQRGLAEPFEIKVFEIDDVERLQRRRTIGNKEVVYFSAKLKILEHRQQRISEVRAKYDWLKKELEQTKQHLMLEPEKWTTEFDLQQTFEVDSLEYLEALEFVTERLENRVNFCKAHLMMITCFDI 1684          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif26aa (kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GENE-041001-148])

HSP 1 Score: 300.442 bits (768), Expect = 7.960e-82
Identity = 180/401 (44.89%), Postives = 258/401 (64.34%), Query Frame = 3
Query:  987 FSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            FS  L+ SPP VPP LL+           GK+KV+++L   + S+     + S S   + VD  KKQ+T  E        R  +AN PK++ FDA++T D    E+CS  + ++IQSVV+G DGC+F FG      +  MIG D  T+ LG+ PCAISWLF+LI E+KEKTG RFS+RVSA+E+ G++E+L+DLL+D     +    S G+ LR+DPV G+QLQNQSELRA +AE+AA++LDAALAAR+ +     EED R SH LFTLH+ QYR+E+ ++ + ++G RSRLH+LD GS     ++DLS       D  +         LSL A   V+LAL NG +H+PYR SKL+ LLRE++ +++CRT M+AH++ +  +  +S+  +Q AS++ R++
Sbjct:   33 FSAALQLSPPAVPPCLLRAGAKVKDSPGMGKVKVMVRLCNAKGSR-----DTSESMSFLKVDAHKKQLTFCEPPMC---ARTASANAPKMFTFDAIFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGQANLGKSYTMIGRDSSTQSLGVAPCAISWLFKLIEERKEKTGTRFSIRVSAVEICGREEVLRDLLADFSAGTSQDSQSAGISLREDPVCGSQLQNQSELRAYSAERAAFFLDAALAARSTTRPDCKEEDRRNSHMLFTLHISQYRMEK-SSKAGMSGNRSRLHLLDLGS----CESDLSQTR----DGGR------GQCLSLGALGNVILALANGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDSPANYVESLTTVQLASRIHRMR 410          

HSP 2 Score: 63.1586 bits (152), Expect = 4.172e-9
Identity = 64/227 (28.19%), Postives = 108/227 (47.58%), Query Frame = 3
Query: 4812 SSGYESILRDSE----VSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPVSVRK---LSPKTSHKTPPND----------QLKRENEIKKIAKQIQF------------EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEI 5405
            SSGYES++RDSE     SS +DS SES  GV+  ++T   +  +  S+  ++ R  P    +TS   +   +  +   L P       P +          +L+R  E   + + +Q+            ++I +L A+ + LK EL  +K R+++DP+ W  +  V   +D E   +++AL + T  L   V  CKS V++ T FDI      +P + G S + E+
Sbjct: 1380 SSGYESMIRDSETTGSASSAHDSMSES--GVSTTSRTKASKSPKKRSNGLQRRRLIPAPLPDTSSLGRKVGAAGQWVDLPPLGGTIKEPFEIKVYEIDDVERLQRRKE--GLTEGLQYFNARLRMLEKRQQQIRELRAKHEKLKKELEDAKTRLMLDPSKWMGEFDVDPDLDQESHDYLQALAQATGDLEFCVNLCKSRVMMETCFDI-----AVPAIPGQSGQQEM 1597          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif26aa (kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GENE-041001-148])

HSP 1 Score: 300.056 bits (767), Expect = 1.672e-81
Identity = 180/401 (44.89%), Postives = 258/401 (64.34%), Query Frame = 3
Query:  987 FSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            FS  L+ SPP VPP LL+           GK+KV+++L   + S+     + S S   + VD  KKQ+T  E        R  +AN PK++ FDA++T D    E+CS  + ++IQSVV+G DGC+F FG      +  MIG D  T+ LG+ PCAISWLF+LI E+KEKTG RFS+RVSA+E+ G++E+L+DLL+D     +    S G+ LR+DPV G+QLQNQSELRA +AE+AA++LDAALAAR+ +     EED R SH LFTLH+ QYR+E+ ++ + ++G RSRLH+LD GS     ++DLS       D  +         LSL A   V+LAL NG +H+PYR SKL+ LLRE++ +++CRT M+AH++ +  +  +S+  +Q AS++ R++
Sbjct:  183 FSAALQLSPPAVPPCLLRAGAKVKDSPGMGKVKVMVRLCNAKGSR-----DTSESMSFLKVDAHKKQLTFCEPPMCA---RTASANAPKMFTFDAIFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGQANLGKSYTMIGRDSSTQSLGVAPCAISWLFKLIEERKEKTGTRFSIRVSAVEICGREEVLRDLLADFSAGTSQDSQSAGISLREDPVCGSQLQNQSELRAYSAERAAFFLDAALAARSTTRPDCKEEDRRNSHMLFTLHISQYRMEK-SSKAGMSGNRSRLHLLDLGS----CESDLSQTR----DGGR------GQCLSLGALGNVILALANGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDSPANYVESLTTVQLASRIHRMR 560          

HSP 2 Score: 62.7734 bits (151), Expect = 5.459e-9
Identity = 66/231 (28.57%), Postives = 106/231 (45.89%), Query Frame = 3
Query: 4812 SSGYESILRDSE----VSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPVSVRKLSPKTSH-KTPP-NDQLKRENEIK---------------KIAKQIQF------------EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEI 5405
            SSGYES++RDSE     SS +DS SES  GV+  ++T   +  +  S+  ++ R  P    +TS         RK+         PP    +K   EIK                + + +Q+            ++I +L A+ + LK EL  +K R+++DP+ W  +  V   +D E   +++AL + T  L   V  CKS V++ T FDI      +P + G S + E+
Sbjct: 1530 SSGYESMIRDSETTGSASSAHDSMSES--GVSTTSRTKASKSPKKRSNGLQRRRLIPAPLPDTSSLG------RKVGAAGQWVDLPPLGGTIKEPFEIKVYEIDDVERLQRRKEGLTEGLQYFNARLRMLEKRQQQIRELRAKHEKLKKELEDAKTRLMLDPSKWMGEFDVDPDLDQESHDYLQALAQATGDLEFCVNLCKSRVMMETCFDI-----AVPAIPGQSGQQEM 1747          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: cfh (complement factor H [Source:Xenbase;Acc:XB-GENE-981265])

HSP 1 Score: 304.679 bits (779), Expect = 1.191e-82
Identity = 198/459 (43.14%), Postives = 281/459 (61.22%), Query Frame = 3
Query: 1074 GKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSAN---STPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNV--GQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRAS--RHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            GK+K+++++   +       QN S S   + VD  KKQ+T+++  +     S  RR    +PK++AFD+V+  D    E+CS  + ++IQSVV+G DGC+F FGH+R   +  MIG D  T+ LG+IPCAISWLF+LI E+KEKTG RFS+RVSA+E++GK E LKDLL++ E   ++  GQ SPGVYLR+DP+ GTQLQNQSELRAPTAEKAA++LDAALAAR+ S    +EE+ R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G  LS T L N  +   +                           G +HIPYR SKL+ LL+E++ +++CRT M+AH++ +  +  +++  +Q AS++ R+K++K    S +S  +SS  +    RR    R                   S+ DY+SSSEQSCDTVIY+G
Sbjct:  274 GKVKIMVRICPFQ-----GPQNTSESMSFLKVDPRKKQVTLYDPSTCGPSVSVHRRAVVAVPKMFAFDSVFPQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVRLGKSYTMIGKDASTQSLGIIPCAISWLFKLINERKEKTGTRFSIRVSAVEIFGKDENLKDLLAE-EATGSLQDGQ-SPGVYLREDPICGTQLQNQSELRAPTAEKAAHFLDAALAARSTSRPDCDEEERRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCEKVLSKSRDGCGGLCLSLTALGNVILALVN---------------------------GAKHIPYRDSKLTMLLQESLGNINCRTTMIAHISDSPANYQETLSTVQLASRIHRMKKKKSKYASSSSGGESSCEEGR-VRRPPHIRPFHQRTVVLDPDFPTLGFHSDPDYSSSSEQSCDTVIYVG 696          

HSP 2 Score: 66.6254 bits (161), Expect = 5.898e-10
Identity = 31/81 (38.27%), Postives = 50/81 (61.73%), Query Frame = 3
Query: 5115 EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYI 5357
            +K+ D+ A+ ++LK EL ++K R+++ P  W     V   +D E   ++EALE+ T+ L   V  CKSHV+++T FDI  I
Sbjct: 1793 QKVKDVKAKYELLKQELEETKHRLMMHPHKWRGQFEVDPSLDKESQEYLEALEQVTEELELCVNVCKSHVMMVTCFDIGMI 1873          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: cfh (complement factor H [Source:Xenbase;Acc:XB-GENE-981265])

HSP 1 Score: 302.368 bits (773), Expect = 3.194e-82
Identity = 196/459 (42.70%), Postives = 281/459 (61.22%), Query Frame = 3
Query: 1074 GKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSAN---STPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNV--GQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEAD--YTSSSEQSCDTVIYLG 2381
            GK+K+++++   +       QN S S   + VD  KKQ+T+++  +     S  RR    +PK++AFD+V+  D    E+CS  + ++IQSVV+G DGC+F FGH+R   +  MIG D  T+ LG+IPCAISWLF+LI E+KEKTG RFS+RVSA+E++GK E LKDLL++ E   ++  GQ SPGVYLR+DP+ GTQLQNQSELRAPTAEKAA++LDAALAAR+ S    +EE+ R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G  LS T L N  +   +                           G +HIPYR SKL+ LL+E++ +++CRT M+AH++ +  +  +++  +Q AS++ R+K++K    S +S  +SS  +    RR    +  +                +D  Y+SSSEQSCDTVIY+G
Sbjct:   43 GKVKIMVRICPFQ-----GPQNTSESMSFLKVDPRKKQVTLYDPSTCGPSVSVHRRAVVAVPKMFAFDSVFPQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVRLGKSYTMIGKDASTQSLGIIPCAISWLFKLINERKEKTGTRFSIRVSAVEIFGKDENLKDLLAE-EATGSLQDGQ-SPGVYLREDPICGTQLQNQSELRAPTAEKAAHFLDAALAARSTSRPDCDEEERRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCEKVLSKSRDGCGGLCLSLTALGNVILALVN---------------------------GAKHIPYRDSKLTMLLQESLGNINCRTTMIAHISDSPANYQETLSTVQLASRIHRMKKKKSKYASSSSGGESSCEEGR-VRRPPHIRPFHQRTVVLDPDFPTLGFHSDPDYSSSSEQSCDTVIYVG 465          

HSP 2 Score: 67.0106 bits (162), Expect = 4.426e-10
Identity = 33/89 (37.08%), Postives = 54/89 (60.67%), Query Frame = 3
Query: 5091 KIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYI 5357
            KI  + + +K+ D+ A+ ++LK EL ++K R+++ P  W     V   +D E   ++EALE+ T+ L   V  CKSHV+++T FDI  I
Sbjct: 1539 KILLERRQQKVKDVKAKYELLKQELEETKHRLMMHPHKWRGQFEVDPSLDKESQEYLEALEQVTEELELCVNVCKSHVMMVTCFDIGMI 1627          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: gyg2 (glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708])

HSP 1 Score: 281.567 bits (719), Expect = 1.079e-75
Identity = 169/387 (43.67%), Postives = 241/387 (62.27%), Query Frame = 3
Query: 1074 GKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            GK+KV++++    T   ES    + S   +  D  KKQIT+++  S    N+  +R +   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVRVSA+EV+GK+E L+DLLS++         SPGVYL +DP+ G QLQNQSELRAPTAEKAA++LDAA+A+R  S    +E+D R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G+ LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++    +  +++  IQ AS++ R+
Sbjct:  279 GKVKVMVRI--CSTLVGES----ADSSSFLKADPRKKQITLYDPLSCSGQNAFQKRGSQIPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSSQRDCDEDDHRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKVLSKSRDGSTGQCLSLSALGNVILALVN---------------------------GSKHIPYKESKLTMLLRESLGNMNCRTTMIAHISAAAGNYTETLSTIQIASRVLRM 631          

HSP 2 Score: 54.6842 bits (130), Expect = 2.549e-6
Identity = 31/96 (32.29%), Postives = 58/96 (60.42%), Query Frame = 3
Query: 5064 QLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDL-HVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            ++ R N   KI +  Q ++I D+ A+ + L  EL  +K+ +++DP  W  +  ++++ ++     ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1669 EVSRNNSKIKILEHRQ-QRIADIRAKYEWLLKELEITKQFLMLDPNKWLSECKNLIDSIE-----YLEALECVTERLENRVNFCKAHLMMITCFDI 1758          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: gyg2 (glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708])

HSP 1 Score: 281.182 bits (718), Expect = 1.293e-75
Identity = 169/387 (43.67%), Postives = 241/387 (62.27%), Query Frame = 3
Query: 1074 GKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            GK+KV++++    T   ES    + S   +  D  KKQIT+++  S    N+  +R +   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVRVSA+EV+GK+E L+DLLS++         SPGVYL +DP+ G QLQNQSELRAPTAEKAA++LDAA+A+R  S    +E+D R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G+ LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++    +  +++  IQ AS++ R+
Sbjct:   50 GKVKVMVRI--CSTLVGES----ADSSSFLKADPRKKQITLYDPLSCSGQNAFQKRGSQIPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSSQRDCDEDDHRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKVLSKSRDGSTGQCLSLSALGNVILALVN---------------------------GSKHIPYKESKLTMLLRESLGNMNCRTTMIAHISAAAGNYTETLSTIQIASRVLRM 402          

HSP 2 Score: 58.9214 bits (141), Expect = 1.164e-7
Identity = 31/95 (32.63%), Postives = 56/95 (58.95%), Query Frame = 3
Query: 5064 QLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            ++ R N   KI +  Q ++I D+ A+ + L  EL  +K+ +++DP  W  +  + +  + +   ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1600 EVSRNNSKIKILEHRQ-QRIADIRAKYEWLLKELEITKQFLMLDPNKWLSEFDLEQTYEVDSIEYLEALECVTERLENRVNFCKAHLMMITCFDI 1693          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: gyg2 (glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708])

HSP 1 Score: 281.567 bits (719), Expect = 1.296e-75
Identity = 181/420 (43.10%), Postives = 255/420 (60.71%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            F T F  IL+  PPP PP LL+           GK+KV++++    T   ES    + S   +  D  KKQIT+++  S    N+  +R +   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVRVSA+EV+GK+E L+DLLS++         SPGVYL +DP+ G QLQNQSELRAPTAEKAA++LDAA+A+R  S    +E+D R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G+ LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++    +  +++  IQ AS++ R+
Sbjct:  416 FSTSFCGILQTCPPPAPPCLLRAVNKVKDNPGLGKVKVMVRI--CSTLVGES----ADSSSFLKADPRKKQITLYDPLSCSGQNAFQKRGSQIPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTAEKAAFFLDAAIASRRSSQRDCDEDDHRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKVLSKSRDGSTGQCLSLSALGNVILALVN---------------------------GSKHIPYKESKLTMLLRESLGNMNCRTTMIAHISAAAGNYTETLSTIQIASRVLRM 801          

HSP 2 Score: 59.3066 bits (142), Expect = 9.576e-8
Identity = 31/95 (32.63%), Postives = 56/95 (58.95%), Query Frame = 3
Query: 5064 QLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            ++ R N   KI +  Q ++I D+ A+ + L  EL  +K+ +++DP  W  +  + +  + +   ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1673 EVSRNNSKIKILEHRQ-QRIADIRAKYEWLLKELEITKQFLMLDPNKWLSEFDLEQTYEVDSIEYLEALECVTERLENRVNFCKAHLMMITCFDI 1766          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif26a (kinesin family member 26A [Source:MGI Symbol;Acc:MGI:2447072])

HSP 1 Score: 324.324 bits (830), Expect = 6.442e-89
Identity = 207/480 (43.12%), Postives = 297/480 (61.88%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKT-SLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRV----NANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS--GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRAS-RHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS  L+  PPPVPP LL+  S  +    + GK+KV++++   +       Q  + S   + VD+ KKQ+T+++  +       +     A +PK++AFDA++  D +  E+CS  + D++QSVVSG DGC+FSFGH+    +  MIG D   + LG++PCAISWLFRLI E+KE+ G RFS+RVSA+EV G  + L+DLL+++         SPGVYLR+DPV GTQLQNQ+ELRAPTAEKAA+YLDAALAAR+ S     EE  R SH LFTLHVYQYRVE+   G  ++GGRSRLH++D GS    +    + S   +  + S+                 +V+LALVNG +H+PYR  +L+ LLRE++++ +CRT M+AH++ +  H A+++  +Q A+++ RL+R+K    S +S  +SS  +    R    R     A       +    S + DY+SSSEQSCDTVIY+G
Sbjct:  329 YPTDFSGSLQLWPPPVPPCLLRAASKAKENPSSFGKVKVMLRIWPAQ-----GVQRSAESTSFLKVDSRKKQVTLYDPAAGPPGCAGLRHAPTAPVPKMFAFDAIFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIDERKERLGTRFSIRVSAVEVCGHDQSLRDLLAEVASGSLQDTQSPGVYLREDPVCGTQLQNQNELRAPTAEKAAFYLDAALAARSTSRAGCGEEARRSSHMLFTLHVYQYRVEKCGQG-GMSGGRSRLHLIDLGSCDAAVGRGGEASGGPLCLSLSA---------------LGSVILALVNGAKHVPYRDHRLTMLLRESLATTNCRTTMIAHISDSPAHHAETLSTVQLAARIHRLRRKKGKHASSSSGGESSCEEGRARRPPHLRPFHPRAVVLDPDRSAPGLSGDPDYSSSSEQSCDTVIYVG 787          

HSP 2 Score: 62.3882 bits (150), Expect = 7.740e-9
Identity = 57/218 (26.15%), Postives = 101/218 (46.33%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSES---SLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDT----------------QSPVSVRKLSPKTSHKTPPNDQLKRENEIK----------------KIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES++RDSE     SS  DS SES   SLG   R+    K+++             P+ +    + +                + P  ++        +   +    RENE K                ++A++ Q +++ ++ A++D L  EL +++ R++V+P  W     V  +++PE + ++ ALE+ T  L + V  CK+HV+++T FDI
Sbjct: 1649 SSGYESMIRDSEATGSASSAPDSMSESGTASLGARSRSLKSPKKRATGLQRRRLIPAPLPDAAALGRKPSLPGQWVDLPPPLAGSLKEPFEIKVYEIDDVERLQRHRLPLRENEAKPSQDAEKGPVCISSKLRLAERRQ-QRLQEVQAKRDHLCEELAETQGRLMVEPGRWLEQFEVDPELEPESAEYLVALEQATAALEQCVNLCKAHVMMVTCFDI 1865          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif26b (kinesin family member 26B [Source:MGI Symbol;Acc:MGI:2447076])

HSP 1 Score: 309.686 bits (792), Expect = 2.863e-84
Identity = 182/420 (43.33%), Postives = 258/420 (61.43%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-------------GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            F T FS IL+ SPPP PP LL+           GK+KV++++         S ++ S S   + VD  KKQIT+++  +    N+  +R +   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVR+SA+EV+GK+E L+DLLS++         SPGVYL +DP+ GTQLQNQSELRAPTAEKAA++LDAA+A+R       +E+D R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D              GSG  LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++   +  A+++  IQ AS++ R+
Sbjct:  416 FATSFSGILQTSPPPAPPCLLRAVNKVKDTPGMGKVKVMLRICST------SARDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRSSQVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGRDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRISAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSNQQDCDEDDHRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVN---------------------------GSKHIPYKESKLTMLLRESLGNVNCRTTMIAHISAAASSYAETLSTIQIASRVLRM 801          

HSP 2 Score: 60.077 bits (144), Expect = 3.700e-8
Identity = 30/80 (37.50%), Postives = 51/80 (63.75%), Query Frame = 3
Query: 5115 EKIYDLLAQQDMLKTELLQSKERILVDPTSW--SYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            ++I ++ A+ + L  EL  +K+ +++DP  W   +DL  V Q+D  +  ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 2030 QRIAEVRAKYEWLMKELEATKQYLMLDPNKWLREFDLEQVLQLDSLE--YLEALEGVTERLESRVNFCKAHLMMITCFDI 2107          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif26b (kinesin family member 26B [Source:MGI Symbol;Acc:MGI:2447076])

HSP 1 Score: 287.73 bits (735), Expect = 9.882e-78
Identity = 168/387 (43.41%), Postives = 242/387 (62.53%), Query Frame = 3
Query: 1074 GKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-------------GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            GK+KV++++         S ++ S S   + VD  KKQIT+++  +    N+  +R +   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVR+SA+EV+GK+E L+DLLS++         SPGVYL +DP+ GTQLQNQSELRAPTAEKAA++LDAA+A+R       +E+D R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D              GSG  LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++   +  A+++  IQ AS++ R+
Sbjct:    2 GKVKVMLRICST------SARDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRSSQVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGRDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRISAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSNQQDCDEDDHRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVN---------------------------GSKHIPYKESKLTMLLRESLGNVNCRTTMIAHISAAASSYAETLSTIQIASRVLRM 354          

HSP 2 Score: 59.6918 bits (143), Expect = 4.674e-8
Identity = 30/80 (37.50%), Postives = 51/80 (63.75%), Query Frame = 3
Query: 5115 EKIYDLLAQQDMLKTELLQSKERILVDPTSW--SYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            ++I ++ A+ + L  EL  +K+ +++DP  W   +DL  V Q+D  +  ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1583 QRIAEVRAKYEWLMKELEATKQYLMLDPNKWLREFDLEQVLQLDSLE--YLEALEGVTERLESRVNFCKAHLMMITCFDI 1660          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 76.6406 bits (187), Expect = 2.226e-13
Identity = 87/385 (22.60%), Postives = 178/385 (46.23%), Query Frame = 3
Query: 1053 RPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMC----ITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLS--DIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSA-VAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR 2186
            +P  C+   +KV+++ + L         N     MC    ++VD  +  ITV ++ S+N  P        K + FD V+  +    ++ +     II SV+ G +G +F++G         M G        G+IP + + +F  I   K +   RF VRVS +E+Y ++  ++DLL     + ++   +   GVY++D  +S   + N     A   ++         +    + NE  +R SH +FT+ +     E+G  G+  V  G  +LH++D       ++T  + + +   +++K +   ++    +SA             H+PYR SKL++LL++++   + +T M A++     +  +++  +++A++ + +K +
Sbjct:    8 KPESCDN--VKVVVRCRPL---------NEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPP--------KTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIA--KAEGDTRFLVRVSYLEIYNEE--VRDLLGKDQTQRLEVKERPDVGVYIKD--LSAYVVNN-----ADDMDRIMTLGHKNRSVGATNMNEHSSR-SHAIFTITIECS--EKGVDGNMHVRMG--KLHLVDLAGSERQAKTGATGQRL--KEATKINLSLSTLGNVISALVDGKST------HVPYRNSKLTRLLQDSLGG-NSKTMMCANIGPADYNYDETISTLRYANRAKNIKNK 348          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif3a (kinesin family member 3A [Source:MGI Symbol;Acc:MGI:107689])

HSP 1 Score: 76.6406 bits (187), Expect = 2.457e-13
Identity = 87/385 (22.60%), Postives = 178/385 (46.23%), Query Frame = 3
Query: 1053 RPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMC----ITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLS--DIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSA-VAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR 2186
            +P  C+   +KV+++ + L         N     MC    ++VD  +  ITV ++ S+N  P        K + FD V+  +    ++ +     II SV+ G +G +F++G         M G        G+IP + + +F  I   K +   RF VRVS +E+Y ++  ++DLL     + ++   +   GVY++D  +S   + N     A   ++         +    + NE  +R SH +FT+ +     E+G  G+  V  G  +LH++D       ++T  + + +   +++K +   ++    +SA             H+PYR SKL++LL++++   + +T M A++     +  +++  +++A++ + +K +
Sbjct:    8 KPESCDN--VKVVVRCRPL---------NEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPP--------KTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPGLRGVIPNSFAHIFGHIA--KAEGDTRFLVRVSYLEIYNEE--VRDLLGKDQTQRLEVKERPDVGVYIKD--LSAYVVNN-----ADDMDRIMTLGHKNRSVGATNMNEHSSR-SHAIFTITIECS--EKGVDGNMHVRMG--KLHLVDLAGSERQAKTGATGQRL--KEATKINLSLSTLGNVISALVDGKST------HVPYRNSKLTRLLQDSLGG-NSKTMMCANIGPADYNYDETISTLRYANRAKNIKNK 348          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q52KG5|KI26A_MOUSE (Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2)

HSP 1 Score: 324.324 bits (830), Expect = 4.506e-88
Identity = 207/480 (43.12%), Postives = 297/480 (61.88%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKT-SLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRV----NANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS--GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRAS-RHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS  L+  PPPVPP LL+  S  +    + GK+KV++++   +       Q  + S   + VD+ KKQ+T+++  +       +     A +PK++AFDA++  D +  E+CS  + D++QSVVSG DGC+FSFGH+    +  MIG D   + LG++PCAISWLFRLI E+KE+ G RFS+RVSA+EV G  + L+DLL+++         SPGVYLR+DPV GTQLQNQ+ELRAPTAEKAA+YLDAALAAR+ S     EE  R SH LFTLHVYQYRVE+   G  ++GGRSRLH++D GS    +    + S   +  + S+                 +V+LALVNG +H+PYR  +L+ LLRE++++ +CRT M+AH++ +  H A+++  +Q A+++ RL+R+K    S +S  +SS  +    R    R     A       +    S + DY+SSSEQSCDTVIY+G
Sbjct:  329 YPTDFSGSLQLWPPPVPPCLLRAASKAKENPSSFGKVKVMLRIWPAQ-----GVQRSAESTSFLKVDSRKKQVTLYDPAAGPPGCAGLRHAPTAPVPKMFAFDAIFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIDERKERLGTRFSIRVSAVEVCGHDQSLRDLLAEVASGSLQDTQSPGVYLREDPVCGTQLQNQNELRAPTAEKAAFYLDAALAARSTSRAGCGEEARRSSHMLFTLHVYQYRVEKCGQG-GMSGGRSRLHLIDLGSCDAAVGRGGEASGGPLCLSLSA---------------LGSVILALVNGAKHVPYRDHRLTMLLRESLATTNCRTTMIAHISDSPAHHAETLSTVQLAARIHRLRRKKGKHASSSSGGESSCEEGRARRPPHLRPFHPRAVVLDPDRSAPGLSGDPDYSSSSEQSCDTVIYVG 787          

HSP 2 Score: 62.3882 bits (150), Expect = 5.414e-8
Identity = 57/218 (26.15%), Postives = 101/218 (46.33%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSES---SLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDT----------------QSPVSVRKLSPKTSHKTPPNDQLKRENEIK----------------KIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES++RDSE     SS  DS SES   SLG   R+    K+++             P+ +    + +                + P  ++        +   +    RENE K                ++A++ Q +++ ++ A++D L  EL +++ R++V+P  W     V  +++PE + ++ ALE+ T  L + V  CK+HV+++T FDI
Sbjct: 1649 SSGYESMIRDSEATGSASSAPDSMSESGTASLGARSRSLKSPKKRATGLQRRRLIPAPLPDAAALGRKPSLPGQWVDLPPPLAGSLKEPFEIKVYEIDDVERLQRHRLPLRENEAKPSQDAEKGPVCISSKLRLAERRQ-QRLQEVQAKRDHLCEELAETQGRLMVEPGRWLEQFEVDPELEPESAEYLVALEQATAALEQCVNLCKAHVMMVTCFDI 1865          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q7TNC6|KI26B_MOUSE (Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3)

HSP 1 Score: 309.686 bits (792), Expect = 2.003e-83
Identity = 182/420 (43.33%), Postives = 258/420 (61.43%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-------------GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            F T FS IL+ SPPP PP LL+           GK+KV++++         S ++ S S   + VD  KKQIT+++  +    N+  +R +   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVR+SA+EV+GK+E L+DLLS++         SPGVYL +DP+ GTQLQNQSELRAPTAEKAA++LDAA+A+R       +E+D R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D              GSG  LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++   +  A+++  IQ AS++ R+
Sbjct:  416 FATSFSGILQTSPPPAPPCLLRAVNKVKDTPGMGKVKVMLRICST------SARDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRSSQVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGRDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRISAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSNQQDCDEDDHRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVN---------------------------GSKHIPYKESKLTMLLRESLGNVNCRTTMIAHISAAASSYAETLSTIQIASRVLRM 801          

HSP 2 Score: 60.077 bits (144), Expect = 2.588e-7
Identity = 30/80 (37.50%), Postives = 51/80 (63.75%), Query Frame = 3
Query: 5115 EKIYDLLAQQDMLKTELLQSKERILVDPTSW--SYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            ++I ++ A+ + L  EL  +K+ +++DP  W   +DL  V Q+D  +  ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 2030 QRIAEVRAKYEWLMKELEATKQYLMLDPNKWLREFDLEQVLQLDSLE--YLEALEGVTERLESRVNFCKAHLMMITCFDI 2107          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q9ULI4|KI26A_HUMAN (Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3)

HSP 1 Score: 308.531 bits (789), Expect = 4.088e-83
Identity = 209/478 (43.72%), Postives = 295/478 (61.72%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKT-SLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRV-NANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRAS-RHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS +L+  PPP PP LL+  S T+    + GK+KV++++   + +     Q  + +   + VD  KKQ+ +++  +    ++ PRR   A +PK++AFDAV+  D +  E+CS  + D++QSVVSG DGC+FSFGH+    +  MIG D   + LG++PCAISWLFRLI E++E+TG RFSVRVSA+EV G+ + L+DLL+++         SPGVYLR+DPV G QLQNQSELRAPTAEKAA+YLDAALAAR+ S     E+  R SH LFTLHVYQYR+E+      ++GGRSRLH++D GS    +                         LSLSA  +V+LALVNG +H+PYR  +L+ LLRE++++  CRT M+AHV+      A+++  +Q A+++ RL+R+K    S +S  +SS  +    R    R             T      + DY+SSSEQSCDTVIY+G
Sbjct:  336 YPTDFSGVLQLWPPPAPPCLLRAASKTKDNPGSIGKVKVMLRIWPAQGA-----QRSAEAMSFLKVDPRKKQVILYDPAAGPPGSAGPRRAATAAVPKMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFRLIEERRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPGSLQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRSSHMLFTLHVYQYRMEK-CGRGGMSGGRSRLHLIDLGSCEAAAGRAGEAAGGP-------------LCLSLSALGSVILALVNGAKHVPYRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAARIHRLRRKKAKYASSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYSSSSEQSCDTVIYVG 794          

HSP 2 Score: 64.6994 bits (156), Expect = 9.810e-9
Identity = 55/212 (25.94%), Postives = 101/212 (47.64%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPV----------------------------SVRKLS-PKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES+ RDSE     SS  DS SES    +P A+T   +  +  ++  ++ R  P    +T+   + P                              V +L  P+ + +  P   L   +   ++A++ Q +++ ++ A+   L  EL +++ R++++P  W     V  +++PE + ++ ALE+ T  L + V  CK+HV+++T FDI
Sbjct: 1657 SSGYESLRRDSEATGSASSAPDSMSESG-AASPGARTRSLKSPKKRATGLQRRRLIPAPLPDTTALGRKPSLPGQWVDLPPPLAGSLKEPFEIKVYEIDDVERLQRPRPTPREAPTQGLACVSTRLRLAERRQ-QRLREVQAKHKHLCEELAETQGRLMLEPGRWLEQFEVDPELEPESAEYLAALERATAALEQCVNLCKAHVMMVTCFDI 1866          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q2KJY2|KI26B_HUMAN (Kinesin-like protein KIF26B OS=Homo sapiens OX=9606 GN=KIF26B PE=1 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 6.316e-83
Identity = 182/420 (43.33%), Postives = 255/420 (60.71%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA---NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-------------GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRL 2177
            F T FS IL+ SPPP PP LL+           GK+KV++++           ++ S S   + VD  KKQIT+++  +    N+  +R N   PK++AFDAV+  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVRVSA+EV+GK+E L+DLLS++         SPGVYL +DP+ GTQLQNQSELRAPTAEKAA++LDAA+A+R       +E+D R SH  FTLH+YQYR+E+ +    ++GGRSRLH++D              GSG  LS + L N  +   +                           G +HIPY+ SKL+ LLRE++ +++CRT M+AH++      A+++  IQ AS++ R+
Sbjct:  416 FATSFSGILQTSPPPAPPCLLRAVNKVKDTPGLGKVKVMLRICSTLA------RDTSESSSFLKVDPRKKQITLYDPLTCGGQNAFQKRGNQVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAAIASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCVKALSKNREGGSGLCLSLSALGNVILALVN---------------------------GSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISAAVGSYAETLSTIQIASRVLRM 801          

HSP 2 Score: 64.3142 bits (155), Expect = 1.340e-8
Identity = 69/216 (31.94%), Postives = 108/216 (50.00%), Query Frame = 3
Query: 4812 SSGYESILRDSEV----SSQNDSTSESSLGVAPRA---QTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSP---VSVR------KLSPKT--------SHKTPPNDQLKRE-----------NEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSW--SYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            SSGYES++RDSE     SS  DSTSE+S  V  R    +TP+K+ +  S       R  P  S +TS   + P     VR      + SP+          ++    ++L+R            N   KI +  Q ++I ++ A+ + L  EL  +K+ +++DP  W   +DL  V ++D  +  ++EALE  T+ L  RV  CK+H+++IT FDI
Sbjct: 1895 SSGYESVMRDSEATGSASSAQDSTSENSSSVGGRCRSLKTPKKRSNPGSQRR----RLIPALSLDTSSPVRKPPNSTGVRWVDGPLRSSPRGLGEPFEIKVYEIDDVERLQRRRGGASKEAMCFNAKLKILEHRQ-QRIAEVRAKYEWLMKELEATKQYLMLDPNKWLSEFDLEQVWELDSLE--YLEALECVTERLESRVNFCKAHLMMITCFDI 2103          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q9VLW2|KI26L_DROME (Kinesin-like protein CG14535 OS=Drosophila melanogaster OX=7227 GN=CG14535 PE=2 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 1.457e-49
Identity = 156/512 (30.47%), Postives = 251/512 (49.02%), Query Frame = 3
Query:  987 FSEILKNSPPPVPPTLLKTSLTRPLGC-NTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTP-----RRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTR------------KLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQC--SPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRL--------SHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS----GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFIL 2426
            F   L+ +PPP+PPTL++   +R   C   GK+KV++++   + +   +  +       + +D  K+Q+T+ +  +A   P     R      PK++AFD ++T +D  +++C++AL+++I +V+ G DGC+ + G+        ++G                   LG  PCAI+WL++ I E+++K+GARFSVRVSA+ V   +    D LS   +I +  +   SPG+YLRDD + G      +ELRAPTAE+AA +LD+ALA R  S     +          S  +FTLHVYQY + R      VAGGRSRLH++D G        L  + + N  +                            +++GQRH P++   L+ LL++ ++ ++C   +VAHV    ++  D++  IQ AS++ RL+RRK       +                       G + G   NG ++      SSSE S DTVIY+G + +    EH    L
Sbjct:   15 FCGALQRAPPPMPPTLIRRLSSRE--CYGVGKVKVMLRVADRDRNSGGTEPDF------MALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFAFDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSGVACSLGAAPCAIAWLYKGIQERRQKSGARFSVRVSAVGVSATK---PDALSQDLLISHAAESDDSPGIYLRDDFLGGP-----TELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVYQYSLSR---KGGVAGGRSRLHIIDLGGCANRNGGLPLSGIGNILLA---------------------------ILSGQRHPPHKDHPLTPLLKDCLAPITCHVAIVAHVRPEQSY-QDALSTIQIASRIHRLRRRKHRVPMPLA----------------------VGLAQGLGGNGSSAGSGADPSSSEISADTVIYMGPNDDATDGEHPPVYL 457          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A1S3HWK5 (kinesin-like protein KIF26B OS=Lingula unguis OX=7574 GN=LOC106158841 PE=3 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 2.883e-111
Identity = 251/478 (52.51%), Postives = 323/478 (67.57%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFE---SHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVER-GTTGS--AVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRH--KGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGA 2384
            F T FSEI+  SPPP PP LL+T + R     TGK+KV++++   + S        + +   ++ D  KKQ+TV++   S  A S  RR  A  PK++AFD V++ DD  TE+CS++L+DIIQSVV+G DGC+F +GH +   +  MIG D   + LG++PCAI+WLFRLI EQK+KTGARFSVRVSA+EV GKQE L+DLLS +   +     SPGVYLR+DP+ GTQL+NQSELRAPTA+KAA+YLDAA AART   NEE++R SHFLFTLHVYQYRVE+ G TGS   VAGGRSRLH++D GSG      D S + ++                 LSA   V+LAL+NGQRH+P+R SKL+QLLREA+ SLSCR CM+AHV+    +  +++Q+IQ A+++ R++RR   K S  SSDDSSSCD  GF R  R   + G        S    ++S  DYTSSSEQSCDTVIY GA
Sbjct:  152 FPTRFSEIIHASPPPAPPCLLRT-VGRIQNPGTGKVKVMLRIAPTDIS--------NDTGSILSSDPRKKQVTVYDPSTSGYATSAHRRTGAAAPKMFAFDQVFSQDDSLTEICSSSLSDIIQSVVNGADGCLFCYGHSKLGKSYTMIGKDGSQQTLGIVPCAIAWLFRLINEQKDKTGARFSVRVSAVEVAGKQETLRDLLSQVASAETGSNTSPGVYLREDPICGTQLENQSELRAPTADKAAFYLDAACAARTTPDNEEESRTSHFLFTLHVYQYRVEKNGKTGSGAGVAGGRSRLHLIDLGSG--CKAKDSSGQALS-----------------LSALGNVILALLNGQRHVPHRDSKLTQLLREALGSLSCRACMIAHVSPTIRNYNETLQVIQLAARIHRMRRRTKVKFSSNSSDDSSSCDDSGFGRRMRPGIRMGTLREGIYYSNAVGSTSGEDYTSSSEQSCDTVIYTGA 601          

HSP 2 Score: 93.9745 bits (232), Expect = 4.631e-15
Identity = 70/209 (33.49%), Postives = 114/209 (54.55%), Query Frame = 3
Query: 4809 TSSGYESILRDSE-----VSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPVSVRK--LSPKTSHKTPPNDQLKRE---------NEIKKIAKQIQFE------------KIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIK 5351
            TSSGYES++RDS       SS +DS++ESS     R       +     ++S++S+SAP RS+ +        S ++   SPK    T   +  + E         ++++++ +    E            KI  L+ +Q  LK EL  +K++++VD ++WSYDL +  +M  +D  ++EALEKET IL +RV ACKSH++++T FDI+
Sbjct: 1603 TSSGYESMIRDSSEITCTSSSTHDSSNESSASGWIRGN-----RIFKKRTASRRSKSAPARSDNSPSSCPQSPSSQRCAASPKAWVDTRQAEGTRDEPFELKMYDVDDVERMQRARSRETSEQRELDGRRKKIQGLMDRQSELKQELANTKDKLMVDKSAWSYDLFLASEMQRDDPHYLEALEKETSILEKRVVACKSHIMMVTCFDIR 1806          
BLAST of Kinesin protein vs. TrEMBL
Match: K1PG80 (Kinesin-like protein KIF26A OS=Crassostrea gigas OX=29159 GN=CGI_10005796 PE=3 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 5.916e-102
Identity = 232/479 (48.43%), Postives = 320/479 (66.81%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTS--LTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSAN---STPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVG-QCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGS--AVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEAD-YTSSSEQSCDTVIYLGA 2384
            + T ++E++KN+PPP PP LL+ +  L +P     GK+KV++K+   E S  E       +Q C+++D  KKQ+TVF+  +     S+ RR     PK++AFDAV++ DD  TE+CS++LT+IIQ VV+G DGC+FS+G+ R   +  M+G+D   + LG++PCAI+WLFRLI EQKEKTGARFSVRVSA+EV GK E LKDLL+D+      G   +PGVYLR+DP+ GTQL+NQSELRAPTA++AAYYLDAALA+R    ++E+ R SH +FTLHVYQYR+E+        VAGGRSRLH++D GS         S+K   P + S          LSLSA   V++AL+NGQRH+P+R SK++QLLR+++  +SCRTCM+ HV+   +H  +++Q+IQ A+++ R++RRK    S +S D S+       RR    KG   G          + S+ D YTSSSEQSCDTVIY+GA
Sbjct:  441 YPTKYNEVIKNTPPPAPPCLLRAAGRLQQP---GIGKVKVMLKI-CTEGSHSEQ------AQSCLSIDPRKKQVTVFDPSTVGVTLSSHRRATPVAPKMFAFDAVFSPDDSQTEICSSSLTEIIQGVVNGADGCLFSYGYSRQGKSYTMMGNDVSAQSLGIMPCAIAWLFRLIDEQKEKTGARFSVRVSAVEVSGKNEQLKDLLADVAKYTEAGVGTAPGVYLREDPICGTQLENQSELRAPTADRAAYYLDAALASRAQ--DDEELRSSHIVFTLHVYQYRIEKANQAGLPGVAGGRSRLHLIDLGS---------SSKSKDPDNVS----------LSLSALGNVIMALLNGQRHVPHRDSKVAQLLRDSLGGVSCRTCMLVHVSSAVSHHNETLQVIQLAARIHRMRRRKTKFSSTSSDDSSTDDGR--LRRP--FKGCRMGTLREDILYHSSHSDPDYYTSSSEQSCDTVIYVGA 884          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A210PKW8 (Kinesin-like protein KIF26A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09819 PE=3 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 1.321e-101
Identity = 230/479 (48.02%), Postives = 312/479 (65.14%), Query Frame = 3
Query:  981 TCFSEILKNSPPPVPPTLLKTS--LTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTP----RRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEV-IDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGS--AVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR--KFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGA 2384
            T F EI++ +PPP PP LL+ +  L  P     GK+KV++K+       P +H     +   + +D  KKQ+TV++  +A  T     R      PK++AFDAV++ DD  TE+C+++LT+IIQ VV+G DGC+F++G+ +   +  M+G DQ    LG+IPCAI+WLFRLI EQKEKTGARFSVRVSA+EV GK E LKDLLSD+   +++    +PGVYLR+DP+ GTQL+NQSELRAPTAE+A YYLDAA+AART   +EE++R SH LFTLHVYQYR+E+        VAGGRSRLH++D GS         S+K   P + S          LSLSA   V++AL+NGQRH+P+R SK++QLLR+++ ++SCRTCM+AHV+    H  +++Q+IQ A+K+ R++RR  KFS  S   S          FR      G   G          + S+ D+TSSSEQSCDTVIY+GA
Sbjct:  640 TKFYEIIRMTPPPAPPCLLRMAGRLQTP---GVGKVKVMLKIC------PSTHYGEQGNSF-LAIDPRKKQVTVYDPTAAGFTTAAHRRTATTTAPKMFAFDAVFSPDDSQTEVCASSLTEIIQGVVNGADGCLFTYGYSKLGKSYTMVGQDQSAHTLGIIPCAIAWLFRLINEQKEKTGARFSVRVSAVEVTGKAECLKDLLSDVAAGVESGSGTAPGVYLREDPICGTQLENQSELRAPTAERATYYLDAAIAART-KLDEEESRSSHLLFTLHVYQYRIEKANQAGLPGVAGGRSRLHLIDLGS---------SSKSKDPGNVS----------LSLSALGNVIMALLNGQRHVPHRDSKVAQLLRDSLGNISCRTCMIAHVSSAVPHYNETLQVIQLAAKIHRMRRRKTKFSSTSSDDSSTDDGRLRRPFR------GFRMGTLREDILYTSSHSDPDHTSSSEQSCDTVIYVGA 1082          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A2C9MAD6 (Kinesin motor domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106057963 PE=3 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 5.591e-100
Identity = 235/479 (49.06%), Postives = 326/479 (68.06%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSAN---STPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIE---VIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGS---AVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGA 2384
            F T FS++++ +PPP PP LL+T + R      GK+KV++K+     S+ E   +       ++ D  KKQ+TVF+  ++    S  RR  A +PK++AFD+VYT DD  TELC+ +LT+I+Q+VV+G DGC+F++G+ +      M GSDQ    LG++PCAI+WLF+LI EQK+KTGARFSVRVSA++V GK+E L+DLL DI        VG  +P VYLR+DP+ GTQL+NQSELRAPTAEKAAYYLDAALAAR  + +E++ R S+ LFTL+VYQYR+E+  T +    VAGGRSRLH++D G+         ++K   P + S          LSLSA   V++AL+NGQRH+P+R SK++QLLR+++ +LSCRTCM+AHV+    H  +++Q+IQ A+++ R+KRR+ +K S TSS+DSS+     FRR   ++G   G          + S+ DYTSSSEQSCDTVIYLGA
Sbjct:  604 FPTNFSDVIRLTPPPAPPCLLRT-VGRLQNPGMGKVKVMLKICNATGSQGEQGASF------LSPDPRKKQVTVFDPTASGYMTSANRRAGAAVPKMFAFDSVYTPDDSLTELCAGSLTEILQAVVAGADGCLFTYGYSKLGKTYTMTGSDQSPSTLGIMPCAIAWLFKLINEQKDKTGARFSVRVSAVQVTGKEETLRDLLIDIAQGTEATGVG-TAPSVYLREDPICGTQLENQSELRAPTAEKAAYYLDAALAARCTT-DEDEGRSSNILFTLNVYQYRIEKSNTKAGLPGVAGGRSRLHLIDLGT---------ASKSKDPNNVS----------LSLSALGNVIMALLNGQRHVPHRDSKIAQLLRDSLGNLSCRTCMIAHVSSAVPHYNETLQVIQLAARIHRMKRRR-TKFSSTSSEDSSTDGDVKFRRP--YRGLRMGTLREDVLYSSSHSDPDYTSSSEQSCDTVIYLGA 1051          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A183A9Y3 (Kinesin motor domain-containing protein OS=Echinostoma caproni OX=27848 PE=3 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.885e-99
Identity = 268/721 (37.17%), Postives = 365/721 (50.62%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNT-GKIKVII---------KLKYLETSKPESHQNISPSQMCITVDNTKKQITVFE---SHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFG-------HL---------RGSSNLIMIGSDQQTR-KLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLL-SDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRL--------------------SHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTD------SSKPDFPXXXXXXXXXXXXXXXXXXXX--------GQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXX---------------------------XXXXXFGFRRASR---HKGGNA---------GFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKRRISAPSFSNAIPERSGSESDLLKLDIXXXXXXXXXXXXATV---------------------------------------RTNALVWPKVAAKNAIETLSTQKEMWVDGPMV------SNKTKTQSPESA 2690
              T F++ + + PPP PPTL K     P G +T GK  +           ++K +    P    + S +  C+TVD  +KQ+ + +   S + ++T RR     PK ++ DAV+T++D   ELCS ALTDI+Q+VV+G DGC+ S G       H+           ++   MIG D++     GL+PCAI+WLFRLI EQKE+TGARFSVRVSA+E+ G+ E L+DLL S  +  D  G  +P VYLR+DP+SG QL+NQSELRAPTAEKAA++LD ALAA+T     E +                      SH  FTLHVYQYRVE+   GS VAGGRSRLH++D  + R+  + +++  +   T       + KP+          + T A+  + +         GQRH+P+R SKL+QLLREAM S++C+TC+V     +    A+++Q++QF  K+QRL+RR+     G++   +                           SSCDSF  RRA+R   H G  A         G  S     G TSSE DYTSSSEQSCDTVI+LG  R+ G D H       R   A   S ++PE     SD  K           Q S  +V                                       RTNA  WP+ AA+NA+E LSTQKE W+DGP        S+++ T  PE A
Sbjct:   27 LRTAFADAIHHQPPPAPPTLFKQP---PPGSHTEGKDDLAFDKVFPIYSTQVKVVLHVHPSVKSSGSETPPCLTVDRRRKQVGLIDPNLSQTISATQRRAGVGAPKFFSLDAVFTEEDSLAELCSFALTDIVQAVVNGCDGCLISLGSGNSYKPHISTAATTTTTTTATITTMIGEDKRGPIGFGLLPCAIAWLFRLISEQKERTGARFSVRVSAVELVGEDESLRDLLTSAAQASDAAGANAPSVYLREDPISGMQLENQSELRAPTAEKAAFFLDCALAAQTHQTCPEISSADIDESGPGESEQSVPRAEVPSHLFFTLHVYQYRVEKSGCGSGVAGGRSRLHLIDLHNSRLGKEQNVTVDDAPQTADDHGPVAGKPEVQDTQAIPRQTTTNALTTSAIQSVILALINGQRHLPHRDSKLTQLLREAMGSVTCQTCLVVQTTSSAAQHAETLQMLQFTHKVQRLRRRRALVPKGSAISQAWCHDYNGQNVQHSFIGTNPNNTSSEDSSSCDSFALRRATRLRMHMGLRAAVRRSGLSKGIGSRHKPGGTTSSELDYTSSSEQSCDTVIFLG--RHNGTDTHLGGARSSRTRMAQIVSGSVPEAQSDHSDNEKQTQHASGVGGDQKSTGSVEHPDLADSKPHTGRTHRRGSVPSADNSGPRGPDVKKTLPRTNAHAWPRAAARNAVEILSTQKEQWIDGPKANFKPVKSSESGTAQPELA 742          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:103039212])

HSP 1 Score: 336.265 bits (861), Expect = 1.409e-92
Identity = 219/488 (44.88%), Postives = 294/488 (60.25%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESH---SANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS I++ SPPP PP LL+           GK+KV++++           Q  S S   + VD  KKQ+T++E        +  RR     PK++AFDAV+T D    E+CS  + ++IQSVV+G DGC+F FGH++      MIG D   + LG+ PCAISWLF+LI E+KEKTG RFSVRVSA+E+YGK E L+DLLSD+         SPGVYLR+DP+ GTQLQNQSELRAPTAEKAA++LDAA+AAR+ S    +EED R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G  LS T L N  +                            L NG +H+PYR SKL+ LLR+++ +++CRT M+AHV+ +  H ADS+  IQ AS++ R+ R+K SK + +SS   SSCD    RR    +  +    +      +  S+ DY+SSSEQSCDTVIY+G
Sbjct:  335 YPTNFSSIIQLSPPPAPPCLLRAGSKAKENPGMGKVKVMMRI-----CPSLGVQESSDSMSFLKVDQRKKQLTLYEPSLLAQPTAAHRRTPLAAPKMFAFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKLGKTYTMIGKDSSAQSLGIAPCAISWLFKLISERKEKTGTRFSVRVSAVEIYGKDESLQDLLSDVSSGSLQDGQSPGVYLREDPICGTQLQNQSELRAPTAEKAAHFLDAAIAARSTSRPDADEEDRRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCEKVLSKSRDGGGGLCLSLTALGNVILA---------------------------LANGAKHVPYRDSKLTMLLRDSLGNINCRTTMIAHVSDSPAHYADSLTTIQLASRIHRV-RKKKSKYASSSSGGESSCDEGRIRRPPHLRPFHPRTVALDPDLPLLLSDPDYSSSSEQSCDTVIYVG 788          

HSP 2 Score: 66.2402 bits (160), Expect = 3.734e-10
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 3
Query: 5118 KIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIK 5351
            +I +L  + + LK EL  +K R+++DP+ W  +  V + +DPE   ++EALE+ T  L   V  CKS V+++T FDI+
Sbjct: 1938 QIKELRVKHETLKEELEDTKARLMMDPSKWMGEFDVDQDLDPESQEYLEALEQATSELEYCVNLCKSRVMMVTCFDIR 2015          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:103039212])

HSP 1 Score: 335.88 bits (860), Expect = 1.635e-92
Identity = 219/488 (44.88%), Postives = 294/488 (60.25%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESH---SANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS I++ SPPP PP LL+           GK+KV++++           Q  S S   + VD  KKQ+T++E        +  RR     PK++AFDAV+T D    E+CS  + ++IQSVV+G DGC+F FGH++      MIG D   + LG+ PCAISWLF+LI E+KEKTG RFSVRVSA+E+YGK E L+DLLSD+         SPGVYLR+DP+ GTQLQNQSELRAPTAEKAA++LDAA+AAR+ S    +EED R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G  LS T L N  +                            L NG +H+PYR SKL+ LLR+++ +++CRT M+AHV+ +  H ADS+  IQ AS++ R+ R+K SK + +SS   SSCD    RR    +  +    +      +  S+ DY+SSSEQSCDTVIY+G
Sbjct:  333 YPTNFSSIIQLSPPPAPPCLLRAGSKAKENPGMGKVKVMMRI-----CPSLGVQESSDSMSFLKVDQRKKQLTLYEPSLLAQPTAAHRRTPLAAPKMFAFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKLGKTYTMIGKDSSAQSLGIAPCAISWLFKLISERKEKTGTRFSVRVSAVEIYGKDESLQDLLSDVSSGSLQDGQSPGVYLREDPICGTQLQNQSELRAPTAEKAAHFLDAAIAARSTSRPDADEEDRRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCEKVLSKSRDGGGGLCLSLTALGNVILA---------------------------LANGAKHVPYRDSKLTMLLRDSLGNINCRTTMIAHVSDSPAHYADSLTTIQLASRIHRV-RKKKSKYASSSSGGESSCDEGRIRRPPHLRPFHPRTVALDPDLPLLLSDPDYSSSSEQSCDTVIYVG 786          

HSP 2 Score: 66.2402 bits (160), Expect = 3.762e-10
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 3
Query: 5118 KIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIK 5351
            +I +L  + + LK EL  +K R+++DP+ W  +  V + +DPE   ++EALE+ T  L   V  CKS V+++T FDI+
Sbjct: 1928 QIKELRVKHETLKEELEDTKARLMMDPSKWMGEFDVDQDLDPESQEYLEALEQATSELEYCVNLCKSRVMMVTCFDIR 2005          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:103039212])

HSP 1 Score: 335.495 bits (859), Expect = 2.463e-92
Identity = 219/488 (44.88%), Postives = 294/488 (60.25%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESH---SANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS I++ SPPP PP LL+           GK+KV++++           Q  S S   + VD  KKQ+T++E        +  RR     PK++AFDAV+T D    E+CS  + ++IQSVV+G DGC+F FGH++      MIG D   + LG+ PCAISWLF+LI E+KEKTG RFSVRVSA+E+YGK E L+DLLSD+         SPGVYLR+DP+ GTQLQNQSELRAPTAEKAA++LDAA+AAR+ S    +EED R SH LFTLH+YQYR+E+ +    ++GGRSRLH++D GS             G  LS T L N  +                            L NG +H+PYR SKL+ LLR+++ +++CRT M+AHV+ +  H ADS+  IQ AS++ R+ R+K SK + +SS   SSCD    RR    +  +    +      +  S+ DY+SSSEQSCDTVIY+G
Sbjct:  360 YPTNFSSIIQLSPPPAPPCLLRAGSKAKENPGMGKVKVMMRI-----CPSLGVQESSDSMSFLKVDQRKKQLTLYEPSLLAQPTAAHRRTPLAAPKMFAFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKLGKTYTMIGKDSSAQSLGIAPCAISWLFKLISERKEKTGTRFSVRVSAVEIYGKDESLQDLLSDVSSGSLQDGQSPGVYLREDPICGTQLQNQSELRAPTAEKAAHFLDAAIAARSTSRPDADEEDRRNSHMLFTLHIYQYRMEK-SGKGGMSGGRSRLHLIDLGSCEKVLSKSRDGGGGLCLSLTALGNVILA---------------------------LANGAKHVPYRDSKLTMLLRDSLGNINCRTTMIAHVSDSPAHYADSLTTIQLASRIHRV-RKKKSKYASSSSGGESSCDEGRIRRPPHLRPFHPRTVALDPDLPLLLSDPDYSSSSEQSCDTVIYVG 813          

HSP 2 Score: 66.2402 bits (160), Expect = 3.741e-10
Identity = 32/84 (38.10%), Postives = 52/84 (61.90%), Query Frame = 3
Query: 5100 KQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIK 5351
            +Q+Q   I +L  + + LK EL  +K R+++DP+ W  +  V + +DPE   ++EALE+ T  L   V  CKS V+++T FDI+
Sbjct: 1960 RQLQ---IKELRVKHETLKEELEDTKARLMMDPSKWMGEFDVDQDLDPESQEYLEALEQATSELEYCVNLCKSRVMMVTCFDIR 2040          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif26aa (kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GENE-041001-148])

HSP 1 Score: 305.449 bits (781), Expect = 4.076e-83
Identity = 187/409 (45.72%), Postives = 260/409 (63.57%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFES----HSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNE-EDTRL--SHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            +   FS  L+ SPPPVPP LL+           GK+KV++++        +   + S S   + VD  KKQ+T+ ES    HS     R  + + PK + FDAV+T D    E+CS  + ++IQSVV+G DGC+F FGH     +  MIG D  T+ LG+ PCAISWLF+LI E+KEK GARFSVRVSA+E+ G++E+L DLL+D     +      GVYLR+DPVSG+QLQNQSELRA +AE+AA++LD+ALAAR+ S  E ED +   SH LFTLH+ QYR+E+   G  ++GGRSRLH+LD GS     ++DLS          K         LSLSA   V+LAL NG +H+PYR SKL+ LLRE++ +++CRT M+AH++ +  +  +S+  +Q AS++ R++
Sbjct:  336 YTEGFSATLQVSPPPVPPCLLRAGAKVKDSPGMGKVKVMVRI-----CPAKGAWDTSESMSFLKVDAHKKQLTLCESPASTHSNGGQKRFSSTSAPKTFNFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHANLGKSYTMIGRDSTTQNLGVAPCAISWLFKLIEERKEKAGARFSVRVSAVEISGREEVLTDLLADFAPSTSQDSQGAGVYLREDPVSGSQLQNQSELRACSAERAAFFLDSALAARSTSKPECEDEQRCNSHMLFTLHITQYRMEKSAKG-GMSGGRSRLHLLDLGS----CESDLS----------KTRDGGGGQCLSLSALGNVILALANGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDSPANYTESLSTVQLASRIHRMR 724          

HSP 2 Score: 62.7734 bits (151), Expect = 5.242e-9
Identity = 62/219 (28.31%), Postives = 97/219 (44.29%), Query Frame = 3
Query: 4812 SSGYESILRDSE----VSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIK----------------KIAKQIQF------------EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLP 5372
            SSGYES++RDSE     SS +DS SES +  + RA+  +  + +++    ++   AP        DT S       + +     P    LK   EIK                   + +Q+            ++I +L  + + LK EL  +K R+++DP  W  +  V   +D +   ++EAL + T  L   V  CKS V+L T FDI  + PT P
Sbjct: 1708 SSGYESMIRDSETTGSASSAHDSMSESGVSTSSRAKVSKSPKKRANGLQRRRLIPAP------LPDTSSLGRKAGAAGQWVDLPPLGGTLKEAFEIKVYEIDDVERLQRRKEGMATEGLQYFNARLRMLEKRQQQIRELRVKHEKLKRELEDAKTRLMLDPAKWMGEFDVDPDLDQDSQDYLEALAQATGELEFCVNLCKSRVMLETCFDI--MAPTSP 1918          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif26aa (kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GENE-041001-148])

HSP 1 Score: 304.679 bits (779), Expect = 6.344e-83
Identity = 187/409 (45.72%), Postives = 260/409 (63.57%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFES----HSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNE-EDTRL--SHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            +   FS  L+ SPPPVPP LL+           GK+KV++++        +   + S S   + VD  KKQ+T+ ES    HS     R  + + PK + FDAV+T D    E+CS  + ++IQSVV+G DGC+F FGH     +  MIG D  T+ LG+ PCAISWLF+LI E+KEK GARFSVRVSA+E+ G++E+L DLL+D     +      GVYLR+DPVSG+QLQNQSELRA +AE+AA++LD+ALAAR+ S  E ED +   SH LFTLH+ QYR+E+   G  ++GGRSRLH+LD GS     ++DLS          K         LSLSA   V+LAL NG +H+PYR SKL+ LLRE++ +++CRT M+AH++ +  +  +S+  +Q AS++ R++
Sbjct:  362 YTEGFSATLQVSPPPVPPCLLRAGAKVKDSPGMGKVKVMVRI-----CPAKGAWDTSESMSFLKVDAHKKQLTLCESPASTHSNGGQKRFSSTSAPKTFNFDAVFTQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHANLGKSYTMIGRDSTTQNLGVAPCAISWLFKLIEERKEKAGARFSVRVSAVEISGREEVLTDLLADFAPSTSQDSQGAGVYLREDPVSGSQLQNQSELRACSAERAAFFLDSALAARSTSKPECEDEQRCNSHMLFTLHITQYRMEKSAKG-GMSGGRSRLHLLDLGS----CESDLS----------KTRDGGGGQCLSLSALGNVILALANGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDSPANYTESLSTVQLASRIHRMR 750          

HSP 2 Score: 62.7734 bits (151), Expect = 5.159e-9
Identity = 63/226 (27.88%), Postives = 98/226 (43.36%), Query Frame = 3
Query: 4812 SSGYESILRDSE----VSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIK-----------------------KIAKQIQF------------EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLP 5372
            SSGYES++RDSE     SS +DS SES +  + RA+  +  + +++    ++   AP        DT S       + +     P    LK   EIK                        + K +Q+            ++I +L  + + LK EL  +K R+++DP  W  +  V   +D +   ++EAL + T  L   V  CKS V+L T FDI  + PT P
Sbjct: 1712 SSGYESMIRDSETTGSASSAHDSMSESGVSTSSRAKVSKSPKKRANGLQRRRLIPAP------LPDTSSLGRKAGAAGQWVDLPPLGGTLKEAFEIKVYEIDDVERLQRRKEGMATEPFQDVEKGLQYFNARLRMLEKRQQQIRELRVKHEKLKRELEDAKTRLMLDPAKWMGEFDVDPDLDQDSQDYLEALAQATGELEFCVNLCKSRVMLETCFDI--MAPTSP 1929          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001911.1 (pep scaffold:Pmarinus_7.0:GL476451:251877:270556:1 gene:ENSPMAG00000001737.1 transcript:ENSPMAT00000001911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 2.861e-56
Identity = 102/233 (43.78%), Postives = 149/233 (63.95%), Query Frame = 3
Query:  987 FSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSA------NSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVI----DNVGQCSPGVYLRDDPVSGTQL 1655
            F+  L+++ PPVPP LL+ +         GK+KV++++         + +++S S   + VD  +KQ+T+++  +A      N+  RR    +PKI+ FDAV++ D    E+C+ A+ +IIQSVV+G DGC+F FG+ +      M+GS   ++ LG+ PCAISWLFRLI E+KE+TGARFSVRVSA+EV G+ E L DLLSD+       DN    SPGV+LR+DPV GTQ+
Sbjct:   42 FAWALRSAAPPVPPCLLRAAGKARDNPGAGKVKVMLRVC-------PARRDVSGSPA-LKVDPRRKQVTLYDPAAAAGASSQNAALRRAGVAVPKIFPFDAVFSQDASQAEVCAGAVPEIIQSVVNGADGCIFCFGNAKLGKTYTMLGSGDSSQALGVAPCAISWLFRLIEERKERTGARFSVRVSAVEVSGRGEALGDLLSDVASGTTQDDNQ---SPGVFLREDPVCGTQV 263          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 78.9518 bits (193), Expect = 6.355e-15
Identity = 89/396 (22.47%), Postives = 183/396 (46.21%), Query Frame = 3
Query: 1011 PPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTM---SFNEEDTRLSHFLFTLHVYQYRVERGTTG-SAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR 2186
            PPP P      +++R     T  ++V+++ + +        ++ +  +  IT+D    Q+ +         PR  NA+  + + FDAVY  D    ++   +   ++ SV+ G +G +F++G         M G      + G+IP +   +F  I   + +      VR S +E+Y  QE ++DLLS  +        S  + LR+ P +G  +++ S     +A +  + +      R++   + NE  +R SH +F + V     E G  G S +  G  +L+++D       ++T    + +   +++K +   ++    +SA             H+PYR SKL++LL++++   + RT MVA+V   + +  +S+  +++A++ + ++ R
Sbjct:    1 PPPSPH--YPAAMSRAKSAET--VRVVVRCRPMN-----PRESAASYESVITIDVRAGQVAI-------RNPR-ANADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDPERRGVIPNSFEHIFTHISRSQNQPVP--EVRASYLEIY--QEEIRDLLSRDQ--------SRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSR-SHAIFVITVECS--ELGADGESHIRVG--KLNLVDLAGSERQAKTGAQGERL--KEATKINLSLSALGNVISALVDGKST------HVPYRDSKLTRLLQDSLGG-NARTVMVANVGPASYNYDESLTTLRYANRAKNIRNR 353          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 75.8702 bits (185), Expect = 7.180e-14
Identity = 79/346 (22.83%), Postives = 163/346 (47.11%), Query Frame = 3
Query: 1152 QMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLS--DIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSA-VAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            +M + VD  + QI V +    N  P       PK + FD V+  +    ++ +     I+ SV+ G +G +F++G         M G        G+IP + + +F  I   K +   RF VRVS +E+Y ++  +KDLL     + ++   +   GVY++D  +S   + N  ++     ++         +  + + NE  +R SH +FT+ +     E+G  G+  V  G  +LH++D       ++T  + + +   +++K +   ++    +SA             H+PYR SKL++LL++++   + +T M A++     +  +++  +++A++ + +K
Sbjct:   35 RMAVLVDEMRGQIAV-QRPDCNDEP-------PKTFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGIRAVPELRGIIPNSFAHIFGHIA--KAEGDTRFLVRVSYLEIYNEE--VKDLLGKDQTQRLEVKERPDVGVYVKD--LSAFVVNNADDM-----DRIMTLGHKNRSVGSTNMNEHSSR-SHAIFTITIEC--SEKGVDGNMHVRMG--KLHLVDLAGSERQTKTGATGQRL--KEATKINLSLSTLGNVISALVDGKST------HVPYRNSKLTRLLQDSLGG-NSKTMMCANIGPADYNYDETISTLRYANRAKNIK 347          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 74.3294 bits (181), Expect = 2.251e-13
Identity = 73/312 (23.40%), Postives = 139/312 (44.55%), Query Frame = 3
Query: 1257 YAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGAR-FSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            + F  ++       E+       +  SV+SG +G +F++G         + G  ++    G+IP  + +LF    EQ +K   R ++  +S +E+Y +     DLL+       +    P V L +D      L+N S  +A + E+A   L      R ++    N+  TR SH +FTLHV       G    +    RS+LH++D      +S+T +    I  T++   +               ++      + H+PYR S ++ +LR+++   +C T M+A +A++  +  +S+   +FA ++  +K
Sbjct:   56 FQFKKIFDQQAKQEEIFETIARPVADSVLSGYNGTIFAYGQTGSGKTFTITGGAERFADRGIIPRILGYLF----EQFQKDTNRVYTAHISYLEIYNENGY--DLLNPRHEASKLEDL-PKVTLMEDTDQIVHLKNLSLHQASSQEEALNLLFLGDTNRMIAETPMNQASTR-SHCIFTLHVC------GREPGSTTLCRSKLHLVDLAGSERVSKTGVGG--ILLTEAKYINL------SLHYLEQVIIALSEKNRSHVPYRNSMMTSVLRDSLGG-NCMTTMIATLAVDKRNIDESISTCRFAQRVALIK 344          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: KIF27 (kinesin family member 27 [Source:HGNC Symbol;Acc:HGNC:18632])

HSP 1 Score: 65.4698 bits (158), Expect = 1.416e-10
Identity = 90/328 (27.44%), Postives = 156/328 (47.56%), Query Frame = 3
Query: 1251 KIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIG------SDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGR---------SRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            + + FD V+       E+    +  +++S V G +  VF++G   GS     IG      S +  R  G+IP AI+ LF  +   KE     FSV VS IEVY  +E L+DLL DIE +      S  +++R+D    T +    E    T ++    L+A  AAR   T   NE  +R SH +FTL V Q R      GS+ +G           S+ H +D      +S+T  + +        K     NS  L+L    + L        HIPYR +K++++L++++   + +T M+A ++ ++ +  +++  +++A++ + ++
Sbjct:   43 RAFTFDHVFGSKVAQEEVYKTCIQPLVKSFVDGYNVTVFAYGQT-GSGKTFTIGGANIASSIEDER--GIIPRAIADLFFAM---KESHNTDFSVGVSYIEVY--KEELRDLL-DIETL------SKDMHIREDDKGNTVIIGTKESVVETEDEVLSLLEAGNAARHTGTTQMNEHSSR-SHTIFTLTVTQRR----PYGSSNSGDNLNNESESLSSKFHFVDLAGSERVSKTGNTGERF------KESIQINSGLLALGNVISALGDPKRKSSHIPYRDAKITRILKDSLGG-NAKTLMIACISPSSGNFDETINSLKYANRAKNIR 343          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 67.0106 bits (162), Expect = 2.155e-11
Identity = 84/334 (25.15%), Postives = 146/334 (43.71%), Query Frame = 3
Query: 1257 YAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLL-SDIE------------VIDNVGQCSPGVYL--RDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTM---SFNEEDTRLSHFLFTLHVYQYRVERGTTGSA------------VAGGRSRLHMLDFGSGRILS-QTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASK 2165
            + FD V+       E+       +I  ++ G +  +F++G         M G++Q+   LGLIP ++S+LF  I EQ      +F V +S +E+Y   E + DLL S +E             +        GV L  RDD   G ++   +E R  ++E+   ++     +R +    +N   +R SH +  + +    V+ GT+ S+              G + R     F +  +L+  T +S       +S   + PS S + S S++        +   HIPYR SKL++LL+ A+S  S  T  +  V       A++M  ++FAS+
Sbjct:  163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQE---LGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIY--NERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSR-SHAIVLIRLTSTNVKNGTSRSSTLSLCDLAGSERATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTT-ICTVDTRNDAAAETMNTLRFASR 489          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 60.8474 bits (146), Expect = 1.977e-9
Identity = 80/336 (23.81%), Postives = 142/336 (42.26%), Query Frame = 3
Query: 1257 YAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLR-----DDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSF---NEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-GSGRI---------LSQTDLSNKEITPTDS-----SKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQ--RLKRRK 2189
            + FD ++   D   ++    +  ++QS + G + C+F++G         M+         G+IP  IS +F  I + K K G  + V    IE+Y   E + DLL      DN  +    + L+     D     T + N +  +  + E     L  A   R+ +    NE  +R SH +F +H+       G+     A     L+++D  GS RI         L +T   NK ++          +PD                     + +RHIP+R SKL+ LL+ +++    +T M  +++ +++H  +++  ++FASK+   RL  RK
Sbjct:  436 FKFDKIFDQQDTNVDVFK-EVGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD-----GIIPSTISHIFNWINKLKTK-GWDYKVNCEFIEIYN--ENIVDLLRS----DNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSR-SHSIFIIHL------SGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPD---------------------STKRHIPFRNSKLTYLLQYSLTG-DSKTLMFVNISPSSSHINETLNSLRFASKVNSTRLVSRK 729          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO49027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHS1])

HSP 1 Score: 208.764 bits (530), Expect = 4.094e-60
Identity = 115/254 (45.28%), Postives = 167/254 (65.75%), Query Frame = 3
Query: 1140 ISPSQMCITVDNTKKQITVFE----SHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQ--CSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNE---EDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS 1874
            I  S   + VD  +KQ+T+++    SH ++S  R++    PK++AFD +Y  D   +E+CS +L DIIQ+VV+G DGC+F++GH        M+G D+  + +G++PCA++WLFRLI +QK+KTG +FSVRVSA+E+ G+ E  +DLL+     +N      SP V+LR+    G QL N SELRA +AEKAA+YLDAALAART    +   ++T+ SH  FT+H+Y+      +TG  V GGRSRLH++D  S
Sbjct:    9 IGESASVMKVDTKRKQVTLYDPSTVSHVSHSR-RKMGVAAPKMFAFDGIYEPDASQSEVCSGSLVDIIQTVVNGSDGCLFTYGHAGLGKTFTMMGRDESDQTIGVLPCALAWLFRLISDQKQKTGTKFSVRVSAVEIVGRSENWRDLLAATTSTENGTNETVSPSVFLREGKSGGMQLLNPSELRASSAEKAAFYLDAALAARTRPSGDNGPDETKNSHMFFTVHIYRVEKHSKSTGGKVHGGRSRLHLIDLAS 261          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO47075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN53])

HSP 1 Score: 76.2554 bits (186), Expect = 7.516e-14
Identity = 87/329 (26.44%), Postives = 149/329 (45.29%), Query Frame = 3
Query: 1143 SPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLL-----SDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSA-VAGGRSRLHMLDFGSGRILSQTDLSN---KEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVA 2102
            S  +MC+ VD     I V      +S P       PK + FD V+  D   T++ ++A   I++SV+ G +G +F++G         M G        G++P + + +F  I   K     RF VRVS +E+Y   E ++DLL     + +EV +   +   GVY++D  +S   + N  +L     ++     +   +    + NE  +R SH +F++ V     E+G  G   V  G  +LH++D       ++T  +    KE T  + S     +  +AL    +            HIPYR SKL++LL++++   + +T MV 
Sbjct:   27 SGCKMCVNVDEGTGSIAVTPPGGRSSEP-------PKKFTFDRVFNVDCKQTDVYTDAARGIVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSVPELRGIVPNSFAHIFGHIA--KVDGHVRFLVRVSYLEIY--NENVRDLLGKDQNAKLEVKE---RPDIGVYVKD--LSSYVMNNADDL-----DRTMTLGNKNRSVGATNMNERSSR-SHAIFSITVECS--EKGLDGQQHVRMG--KLHLVDLAGSERQAKTGATGVRLKEATQINLSLSTLGNVISALVDGKST-----------HIPYRNSKLTRLLQDSLGG-NSKTIMVG 317          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO49131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY3])

HSP 1 Score: 72.4034 bits (176), Expect = 6.171e-13
Identity = 76/312 (24.36%), Postives = 142/312 (45.51%), Query Frame = 3
Query: 1257 YAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTM---SFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLK 2180
            + FD V+ ++ + T++  N   DII  V+ G +  VF++G         M+GS+      G++   +  L+R I E K++      V VS +EVY   E ++DLL             P + +R+DP  G  +   +  +  +AE+    L+     RT      N + +R SH +F + V Q   +  T G       +++ ++D  GS R    T+   +     + +K      +   +L+              HIPYR SKL++LL++++   +C+T M+A V+ +     D+   +++A + + +K
Sbjct:   67 FIFDRVFNEEANNTDVFENTTKDIIDGVLDGFNCTVFAYGATGAGKTHTMLGSNNNP---GVMFLTMMDLYRRIHEMKDEKTC--DVAVSYLEVY--NETIRDLLLP----------GPALAVREDPQRGVCVSGLTLHKPHSAEELLSMLEFGNNNRTQHPTDANAQSSR-SHAVFQVFVRQ---KDRTAGLKANVRLAKMSLIDLAGSERATVTTNRGARFREGANINKSLLALGNCINALADKENKSG-------HIPYRNSKLTRLLKDSLGG-NCKTVMIAAVSPSMLSYEDTYNTLKYADRAKSIK 349          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO46386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPV5])

HSP 1 Score: 70.8626 bits (172), Expect = 8.419e-13
Identity = 80/299 (26.76%), Postives = 139/299 (46.49%), Query Frame = 3
Query: 1248 PKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIG-----SDQQTRKL-GLIPCAISWLFRLICEQKEKTG--ARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXR---TMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDF-GSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHV 2108
            PK ++FD V   +    E+      +I++  V G +G +F++G         M+G     ++  T +L G+IP    +LF LI  ++EK G    F  + S +E+Y +Q           + D +   S G+ LR+D   G  +    E    +A++A   L++    R   + S N E +R SH +FT+ +     +   +   V    SRLH++D  GS R   Q D   + +   ++S  +    S +   +   A++       RHI YR SKL+ LLR+++   + RT ++A+V
Sbjct:   18 PKTFSFDHVADTNTMQEEVFGAVAKNIVEGCVDGYNGTIFAYGQTGSGKTFTMLGPAEGEAECFTHELRGVIPRCFEYLFSLIKREQEKHGDHLEFLCQCSFLEIYNEQ-----------IFDLLDPASSGLALREDLKKGIFVCGLLERDVTSAKEAYNVLNSGWLNRRVASTSMNRESSR-SHAVFTVTLQSREKKNNMSNIKV----SRLHLVDLAGSER---QRDTHAEGLRLKEASSIN---KSLSALGNVIMALVDITHGKNRHIHYRDSKLTFLLRDSLGG-NARTYIIANV 293          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO40836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5X0])

HSP 1 Score: 71.633 bits (174), Expect = 2.674e-12
Identity = 73/322 (22.67%), Postives = 150/322 (46.58%), Query Frame = 3
Query: 1245 IPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIG--SDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSN---KEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR 2186
            +PK++ +DAVY  +    +L       +++SV+ G +G +F++G         M G  SD   R  G+IP +   +F  I      T  ++ VR S +E+Y  QE ++DLL   +           + L++ P +G  +++       + ++  + ++     R++     NE  +R SH +F + +   ++          G   +L+M+D       ++T+ +    KE T  + S     +  +AL    +            HIPYR SKL++LL++++   + RT MVA++   + +  +S+  +++A++ + +K +
Sbjct:   34 VPKMFTYDAVYDWNSKQIDLYDETFRQLVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSDPDLR--GVIPNSFDHIFTHIA---RTTNQQYLVRASYLEIY--QEEVRDLLGKDQ--------KKRLELKERPDTGVYVKDLQSFVCKSVKEIEHVMNVGNQNRSVGATKMNEHSSR-SHAIFIITIECSQLNAVGECHIRVG---KLNMVDLAGSERQTKTEATGDRLKEATKINLSLSALGNVISALVDGKST-----------HIPYRDSKLTRLLQDSLGG-NARTVMVANIGPASYNYEESITTLRYANRAKNIKNK 324          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:101162644])

HSP 1 Score: 334.339 bits (856), Expect = 5.536e-92
Identity = 219/478 (45.82%), Postives = 310/478 (64.85%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKL-KYLETSKPESHQNISPSQMCITVDNTKKQITVFES----HSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS IL+ SPPP PP LL+           GK+KV++++   LE +      + S SQ  + VD+ KKQ+T+++     HS++   R     +PKI+AFDAV+T D    E+CS  + +++QSVV+G DGC+FSFG ++      MIG D  T+ LG++PCAISWLF+LI E+KEKTG RFSVRVSA+E++GK E LKDLLS++         SPG++L++DP+ GTQLQNQSELRAPTA+KAA+YLDAA+AAR+ S     EE+ R SH LFTLHVYQYR+E+ +    ++GGRSRLH+LD GS  ++LS++      +                LSL+A   V++AL NG +H+PYR SKL+ LLRE++ +++CRT M+AH++    + ADS+  IQ AS++ R+ R+K SK + +SS   SSC+    RR    +  +    +         S+ +Y+SSSEQSCDTVIY+G
Sbjct:  342 YPTNFSGILQVSPPPAPPCLLRAVSKVKENPGMGKVKVMMRICPSLEDA------DSSESQSFLKVDSRKKQLTLYDPASSPHSSSGHRRSATVAVPKIFAFDAVFTQDASQAEVCSGTVAEVVQSVVNGADGCIFSFGQVKLGKTYTMIGKDSSTQSLGIVPCAISWLFKLINERKEKTGTRFSVRVSAVEIFGKDEELKDLLSEVSTGSLQEGQSPGIHLKEDPICGTQLQNQSELRAPTADKAAFYLDAAIAARSTSRPNVEEEERRNSHMLFTLHVYQYRMEK-SGKGGMSGGRSRLHLLDLGSCEKVLSKSRDGGGGLC---------------LSLNALGNVIMALTNGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDVPANHADSLTTIQLASRIHRM-RKKKSKYASSSSGGESSCEEGRIRRPPHLRPFHPRTVALDPDLPSFLSDPEYSSSSEQSCDTVIYVG 796          

HSP 2 Score: 58.9214 bits (141), Expect = 6.817e-8
Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 5079 NEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            N++K + K+ Q  ++ +L A+  +L  EL  +K R+++DP+ W  +  V   +D E   ++EAL + T+ L   V  CKS V+++T FDI
Sbjct: 1896 NKLKMLEKRQQ--QVKELKAKHQVLLEELEDTKARLMMDPSKWLGEFEVDPSLDKESIEYLEALAQITEELEFCVNLCKSRVMMVTCFDI 1983          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:101162644])

HSP 1 Score: 333.954 bits (855), Expect = 7.230e-92
Identity = 215/490 (43.88%), Postives = 300/490 (61.22%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKL-KYLETSKPESHQNISPSQMCITVDNTKKQITVFES----HSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-------------GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS IL+ SPPP PP LL+           GK+KV++++   LE +      + S SQ  + VD+ KKQ+T+++     HS++   R     +PKI+AFDAV+T D    E+CS  + +++QSVV+G DGC+FSFG ++      MIG D  T+ LG++PCAISWLF+LI E+KEKTG RFSVRVSA+E++GK E LKDLLS++         SPG++L++DP+ GTQLQNQSELRAPTA+KAA+YLDAA+AAR+ S     EE+ R SH LFTLHVYQYR+E+ +    ++GGRSRLH+LD GS             G  LS   L N  +  T+                           G +H+PYR SKL+ LLRE++ +++CRT M+AH++    + ADS+  IQ AS++ R+ R+K SK + +SS   SSC+    RR    +  +    +         S+ +Y+SSSEQSCDTVIY+G
Sbjct:  362 YPTNFSGILQVSPPPAPPCLLRAVSKVKENPGMGKVKVMMRICPSLEDA------DSSESQSFLKVDSRKKQLTLYDPASSPHSSSGHRRSATVAVPKIFAFDAVFTQDASQAEVCSGTVAEVVQSVVNGADGCIFSFGQVKLGKTYTMIGKDSSTQSLGIVPCAISWLFKLINERKEKTGTRFSVRVSAVEIFGKDEELKDLLSEVSTGSLQEGQSPGIHLKEDPICGTQLQNQSELRAPTADKAAFYLDAAIAARSTSRPNVEEEERRNSHMLFTLHVYQYRMEK-SGKGGMSGGRSRLHLLDLGSCEKVLSKSRDGGGGLCLSLNALGNVIMALTN---------------------------GAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDVPANHADSLTTIQLASRIHRM-RKKKSKYASSSSGGESSCEEGRIRRPPHLRPFHPRTVALDPDLPSFLSDPEYSSSSEQSCDTVIYVG 816          

HSP 2 Score: 59.6918 bits (143), Expect = 4.189e-8
Identity = 32/98 (32.65%), Postives = 56/98 (57.14%), Query Frame = 3
Query: 5055 PNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            P   +   N++K + K+ Q  ++ +L A+  +L  EL  +K R+++DP+ W  +  V   +D E   ++EAL + T+ L   V  CKS V+++T FDI
Sbjct: 1900 PEGLMYFNNKLKMLEKRQQ--QVKELKAKHQVLLEELEDTKARLMMDPSKWLGEFEVDPSLDKESIEYLEALAQITEELEFCVNLCKSRVMMVTCFDI 1995          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:101162644])

HSP 1 Score: 333.569 bits (854), Expect = 7.317e-92
Identity = 219/478 (45.82%), Postives = 310/478 (64.85%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKL-KYLETSKPESHQNISPSQMCITVDNTKKQITVFES----HSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSG-RILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS IL+ SPPP PP LL+           GK+KV++++   LE +      + S SQ  + VD+ KKQ+T+++     HS++   R     +PKI+AFDAV+T D    E+CS  + +++QSVV+G DGC+FSFG ++      MIG D  T+ LG++PCAISWLF+LI E+KEKTG RFSVRVSA+E++GK E LKDLLS++         SPG++L++DP+ GTQLQNQSELRAPTA+KAA+YLDAA+AAR+ S     EE+ R SH LFTLHVYQYR+E+ +    ++GGRSRLH+LD GS  ++LS++      +                LSL+A   V++AL NG +H+PYR SKL+ LLRE++ +++CRT M+AH++    + ADS+  IQ AS++ R+ R+K SK + +SS   SSC+    RR    +  +    +         S+ +Y+SSSEQSCDTVIY+G
Sbjct:  362 YPTNFSGILQVSPPPAPPCLLRAVSKVKENPGMGKVKVMMRICPSLEDA------DSSESQSFLKVDSRKKQLTLYDPASSPHSSSGHRRSATVAVPKIFAFDAVFTQDASQAEVCSGTVAEVVQSVVNGADGCIFSFGQVKLGKTYTMIGKDSSTQSLGIVPCAISWLFKLINERKEKTGTRFSVRVSAVEIFGKDEELKDLLSEVSTGSLQEGQSPGIHLKEDPICGTQLQNQSELRAPTADKAAFYLDAAIAARSTSRPNVEEEERRNSHMLFTLHVYQYRMEK-SGKGGMSGGRSRLHLLDLGSCEKVLSKSRDGGGGLC---------------LSLNALGNVIMALTNGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDVPANHADSLTTIQLASRIHRM-RKKKSKYASSSSGGESSCEEGRIRRPPHLRPFHPRTVALDPDLPSFLSDPEYSSSSEQSCDTVIYVG 816          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif26ab (kinesin family member 26A [Source:NCBI gene;Acc:101162644])

HSP 1 Score: 333.569 bits (854), Expect = 8.038e-92
Identity = 219/478 (45.82%), Postives = 310/478 (64.85%), Query Frame = 3
Query:  975 FMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKL-KYLETSKPESHQNISPSQMCITVDNTKKQITVFES----HSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS---FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGS-GRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            + T FS IL+ SPPP PP LL+           GK+KV++++   LE +      + S SQ  + VD+ KKQ+T+++     HS++   R     +PKI+AFDAV+T D    E+CS  + +++QSVV+G DGC+FSFG ++      MIG D  T+ LG++PCAISWLF+LI E+KEKTG RFSVRVSA+E++GK E LKDLLS++         SPG++L++DP+ GTQLQNQSELRAPTA+KAA+YLDAA+AAR+ S     EE+ R SH LFTLHVYQYR+E+ +    ++GGRSRLH+LD GS  ++LS++      +                LSL+A   V++AL NG +H+PYR SKL+ LLRE++ +++CRT M+AH++    + ADS+  IQ AS++ R+ R+K SK + +SS   SSC+    RR    +  +    +         S+ +Y+SSSEQSCDTVIY+G
Sbjct:  362 YPTNFSGILQVSPPPAPPCLLRAVSKVKENPGMGKVKVMMRICPSLEDA------DSSESQSFLKVDSRKKQLTLYDPASSPHSSSGHRRSATVAVPKIFAFDAVFTQDASQAEVCSGTVAEVVQSVVNGADGCIFSFGQVKLGKTYTMIGKDSSTQSLGIVPCAISWLFKLINERKEKTGTRFSVRVSAVEIFGKDEELKDLLSEVSTGSLQEGQSPGIHLKEDPICGTQLQNQSELRAPTADKAAFYLDAAIAARSTSRPNVEEEERRNSHMLFTLHVYQYRMEK-SGKGGMSGGRSRLHLLDLGSCEKVLSKSRDGGGGLC---------------LSLNALGNVIMALTNGAKHVPYRDSKLTMLLRESLGNINCRTTMIAHISDVPANHADSLTTIQLASRIHRM-RKKKSKYASSSSGGESSCEEGRIRRPPHLRPFHPRTVALDPDLPSFLSDPEYSSSSEQSCDTVIYVG 816          

HSP 2 Score: 58.9214 bits (141), Expect = 7.363e-8
Identity = 31/90 (34.44%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 5079 NEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDI 5348
            N++K + K+ Q  ++ +L A+  +L  EL  +K R+++DP+ W  +  V   +D E   ++EAL + T+ L   V  CKS V+++T FDI
Sbjct: 1916 NKLKMLEKRQQ--QVKELKAKHQVLLEELEDTKARLMMDPSKWLGEFEVDPSLDKESIEYLEALAQITEELEFCVNLCKSRVMMVTCFDI 2003          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif26ba (kinesin family member 26B [Source:NCBI gene;Acc:101169595])

HSP 1 Score: 305.064 bits (780), Expect = 8.326e-83
Identity = 209/457 (45.73%), Postives = 281/457 (61.49%), Query Frame = 3
Query: 1074 GKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSAN-----STPRRVNAN--IPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMS----FNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRI--LSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASR--------HKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLG 2381
            GK+KV++++       P SH + + S   + VD  KKQIT+ +  SAN     ++ +R  AN   PKI+ FDA +  D    E+C+  + ++IQSVV+G DGCVF FGH +   +  MIG D   + LG+IPCAISWLF+LI E+KEKTGARFSVRVSA+EV+GK+E LKDLLS++         SPGVYL +DP+ G QLQNQSELRAPT EKAA+ LDAA+AAR  S      EE+ R SH LFTLH+YQYR+E+   G  ++GGRSRLH+LD GS  +  L             +SS    P     LSLSA   V+LALVNG +HIPY+ SKL+ LLRE++ +++CRT M+AH+++     ++++  IQ AS++ R+K++K       +S  S    S    R  R        H+G               SS+ +  SSSEQSCDTVIY+G
Sbjct:  502 GKVKVMVRVC------PVSHSDAAESSSFLKVDTRKKQITIMDP-SANQPLNAASQKRAGANQVPPKIFTFDAAFPPDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHSKLGKSYTMIGRDDSLQTLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLKDLLSEVATGSLQDGQSPGVYLCEDPICGMQLQNQSELRAPTPEKAAWLLDAAIAARHSSQRPNTTEEEHRNSHMLFTLHIYQYRMEKTGKG-GMSGGRSRLHLLDLGSCDVKELGGGGGGGGGKNRENSSPSSAP---LCLSLSALGNVILALVNGSKHIPYKDSKLTMLLRESLGNMNCRTTMIAHISVLPRDFSETLSTIQIASRVLRMKKKKTKVTVQYTSSSSGGESSCEEGRMRRPTHLRPFHHRGDT----DSDLPLLKLSSDPEEYSSSEQSCDTVIYVG 943          

HSP 2 Score: 59.3066 bits (142), Expect = 6.021e-8
Identity = 26/82 (31.71%), Postives = 50/82 (60.98%), Query Frame = 3
Query: 5115 EKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIH 5360
            ++I ++ A+   LK EL Q+K+ ++++P  W  +  + +  + +   ++EAL+  TD L  RV  CK+H+++IT FD+   H
Sbjct: 2243 QRIGEVRAKYQCLKNELEQTKQHLMLEPHKWITEFELQQPYEVDSLEYLEALQTVTDKLESRVNFCKAHLMMITCFDVSSRH 2324          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000013633.1 (SMESG000013633.1)

HSP 1 Score: 2790.76 bits (7233), Expect = 0.000e+0
Identity = 1623/1659 (97.83%), Postives = 1626/1659 (98.01%), Query Frame = 3
Query:  465 QIQCHPQGQNGVAPSFTCTNRLQYFEKPPTDIQPSKYPFDFVSSLHQKNNSYRININNHRYHPVDYSKPFHWAIRNNLASTEQVKMINNNKSNVKLNPGNSNLPKYSSKETTETGTILNKDSTVXXXXXXXXXXXXXXXXXXXPITSGTESTSXXXXXXXXXXXXXXXXEFMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKRRISAPSFSNAIPERSGSESDLLKLDIXXXXXXXXXXXXATVRTNALVWPKVAAKNAIETLSTQKEMWVDGPMVSNKTKTQSPESAGNISKFTNTETQTYSIEHNSIVKESNTKAKPVSDVTQPHELNSQITDINANIQKPDXXXXXXXXXXXXXXXXXXXXQESTTAAVGSSDGDHKLTDLFKSIPTSSHSITTGNIHXXXXXXXXXXXXTTHHIVSPQAYKPFVWDWVEKHSDMVVDTPLGNPLTSYPFQIEPMEDVQPSQKRAAKHCAKHQQMLKKSRPAVNNDQVELHEREGRKRHKSAKHKTAQTTGTYENYKTNQFSNPSAEPNFTRVAEWVRSVSEETNRAQSLSPIRRNHTVKENKITSRNHENIPTTTSFQTSTNYRSLDRHAQGFINMSQAGKYPNFYMESTDLSHSSVQFPCVSLGSKTFDSIPLPSRQIYHQDMLNLKKSQNLSRHTSQRSEIEIQSTNPVLKRGNSQNEDSGLAPNSQLKSQNSVSKPTNHTSSKHNTKNSPTRQILERNSPNKTRSSSLIKNALFGRCKLSSSSNIDDNNQYSVPNSPCKNSSKQLPDFIPLNNTGGYHYVVMTSSLSTPAKQIQEETAKAIXXXXXXXXXXXXXXXXLEKKQLANTNKREKVXXXXXXXXXXXXXXXXXXXXXXXLSFLTSPLFGKKKDKDKFSITAPSKATKQQKANPTLQSCSIHHGQHENSSKVISPYCTVTQPKXXXXXXXXXXXXXXXLYGQQHKFSELAGHLKCRECTNIDEEGSCLNHIDQCNIDXXXXXXXXXXXXXXXTSSGYESILRDSEVSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEINQKTPIIKSNRV 5441
            QIQCHPQGQNGVAPSFTCTNRLQYFEKPPTDIQPSKYPFDFVSSLHQKNNSYRININNHRYHPVDYSKPFHWAIRNNLASTEQVKMINNNKSNVKLNPGNSNLPKYSSKETTETGTILNKDSTVASQSNLAAAASFFAKAGKKPITSGTESTSSFKRKKKIDHSKSKDSEFMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKAAYYLDAALAARTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPSNSTALSLSATAAVLLALVNGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFSKLSGTSSDDSSSCDSFGFRRASRHKGGNAGFSSGSSTNGMTSSEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKRRISAPSFSNAIPERSGSESDLLKLDISKHHNNHHQHSKATVRTNALVWPKVAAKNAIETLSTQKEMWVDGPMVSNKTKTQSPESAGNISKFTNTETQTYSIEHNSIVKESNTKAKPVSDVTQPHELNSQITDINANIQKPDNINTVSMTSTTSTSNDNPSSQESTTAAVGSSDGDHKLTDLFKSIPTSSHSITTGNIHSSNNNSSQLPSSTTHHIVSPQAYKPFVWDWVEKHSDMVVDTPLGNPLTSYPFQIEPMEDVQPSQKRAAKHCAKHQQMLKKSRPAVNNDQVELHEREGRKRHKSAKHKTAQTT                             +++    AQSLSPIRRNHTVKENKITSRNHENIPTTTSFQTSTNYRSLDRHAQGFINMSQAGKYPNFYMESTDLSHSSVQFPCVSLGSKTFDSIPLPSRQIYHQDMLNLKKSQNLSRHTSQRSEIEIQSTNPVLKRGNSQNEDSGLAPNSQLKSQNSVSKPTNHTSSKHNTKNSPTRQILERNSPNKTRSSSLIKNALFGRCKLSSSSNIDDNNQYSVPNSPCKNSSKQLPDFIPLNNTGGYHYVVMTSSLSTPAKQIQEETAKAIKRRSSSTSPGKSSGSSLEKKQLANTNKREKVKEKSKEIKNDNNKIKNKKESKKKLSFLTSPLFGKKKDKDKFSITAPSKATKQQKANPTLQSCSIHHGQHENSSKVISPYCTVTQPKHSAHSSSGHGSDCSSLYGQQHKFSELAGHLKCRECTNIDEEGSCLNHIDQCNIDQHQLLRRSQRRGGGHTSSGYESILRDSEVSSQNDSTSESSLGVAPRAQTPEKQQSQSSSSSSKQSRSAPNRSEETSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEINQKTPIIKSNRV
Sbjct:    6 QIQCHPQGQNGVAPSFTCTNRLQYFEKPPTDIQPSKYPFDFVSSLHQKNNSYRININNHRYHPVDYSKPFHWAIRNNLASTEQVKMINNNKSNVKLNPGNSNLPKYSSKETTETGTILNKDSTVASQSNLAAAASFFAKAGKKPITSGTESTSSFKRKKKIDHSKSKDSEFMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKAAYYLDAALAARTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPSNSTALSLSATAAVLLALVNGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFSKLSGTSSDDSSSCDSFGFRRASRHKGGNAGFSSGSSTNGMTSSEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKRRISAPSFSNAIPERSGSESDLLKLDISKHHNNHHQHSKATVRTNALVWPKVAAKNAIETLSTQKEMWVDGPMVSNKTKTQSPESAGNISKFTNTETQTYSIEHNSIVKESNTKAKPVSDVTQPHELNSQITDINANIQKPDNINTVSMTSTTSTSNDNPSSQESTTAAVGSSDGDHKLTDLFKSIPTSSHSITTGNIHSSNNNSSQLPSSTTHHIVSPQAYKPFVWDWVEKHSDMVVDTPLGNPLTSYPFQIEPMEDVQPSQKRAAKHCAKHQQMLKKSRPAVNNDQVELHEREGRKRHKSAKHKTAQTT----------------------------VLNQILLEAQSLSPIRRNHTVKENKITSRNHENIPTTTSFQTSTNYRSLDRHAQGFINMSQAGKYPNFYMESTDLSHSSVQFPCVSLGSKTFDSIPLPSRQIYHQDMLNLKKSQNLSRHTSQRSEIEIQSTNPVLKRGNSQNEDSGLAPNSQLKSQNSVSKPTNHTSSKHNTKNSPTRQILERNSPNKTRSSSLIKNALFGRCKLSSSSNIDDNNQYSVPNSPCKNSSKQLPDFIPLNNTGGYHYVVMTSSLSTPAKQIQEETAKAIKRRSSSTSPGKSSGSSLEKKQLANTNKREKVKEKSKEIKNDNNKIKNKKESKKKLSFLTSPLFGKKKDKDKFSITAPSKATKQQKANPTLQSCSIHHGQHENSSKVISPYCTVTQPKHSAHSSSGHGSDCSSLYGQQHKFSELAGHLKCRECTNIDEEGSCLNHIDQCNIDQHQLLRRSQRRGGGHTSSGYESILRDSEVSSQNDSTSESSLGVAPRAQTPEKQQSQSSSSSSKQSRSAPNRSEETSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEINQKTPIIKSNRV 1636          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000013633.1 (SMESG000013633.1)

HSP 1 Score: 1681.77 bits (4354), Expect = 0.000e+0
Identity = 967/967 (100.00%), Postives = 967/967 (100.00%), Query Frame = 3
Query:  465 QIQCHPQGQNGVAPSFTCTNRLQYFEKPPTDIQPSKYPFDFVSSLHQKNNSYRININNHRYHPVDYSKPFHWAIRNNLASTEQVKMINNNKSNVKLNPGNSNLPKYSSKETTETGTILNKDSTVXXXXXXXXXXXXXXXXXXXPITSGTESTSXXXXXXXXXXXXXXXXEFMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFXXXXXXXXXXXXXXXXFGFRRASRHKGGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKRRISAPSFSNAIPERSGSESDLLKLDIXXXXXXXXXXXXATVRTNALVWPKVAAKNAIETLSTQKEMWVDGPMVSNKTKTQSPESAGNISKFTNTETQTYSIEHNSIVKESNTKAKPVSDVTQPHELNSQITDINANIQKPDXXXXXXXXXXXXXXXXXXXXQESTTAAVGSSDGDHKLTDLFKSIPTSSHSITTGNIHXXXXXXXXXXXXTTHHIVSPQAYKPFVWDWVEKHSDMVVDTPLGNPLTSYPFQIEPMEDVQPSQKRAAKHCAKHQQMLKKSRPAVNNDQVELHEREGRKRHKSAKHKTAQTT 3365
            QIQCHPQGQNGVAPSFTCTNRLQYFEKPPTDIQPSKYPFDFVSSLHQKNNSYRININNHRYHPVDYSKPFHWAIRNNLASTEQVKMINNNKSNVKLNPGNSNLPKYSSKETTETGTILNKDSTVASQSNLAAAASFFAKAGKKPITSGTESTSSFKRKKKIDHSKSKDSEFMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKAAYYLDAALAARTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPSNSTALSLSATAAVLLALVNGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFSKLSGTSSDDSSSCDSFGFRRASRHKGGNAGFSSGSSTNGMTSSEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKRRISAPSFSNAIPERSGSESDLLKLDISKHHNNHHQHSKATVRTNALVWPKVAAKNAIETLSTQKEMWVDGPMVSNKTKTQSPESAGNISKFTNTETQTYSIEHNSIVKESNTKAKPVSDVTQPHELNSQITDINANIQKPDNINTVSMTSTTSTSNDNPSSQESTTAAVGSSDGDHKLTDLFKSIPTSSHSITTGNIHSSNNNSSQLPSSTTHHIVSPQAYKPFVWDWVEKHSDMVVDTPLGNPLTSYPFQIEPMEDVQPSQKRAAKHCAKHQQMLKKSRPAVNNDQVELHEREGRKRHKSAKHKTAQTT
Sbjct:    6 QIQCHPQGQNGVAPSFTCTNRLQYFEKPPTDIQPSKYPFDFVSSLHQKNNSYRININNHRYHPVDYSKPFHWAIRNNLASTEQVKMINNNKSNVKLNPGNSNLPKYSSKETTETGTILNKDSTVASQSNLAAAASFFAKAGKKPITSGTESTSSFKRKKKIDHSKSKDSEFMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRVNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKAAYYLDAALAARTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPSNSTALSLSATAAVLLALVNGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRRKFSKLSGTSSDDSSSCDSFGFRRASRHKGGNAGFSSGSSTNGMTSSEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKRRISAPSFSNAIPERSGSESDLLKLDISKHHNNHHQHSKATVRTNALVWPKVAAKNAIETLSTQKEMWVDGPMVSNKTKTQSPESAGNISKFTNTETQTYSIEHNSIVKESNTKAKPVSDVTQPHELNSQITDINANIQKPDNINTVSMTSTTSTSNDNPSSQESTTAAVGSSDGDHKLTDLFKSIPTSSHSITTGNIHSSNNNSSQLPSSTTHHIVSPQAYKPFVWDWVEKHSDMVVDTPLGNPLTSYPFQIEPMEDVQPSQKRAAKHCAKHQQMLKKSRPAVNNDQVELHEREGRKRHKSAKHKTAQTT 972          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000013633.1 (SMESG000013633.1)

HSP 1 Score: 1026.16 bits (2652), Expect = 0.000e+0
Identity = 606/606 (100.00%), Postives = 606/606 (100.00%), Query Frame = 3
Query: 3624 MSQAGKYPNFYMESTDLSHSSVQFPCVSLGSKTFDSIPLPSRQIYHQDMLNLKKSQNLSRHTSQRSEIEIQSTNPVLKRGNSQNEDSGLAPNSQLKSQNSVSKPTNHTSSKHNTKNSPTRQILERNSPNKTRSSSLIKNALFGRCKLSSSSNIDDNNQYSVPNSPCKNSSKQLPDFIPLNNTGGYHYVVMTSSLSTPAKQIQEETAKAIXXXXXXXXXXXXXXXXLEKKQLANTNKREKVXXXXXXXXXXXXXXXXXXXXXXXLSFLTSPLFGKKKDKDKFSITAPSKATKQQKANPTLQSCSIHHGQHENSSKVISPYCTVTQPKXXXXXXXXXXXXXXXLYGQQHKFSELAGHLKCRECTNIDEEGSCLNHIDQCNIDXXXXXXXXXXXXXXXTSSGYESILRDSEVSSQNDSTSESSLGVAPRAQTPEXXXXXXXXXXXXXXRSAPNRSEETSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEINQKTPIIKSNRV 5441
            MSQAGKYPNFYMESTDLSHSSVQFPCVSLGSKTFDSIPLPSRQIYHQDMLNLKKSQNLSRHTSQRSEIEIQSTNPVLKRGNSQNEDSGLAPNSQLKSQNSVSKPTNHTSSKHNTKNSPTRQILERNSPNKTRSSSLIKNALFGRCKLSSSSNIDDNNQYSVPNSPCKNSSKQLPDFIPLNNTGGYHYVVMTSSLSTPAKQIQEETAKAIKRRSSSTSPGKSSGSSLEKKQLANTNKREKVKEKSKEIKNDNNKIKNKKESKKKLSFLTSPLFGKKKDKDKFSITAPSKATKQQKANPTLQSCSIHHGQHENSSKVISPYCTVTQPKHSAHSSSGHGSDCSSLYGQQHKFSELAGHLKCRECTNIDEEGSCLNHIDQCNIDQHQLLRRSQRRGGGHTSSGYESILRDSEVSSQNDSTSESSLGVAPRAQTPEKQQSQSSSSSSKQSRSAPNRSEETSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEINQKTPIIKSNRV
Sbjct:    1 MSQAGKYPNFYMESTDLSHSSVQFPCVSLGSKTFDSIPLPSRQIYHQDMLNLKKSQNLSRHTSQRSEIEIQSTNPVLKRGNSQNEDSGLAPNSQLKSQNSVSKPTNHTSSKHNTKNSPTRQILERNSPNKTRSSSLIKNALFGRCKLSSSSNIDDNNQYSVPNSPCKNSSKQLPDFIPLNNTGGYHYVVMTSSLSTPAKQIQEETAKAIKRRSSSTSPGKSSGSSLEKKQLANTNKREKVKEKSKEIKNDNNKIKNKKESKKKLSFLTSPLFGKKKDKDKFSITAPSKATKQQKANPTLQSCSIHHGQHENSSKVISPYCTVTQPKHSAHSSSGHGSDCSSLYGQQHKFSELAGHLKCRECTNIDEEGSCLNHIDQCNIDQHQLLRRSQRRGGGHTSSGYESILRDSEVSSQNDSTSESSLGVAPRAQTPEKQQSQSSSSSSKQSRSAPNRSEETSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLLAQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETDILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEINQKTPIIKSNRV 606          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000013625.1 (SMESG000013625.1)

HSP 1 Score: 301.982 bits (772), Expect = 1.473e-94
Identity = 143/143 (100.00%), Postives = 143/143 (100.00%), Query Frame = 3
Query:   36 MITEKELLAPPISALFPNFDSAFEAKSFNAHINGQNGQTVKCSTCNRCLQELFRQGCYLMFGDMRLQSTFNVSRLPNNINEGRLLEKLCLPDHPQIGTDGFCRVCDTRVIQLKIEAARAIRNLKRQNQLAHLQPSHWQTLLNR 464
            MITEKELLAPPISALFPNFDSAFEAKSFNAHINGQNGQTVKCSTCNRCLQELFRQGCYLMFGDMRLQSTFNVSRLPNNINEGRLLEKLCLPDHPQIGTDGFCRVCDTRVIQLKIEAARAIRNLKRQNQLAHLQPSHWQTLLNR
Sbjct:    1 MITEKELLAPPISALFPNFDSAFEAKSFNAHINGQNGQTVKCSTCNRCLQELFRQGCYLMFGDMRLQSTFNVSRLPNNINEGRLLEKLCLPDHPQIGTDGFCRVCDTRVIQLKIEAARAIRNLKRQNQLAHLQPSHWQTLLNR 143          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000028296.1 (SMESG000028296.1)

HSP 1 Score: 198.749 bits (504), Expect = 8.140e-51
Identity = 194/563 (34.46%), Postives = 282/563 (50.09%), Query Frame = 3
Query:  987 FSEILKNSPPPVPPTLLK-TSLTRPLGCNTGKIKVIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRR--VNANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLRGSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIEVYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPTAEKXXXXXXXXXXXRTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVAGGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPXXXXXXXXXXXXXXXXXXXXGQRHIPYRTSKLSQLLRE--AMSSLSCRTCMVAHVAMNTTHCADSMQIIQFASKLQRLKRR-KFXXXXXXXXXXXXXXXXFGFRRASRHK---GGNAGFXXXXXXXXXXXXEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKRRISAPSFSNAIPERSGSESDLLKLDIXXXXXXXXXXXXATVRTNALVWPKVAAKNAIETLSTQKEMWVDGP 2648
            F +IL NS P +PP L K  S        + +I+V ++L     S PE+         C+++D     I++      N TP R    +N PK++  D++  +D    E+CSN+L  +I+SV +G D CV SFG++  S    +IGSD+    +G++PCAI WLF  I   +++  ARFSVR+SA E+ G+QE  +DLL  I    +          +    S +   +  ELRA   EKAAYYLD AL  R+ S   E+  LSH   TLH+YQY ++     S ++GGRS+LH++D G GR+    D+ +  ++    SK  +                 AL + QRHIP   S L+Q L+     S    +T M+  V+   T   +++Q++Q ASKL R K R      S  S D+SSS DSF  RR ++ +   G +       +     SS+ D TSSSE SCDTVIY G   N       S +    R +A   S      S SES+  K +         + +   + +NA  WPKVA K A E + + +E+WVDGP
Sbjct:   54 FHKILSNSVPGLPPNLQKLISTENKSKKESDRIQVFVQL----LSCPETSS-------CLSLDIPNNCISL-----TNPTPSRKFTASNAPKLFPVDSIIHEDCPIMEICSNSLGPVIRSVANGEDACVISFGNVLPSDLNPIIGSDKSPNMIGVMPCAIVWLFNYIQTIRKQEYARFSVRISAAEISGRQENCRDLLLSISNPSSDSS-------QPLNSSSSLFNSLVELRAVNVEKAAYYLDYALTERSKS---EENGLSHMFLTLHLYQYHLQ---NDSGISGGRSKLHIIDLGCGRL--SEDVESTALSIQGISKVIY-----------------ALWSHQRHIPNPDSILAQTLKRLNVNSYTMMQTSMIIKVSGKETQYNEALQVVQLASKLCRQKTRLSKLSSSTCSDDNSSSSDSFSIRRMTKFRSQFGNDLKRLDRLNRTLSISSDVDATSSSEVSCDTVIYRGQPLNSP----PSCV----RGNADGCSQGQIGFSHSESEEKKPEPKLTLFQLKRRTGNKINSNA--WPKVAVKKAKEVMKSGQELWVDGP 558          
The following BLAST results are available for this feature:
BLAST of Kinesin protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF26A4.556e-8443.72kinesin family member 26A [Source:HGNC Symbol;Acc:... [more]
KIF26A8.512e-8443.72kinesin family member 26A [Source:HGNC Symbol;Acc:... [more]
KIF26B1.074e-8343.33kinesin family member 26B [Source:HGNC Symbol;Acc:... [more]
KIF26B1.168e-8343.33kinesin family member 26B [Source:HGNC Symbol;Acc:... [more]
KIF26B1.315e-8343.33kinesin family member 26B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-82.183e-1227.10Kinesin-like protein vab-8 [Source:UniProtKB/Swis... [more]
klp-118.607e-1122.71Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
osm-33.848e-1021.95Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
osm-35.015e-1021.95Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
unc-1166.256e-823.43Kinesin heavy chain [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG145351.453e-5030.47gene:FBgn0031955 transcript:FBtr0343421[more]
CG145351.453e-5030.47gene:FBgn0031955 transcript:FBtr0079564[more]
Klp64D8.343e-1723.06gene:FBgn0004380 transcript:FBtr0077157[more]
Klp68D2.310e-1123.00gene:FBgn0004381 transcript:FBtr0332129[more]
Klp68D2.310e-1123.00gene:FBgn0004381 transcript:FBtr0076030[more]
back to top
BLAST of Kinesin protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif26ba4.212e-9043.57kinesin family member 26Ba [Source:ZFIN;Acc:ZDB-GE... [more]
kif26ab9.925e-9043.29kinesin family member 26Ab [Source:ZFIN;Acc:ZDB-GE... [more]
kif26ba3.633e-8343.40kinesin family member 26Ba [Source:ZFIN;Acc:ZDB-GE... [more]
kif26aa7.960e-8244.89kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GE... [more]
kif26aa1.672e-8144.89kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfh1.191e-8243.14complement factor H [Source:Xenbase;Acc:XB-GENE-98... [more]
cfh3.194e-8242.70complement factor H [Source:Xenbase;Acc:XB-GENE-98... [more]
gyg21.079e-7543.67glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708][more]
gyg21.293e-7543.67glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708][more]
gyg21.296e-7543.10glycogenin 2 [Source:Xenbase;Acc:XB-GENE-5854708][more]
back to top
BLAST of Kinesin protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif26a6.442e-8943.13kinesin family member 26A [Source:MGI Symbol;Acc:M... [more]
Kif26b2.863e-8443.33kinesin family member 26B [Source:MGI Symbol;Acc:M... [more]
Kif26b9.882e-7843.41kinesin family member 26B [Source:MGI Symbol;Acc:M... [more]
Kif3a2.226e-1322.60kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
Kif3a2.457e-1322.60kinesin family member 3A [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q52KG5|KI26A_MOUSE4.506e-8843.13Kinesin-like protein KIF26A OS=Mus musculus OX=100... [more]
sp|Q7TNC6|KI26B_MOUSE2.003e-8343.33Kinesin-like protein KIF26B OS=Mus musculus OX=100... [more]
sp|Q9ULI4|KI26A_HUMAN4.088e-8343.72Kinesin-like protein KIF26A OS=Homo sapiens OX=960... [more]
sp|Q2KJY2|KI26B_HUMAN6.316e-8343.33Kinesin-like protein KIF26B OS=Homo sapiens OX=960... [more]
sp|Q9VLW2|KI26L_DROME1.457e-4930.47Kinesin-like protein CG14535 OS=Drosophila melanog... [more]
back to top
BLAST of Kinesin protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HWK52.883e-11152.51kinesin-like protein KIF26B OS=Lingula unguis OX=7... [more]
K1PG805.916e-10248.43Kinesin-like protein KIF26A OS=Crassostrea gigas O... [more]
A0A210PKW81.321e-10148.02Kinesin-like protein KIF26A OS=Mizuhopecten yessoe... [more]
A0A2C9MAD65.591e-10049.06Kinesin motor domain-containing protein OS=Biompha... [more]
A0A183A9Y31.885e-9937.17Kinesin motor domain-containing protein OS=Echinos... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif26ab1.409e-9244.88kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab1.635e-9244.88kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab2.463e-9244.88kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26aa4.076e-8345.72kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GE... [more]
kif26aa6.344e-8345.72kinesin family member 26Aa [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001911.12.861e-5643.78pep scaffold:Pmarinus_7.0:GL476451:251877:270556:1... [more]
kif3ca6.355e-1522.47kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
kif3a7.180e-1422.83kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif62.251e-1323.40kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
KIF271.416e-1027.44kinesin family member 27 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
KIP22.155e-1125.15Kinesin-related motor protein involved in mitotic ... [more]
KAR31.977e-923.81Minus-end-directed microtubule motor; functions in... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490274.094e-6045.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470757.516e-1426.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491316.171e-1324.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463868.419e-1326.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408362.674e-1222.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif26ab5.536e-9245.82kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab7.230e-9243.88kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab7.317e-9245.82kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ab8.038e-9245.82kinesin family member 26A [Source:NCBI gene;Acc:10... [more]
kif26ba8.326e-8345.73kinesin family member 26B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Kinesin protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013633.10.000e+097.83SMESG000013633.1[more]
SMESG000013633.10.000e+0100.00SMESG000013633.1[more]
SMESG000013633.10.000e+0100.00SMESG000013633.1[more]
SMESG000013625.11.473e-94100.00SMESG000013625.1[more]
SMESG000028296.18.140e-5134.46SMESG000028296.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029805 ID=SMED30029805|Name=Kinesin protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5864bp
GATATAACCTGGATTTATAAATATTTAGAAACATAATGATTACTGAAAAA
GAGCTTCTTGCACCTCCGATATCAGCACTGTTTCCTAATTTTGATTCCGC
CTTTGAAGCTAAATCCTTCAATGCTCACATCAATGGACAAAATGGTCAAA
CAGTGAAATGTTCTACTTGCAATAGATGCTTGCAAGAGTTGTTTCGGCAA
GGATGCTACTTAATGTTTGGAGACATGAGACTGCAATCTACATTCAATGT
TTCACGATTACCAAACAATATCAATGAGGGCAGACTTCTGGAGAAACTTT
GTCTTCCAGATCATCCGCAAATTGGGACGGATGGATTCTGTAGAGTTTGT
GATACGAGGGTAATTCAACTGAAAATTGAAGCTGCAAGAGCAATCAGGAA
TTTAAAAAGGCAAAACCAATTAGCCCACCTTCAGCCTTCTCATTGGCAGA
CTTTATTAAATCGTCAAATTCAATGTCATCCTCAGGGCCAAAATGGGGTA
GCTCCCAGTTTTACTTGTACAAATCGGTTGCAATACTTTGAAAAACCTCC
AACTGATATTCAGCCATCAAAATATCCTTTTGATTTTGTTTCAAGCTTGC
ATCAGAAAAACAATTCCTATCGCATTAATATAAATAATCATAGATATCAT
CCAGTAGACTACTCAAAACCATTTCATTGGGCAATAAGAAATAATTTAGC
CTCCACAGAGCAAGTTAAAATGATAAACAACAACAAGTCAAACGTGAAAC
TAAATCCGGGAAATTCAAATTTACCCAAATATTCCAGTAAAGAAACAACA
GAAACAGGCACAATTCTAAATAAAGACTCAACTGTAGCGTCACAGTCTAA
TTTGGCAGCTGCAGCTTCATTTTTTGCAAAAGCCGGTAAAAAGCCAATTA
CTTCCGGAACAGAATCAACATCATCCTTTAAAAGAAAAAAGAAAATAGAT
CATTCGAAATCAAAAGACTCAGAATTTATGACTTGTTTCAGTGAAATTCT
GAAAAATTCTCCTCCTCCAGTTCCTCCGACTTTATTGAAGACCTCTTTAA
CTAGGCCATTGGGTTGTAATACAGGAAAAATAAAAGTGATTATCAAATTA
AAATATCTCGAAACATCAAAACCGGAAAGTCATCAAAATATTTCACCTTC
TCAAATGTGCATTACTGTGGATAATACCAAGAAACAAATTACAGTTTTTG
AAAGCCACTCTGCAAATTCAACTCCTAGAAGAGTGAATGCCAATATTCCA
AAGATTTATGCTTTTGATGCTGTTTATACAGATGATGACGATCCAACAGA
ACTGTGCTCCAATGCCTTGACAGATATCATTCAATCTGTTGTCAGTGGAA
TTGACGGTTGCGTGTTCTCCTTTGGACATCTTAGAGGAAGTTCAAATTTA
ATAATGATTGGATCGGATCAACAAACCAGAAAGCTCGGTTTGATCCCATG
CGCTATATCATGGCTTTTTCGATTGATTTGTGAACAAAAGGAGAAAACTG
GAGCCCGATTTTCTGTTCGTGTTTCTGCAATTGAAGTTTATGGTAAACAG
GAAATTCTCAAAGATCTTTTGTCAGATATTGAAGTAATCGATAACGTTGG
CCAATGTTCCCCGGGAGTTTATTTGCGCGACGATCCTGTATCCGGTACAC
AGTTACAGAACCAAAGTGAACTTCGAGCTCCAACTGCTGAAAAAGCCGCC
TATTATTTAGATGCAGCTTTGGCAGCAAGAACAATGTCTTTCAATGAAGA
AGATACACGGCTTTCCCATTTTCTATTTACTCTTCATGTTTATCAATATC
GAGTAGAAAGAGGAACAACTGGATCAGCAGTCGCTGGCGGTCGAAGTCGC
TTGCATATGTTGGATTTCGGGTCTGGAAGGATTCTTTCACAGACAGACTT
GTCTAATAAAGAAATAACCCCGACTGACTCGTCCAAACCAGATTTCCCAT
CAAATTCAACCGCACTGTCCTTGTCGGCGACAGCCGCTGTTCTACTTGCC
CTAGTTAATGGACAACGGCATATTCCTTACAGAACAAGCAAATTATCCCA
ATTACTAAGAGAAGCTATGAGCAGCTTATCCTGTAGAACGTGCATGGTAG
CCCATGTCGCTATGAATACTACGCATTGTGCAGACAGTATGCAGATTATT
CAATTTGCTTCAAAATTGCAAAGATTAAAGAGACGGAAGTTCTCCAAATT
GTCTGGCACAAGTTCAGATGATAGTTCGTCTTGTGACAGCTTTGGATTTC
GAAGAGCTAGTAGACATAAAGGTGGTAATGCTGGCTTTTCATCCGGTTCC
AGTACAAATGGAATGACTTCCTCAGAAGCTGATTATACATCAAGCAGTGA
ACAGTCGTGCGATACTGTGATTTATTTAGGAGCTTCTCGTAACAAAGGTG
GAGATGAACACTCGTCGTTCATTTTGAGAAAACGAAGAATTTCAGCTCCG
AGTTTTTCAAATGCTATTCCCGAAAGATCAGGATCAGAATCAGATTTATT
GAAACTTGACATATCAAAGCATCATAATAATCATCATCAGCATTCAAAAG
CAACAGTGAGAACCAACGCGTTAGTATGGCCAAAGGTTGCTGCTAAAAAC
GCCATAGAAACCTTAAGTACCCAAAAGGAAATGTGGGTAGATGGTCCTAT
GGTGTCAAATAAAACCAAAACTCAGTCTCCAGAATCAGCGGGAAATATAT
CAAAGTTCACTAATACGGAAACTCAAACATATTCTATTGAACATAATAGT
ATAGTTAAAGAAAGCAATACAAAAGCAAAACCCGTTTCGGACGTCACCCA
ACCCCATGAATTAAATTCTCAAATTACAGACATCAACGCCAATATTCAAA
AACCGGATAATATAAATACGGTTTCAATGACTTCTACAACTTCTACTTCC
AATGATAACCCTTCGTCTCAGGAATCTACAACTGCGGCTGTTGGTTCATC
CGATGGGGATCATAAACTAACTGATTTATTTAAATCTATCCCAACAAGTT
CTCATTCAATCACAACGGGTAACATTCATTCTTCCAATAATAATTCCTCC
CAGTTACCTTCATCAACGACCCATCATATTGTTTCTCCACAAGCATACAA
ACCTTTCGTTTGGGATTGGGTAGAGAAACATAGCGATATGGTTGTAGATA
CACCACTAGGAAACCCGTTGACTTCCTATCCATTCCAAATTGAACCAATG
GAAGATGTTCAACCTTCCCAAAAACGAGCTGCTAAACATTGTGCTAAGCA
TCAACAAATGTTAAAGAAATCAAGACCAGCGGTAAATAATGATCAGGTGG
AACTCCATGAAAGAGAAGGTCGAAAAAGACATAAATCTGCTAAGCATAAG
ACAGCTCAAACAACCGGTACCTATGAAAATTATAAAACCAATCAGTTTAG
TAATCCTAGTGCTGAACCAAATTTTACTAGAGTCGCGGAATGGGTGAGAT
CGGTTTCTGAAGAAACAAACAGAGCTCAAAGTTTATCTCCAATTCGACGA
AACCATACAGTCAAAGAGAATAAAATTACTTCTCGGAATCATGAAAATAT
TCCAACTACTACTTCTTTCCAAACATCTACAAATTATCGTTCACTTGATA
GACATGCTCAGGGCTTTATTAATATGTCTCAAGCTGGAAAGTATCCTAAC
TTTTATATGGAATCCACAGATCTTTCTCATTCATCGGTTCAATTTCCATG
TGTGTCTTTAGGTTCAAAGACATTTGACTCAATTCCTCTTCCATCTCGTC
AGATTTATCATCAGGATATGTTAAATTTGAAAAAATCCCAAAATTTGTCG
AGGCATACCTCTCAAAGAAGCGAAATCGAAATTCAGTCAACGAATCCCGT
ATTAAAAAGGGGAAATTCTCAAAATGAAGACAGTGGGTTGGCACCAAATA
GTCAGCTAAAGAGCCAAAATTCTGTTTCCAAACCAACTAATCATACATCA
TCAAAGCACAATACCAAAAACTCCCCAACAAGACAAATTTTAGAAAGAAA
TTCTCCAAATAAAACTCGATCGAGTTCTCTAATTAAAAATGCCTTATTTG
GTCGTTGTAAATTGTCTTCCAGCAGTAATATTGATGACAATAATCAGTAC
TCAGTTCCCAACTCCCCTTGTAAAAATTCCAGTAAACAATTACCGGATTT
CATACCTTTAAACAATACTGGAGGTTATCATTATGTTGTTATGACTTCGA
GTCTCAGTACCCCCGCCAAACAGATTCAGGAGGAAACAGCAAAAGCGATT
AAAAGACGATCATCGAGTACTTCGCCTGGTAAAAGTTCTGGTTCAAGCTT
GGAAAAGAAACAATTAGCAAATACAAATAAACGAGAAAAGGTTAAAGAGA
AAAGCAAAGAAATAAAAAACGATAACAATAAAATAAAAAATAAAAAGGAA
TCAAAGAAAAAATTAAGTTTCTTAACCAGTCCACTGTTCGGTAAAAAGAA
AGATAAAGACAAATTTTCCATTACTGCTCCTTCGAAAGCAACTAAACAAC
AAAAAGCCAATCCTACCTTACAATCATGCAGCATTCATCACGGACAACAT
GAAAATTCATCAAAAGTCATCAGTCCATATTGTACCGTAACCCAGCCAAA
ACATTCAGCTCATTCGAGCAGTGGACATGGCAGTGATTGCTCAAGTTTAT
ATGGTCAACAACACAAATTTTCTGAATTAGCTGGTCATCTAAAATGCCGT
GAATGTACAAATATTGACGAAGAGGGATCATGTCTCAATCATATAGATCA
ATGCAACATAGATCAACATCAGCTCTTAAGACGTTCTCAGAGACGTGGTG
GGGGTCATACTAGCAGCGGATATGAAAGTATATTACGAGACAGTGAAGTT
TCATCTCAAAATGATTCAACCAGTGAAAGTTCGCTTGGAGTTGCTCCAAG
AGCTCAAACTCCGGAAAAGCAACAATCTCAATCATCTTCATCATCTTCCA
AACAAAGCAGATCTGCACCAAATAGGTCAGAAGAGACTTCAGAAGACACC
CAAAGTCCTGTTAGTGTTCGAAAACTGTCTCCTAAAACTTCACACAAAAC
ACCACCTAATGACCAATTAAAAAGAGAAAACGAAATTAAAAAAATTGCAA
AACAGATCCAATTTGAAAAGATTTATGATCTTTTAGCTCAACAAGATATG
TTGAAAACTGAATTATTACAATCAAAAGAACGAATATTGGTTGATCCAAC
CTCATGGAGCTATGACTTGCATGTTGTTGAACAAATGGATCCCGAAGATT
CGAGTTTCATTGAAGCATTAGAAAAAGAAACAGATATCCTTCGCCGAAGA
GTGGAAGCTTGTAAATCTCATGTACTACTTATAACGTATTTCGACATCAA
ATACATTCATCCGACATTACCGGAAGTAAAAGGTCATTCTGTAAAATTGG
AAATCAACCAGAAAACCCCAATCATTAAAAGCAATAGAGTATAACAAAAG
AACAACTGACTCTCCTAGACATTCGCCAGAGTGTTGGAAGTTGCTAAAAA
TTTCAAAGTGGCCAATTTTTCGTTTTCATGTTTGATAGCGTATATTTATT
TAATTCTTGTAAATTTTGATTTGATTTTTGTATTGAATTTGACCATTTCA
ATGTTTATCAAGAAAGTTTTTATGAAGAAAAAAAACCACTTTTAAATTTT
ATTTGATTTCAAGTTTTATGTGAGATTAAAATCTATTGTTTTTAACCATG
GAAATTTTAAACTGTGATTTGTTTGAATGTGATGCCTATATCCTATTTGG
TATCCAATCCCATATTTTTGGTGCATCTCTTGAGGTTGTATTTTAGCGTG
AAATTATGGAGATTTATGGAGATTTCTGTTACCTTCAAAACATTCATTGT
AATTGTACAAGACG
back to top

protein sequence of SMED30029805-orf-1

>SMED30029805-orf-1 ID=SMED30029805-orf-1|Name=SMED30029805-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1803bp
MITEKELLAPPISALFPNFDSAFEAKSFNAHINGQNGQTVKCSTCNRCLQ
ELFRQGCYLMFGDMRLQSTFNVSRLPNNINEGRLLEKLCLPDHPQIGTDG
FCRVCDTRVIQLKIEAARAIRNLKRQNQLAHLQPSHWQTLLNRQIQCHPQ
GQNGVAPSFTCTNRLQYFEKPPTDIQPSKYPFDFVSSLHQKNNSYRININ
NHRYHPVDYSKPFHWAIRNNLASTEQVKMINNNKSNVKLNPGNSNLPKYS
SKETTETGTILNKDSTVASQSNLAAAASFFAKAGKKPITSGTESTSSFKR
KKKIDHSKSKDSEFMTCFSEILKNSPPPVPPTLLKTSLTRPLGCNTGKIK
VIIKLKYLETSKPESHQNISPSQMCITVDNTKKQITVFESHSANSTPRRV
NANIPKIYAFDAVYTDDDDPTELCSNALTDIIQSVVSGIDGCVFSFGHLR
GSSNLIMIGSDQQTRKLGLIPCAISWLFRLICEQKEKTGARFSVRVSAIE
VYGKQEILKDLLSDIEVIDNVGQCSPGVYLRDDPVSGTQLQNQSELRAPT
AEKAAYYLDAALAARTMSFNEEDTRLSHFLFTLHVYQYRVERGTTGSAVA
GGRSRLHMLDFGSGRILSQTDLSNKEITPTDSSKPDFPSNSTALSLSATA
AVLLALVNGQRHIPYRTSKLSQLLREAMSSLSCRTCMVAHVAMNTTHCAD
SMQIIQFASKLQRLKRRKFSKLSGTSSDDSSSCDSFGFRRASRHKGGNAG
FSSGSSTNGMTSSEADYTSSSEQSCDTVIYLGASRNKGGDEHSSFILRKR
RISAPSFSNAIPERSGSESDLLKLDISKHHNNHHQHSKATVRTNALVWPK
VAAKNAIETLSTQKEMWVDGPMVSNKTKTQSPESAGNISKFTNTETQTYS
IEHNSIVKESNTKAKPVSDVTQPHELNSQITDINANIQKPDNINTVSMTS
TTSTSNDNPSSQESTTAAVGSSDGDHKLTDLFKSIPTSSHSITTGNIHSS
NNNSSQLPSSTTHHIVSPQAYKPFVWDWVEKHSDMVVDTPLGNPLTSYPF
QIEPMEDVQPSQKRAAKHCAKHQQMLKKSRPAVNNDQVELHEREGRKRHK
SAKHKTAQTTGTYENYKTNQFSNPSAEPNFTRVAEWVRSVSEETNRAQSL
SPIRRNHTVKENKITSRNHENIPTTTSFQTSTNYRSLDRHAQGFINMSQA
GKYPNFYMESTDLSHSSVQFPCVSLGSKTFDSIPLPSRQIYHQDMLNLKK
SQNLSRHTSQRSEIEIQSTNPVLKRGNSQNEDSGLAPNSQLKSQNSVSKP
TNHTSSKHNTKNSPTRQILERNSPNKTRSSSLIKNALFGRCKLSSSSNID
DNNQYSVPNSPCKNSSKQLPDFIPLNNTGGYHYVVMTSSLSTPAKQIQEE
TAKAIKRRSSSTSPGKSSGSSLEKKQLANTNKREKVKEKSKEIKNDNNKI
KNKKESKKKLSFLTSPLFGKKKDKDKFSITAPSKATKQQKANPTLQSCSI
HHGQHENSSKVISPYCTVTQPKHSAHSSSGHGSDCSSLYGQQHKFSELAG
HLKCRECTNIDEEGSCLNHIDQCNIDQHQLLRRSQRRGGGHTSSGYESIL
RDSEVSSQNDSTSESSLGVAPRAQTPEKQQSQSSSSSSKQSRSAPNRSEE
TSEDTQSPVSVRKLSPKTSHKTPPNDQLKRENEIKKIAKQIQFEKIYDLL
AQQDMLKTELLQSKERILVDPTSWSYDLHVVEQMDPEDSSFIEALEKETD
ILRRRVEACKSHVLLITYFDIKYIHPTLPEVKGHSVKLEINQKTPIIKSN
RV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR001627Semap_dom
IPR001752Kinesin_motor_dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0005515protein binding
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1742..1762
NoneNo IPR availableCOILSCoilCoilcoord: 1422..1456
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1427..1457
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 747..769
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 748..769
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1586..1672
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1474..1506
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 948..972
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1252..1331
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1407..1426
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 948..974
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1397..1457
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1584..1682
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1074..1108
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1481..1506
NoneNo IPR availablePANTHERPTHR21608UNCHARACTERIZEDcoord: 38..784
coord: 1694..1772
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 438..459
score: 25.49
coord: 663..684
score: 38.22
coord: 568..585
score: 22.96
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 346..722
e-value: 6.0E-15
score: 8.1
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 383..712
e-value: 5.6E-37
score: 127.4
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 348..714
score: 49.403
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 347..723
e-value: 7.4E-50
score: 171.6
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 340..714