Nucleolar complex protein 2 homolog

Overview
NameNucleolar complex protein 2 homolog
Smed IDSMED30029803
Length (bp)1332
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleolar complex protein 2 homolog (SMED30029803) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleolar complex protein 2 homolog (SMED30029803) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleolar complex protein 2 homolog (SMED30029803) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleolar complex protein 2 homolog (SMED30029803) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029803

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029803h1SMcG0006271 SmedASXL_013573SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029803h1SMcG0006271 SmedASXL_013573SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30029803h1SMcG0006271 dd_Smed_v4_6278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Human
Match: NOC2L (NOC2 like nucleolar associated transcriptional repressor [Source:HGNC Symbol;Acc:HGNC:24517])

HSP 1 Score: 157.918 bits (398), Expect = 2.918e-41
Identity = 85/259 (32.82%), Postives = 141/259 (54.44%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y    K  +   L  I   +  L   L+L+   +Y +AF+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +   GPS  L + LV PL Q+I+G I+L P+AR+ P+R HC++ L  ++       PV   I+E+F  V+FN+K  R S K IN  V+L  S   L    + +  +++++ L +E L   +    FPE +  +  +++SF ++C  + +    + L+ K+++++ ++   R R
Sbjct:  333 LKQMYITYVRNCKFTSPGALPFISFMQWTLTELLALEPGVAYQHAFLYIRQLAIHLRNAMTTRKKETYQSVYNWQYVHCLFLWCRVLSTAGPSEAL-QPLVYPLAQVIIGCIKLIPTARFYPLRMHCIRALTLLSGSSGAFIPVLPFILEMFQQVDFNRKPGRMSSKPINFSVILKLSNVNLQEKAYRDGLVEQLYDLTLEYLHSQAHCIGFPELVLPVVLQLKSFLRECKVANYCRQVQQLLGKVQENSAYICSRRQR 590          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Celegans
Match: pro-2 (Nucleolar complex protein 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:O17580])

HSP 1 Score: 102.834 bits (255), Expect = 3.224e-23
Identity = 61/223 (27.35%), Postives = 114/223 (51.12%), Query Frame = 2
Query:  284 DKSYSYAFIYIRQLAITLRQA-IADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSN--DLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTK----RDSKKTINLMVMLHFSTSQLGTFEHLEQTLDE-VFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFV 928
            +++Y YAF+YIRQ A+ LR A I+  +K  ++S+YNWQ ++ + +W   I      N  + I  LV PL+Q+IVG+ +L  +  +LP+R HC +LL Q+     N  P+     +    +    K+K    + + K  ++   L  S SQ        + + E VF+ ++++  + +   AFP+ +  +   I +  +       ++ ++    KL++H+ FV
Sbjct:  371 EQAYKYAFVYIRQTAVHLRNAMISKGRKDLIFSIYNWQMMQCMYMWVRVIAKAHSVNGAEQIGELVYPLIQVIVGIFKLCNAPTFLPLRLHCCQLLIQLQASCTNYIPILQVSCDCLEELARELKSKPKPVKGAVKLPDIECTLKCS-SQFSDLPQWRKVISEHVFRTMMQSAHLLASQAAFPDVVLPINHRISAILETMKNGDHAHLFRGFQTKLKEHSRFV 592          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Fly
Match: CG9246 (gene:FBgn0032925 transcript:FBtr0081472)

HSP 1 Score: 157.532 bits (397), Expect = 1.575e-41
Identity = 85/259 (32.82%), Postives = 141/259 (54.44%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K +   Y   SK V+ + L  I   +  L+   +L L+ SY + F+YIRQLAI LR A+   KK S  +VYNWQ++ +L LW D +  +     L + L+ PLV +  GVIRL P+A++ P+RFHCL+ L  +        PV   I+E+  S  FN+K    S K +    +L  +  QL      ++ +++V  L++E LA  S S AF + +      I+++ K+C  + ++   K L++K+++ A F+ ++R +
Sbjct:  350 LKAMYLAYVRNSKFVSPNTLPGINFMRRSLVEMFALDLNVSYQHVFLYIRQLAIHLRNAVILKKKDSFQAVYNWQFINSLRLWADLLGASANKPQL-QPLIYPLVTIATGVIRLIPTAQYFPLRFHCLQTLISLAKETNTYVPVLPLIVEVLKSNTFNRKHSAVSMKPVQFTCVLRLNKGQLAENGFRDEVIEQVCGLLLEYLAHESTSLAFSDLVVPTVMAIKTYLKECRNANYARKLKQLLEKIQESARFIEQQRGK 607          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Zebrafish
Match: noc2l (NOC2-like nucleolar associated transcriptional repressor [Source:ZFIN;Acc:ZDB-GENE-000607-75])

HSP 1 Score: 142.51 bits (358), Expect = 3.094e-36
Identity = 82/277 (29.60%), Postives = 143/277 (51.62%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTRRP-NIEKINPNPVFEKYV 997
             K++   Y +  K  + + L  I   +  L    SL    SY + F+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +    PS +++E L+ PL Q+I+G I+L P +R+ P+R HC++ +  ++   K   P    ++EI    +FN+K  R S K IN  V+L  S   L    + +  +++++ LI+E     + S  FPE       ++++F K+C  + +    + L++K++++ + +   R +    +  +     +EK V
Sbjct:  323 LKQMYIAYVQNCKFTSPNTLPMINFMQRTLAEMYSLDTQVSYQHTFLYIRQLAIHLRNAMNLKKKETYQSVYNWQYVHCLYLWCRVLSTIYPS-EVLEPLIYPLCQVIIGCIKLVPISRYYPLRLHCVRAIILLSGNTKTFVPALPFLLEILQQEDFNKKPGRMSVKPINFAVILKLSKFNLQEKAYKDGLVEQLYDLILECFHTQACSIGFPELALPTIIQLKAFLKECKVANYCKQMRQLLEKIQENCSHITGRRQKAAFGVADVTAVAAWEKLV 598          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Zebrafish
Match: noc2l (NOC2-like nucleolar associated transcriptional repressor [Source:ZFIN;Acc:ZDB-GENE-000607-75])

HSP 1 Score: 142.51 bits (358), Expect = 3.171e-36
Identity = 82/277 (29.60%), Postives = 143/277 (51.62%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTRRP-NIEKINPNPVFEKYV 997
             K++   Y +  K  + + L  I   +  L    SL    SY + F+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +    PS +++E L+ PL Q+I+G I+L P +R+ P+R HC++ +  ++   K   P    ++EI    +FN+K  R S K IN  V+L  S   L    + +  +++++ LI+E     + S  FPE       ++++F K+C  + +    + L++K++++ + +   R +    +  +     +EK V
Sbjct:  331 LKQMYIAYVQNCKFTSPNTLPMINFMQRTLAEMYSLDTQVSYQHTFLYIRQLAIHLRNAMNLKKKETYQSVYNWQYVHCLYLWCRVLSTIYPS-EVLEPLIYPLCQVIIGCIKLVPISRYYPLRLHCVRAIILLSGNTKTFVPALPFLLEILQQEDFNKKPGRMSVKPINFAVILKLSKFNLQEKAYKDGLVEQLYDLILECFHTQACSIGFPELALPTIIQLKAFLKECKVANYCKQMRQLLEKIQENCSHITGRRQKAAFGVADVTAVAAWEKLV 606          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Zebrafish
Match: noc2l (NOC2-like nucleolar associated transcriptional repressor [Source:ZFIN;Acc:ZDB-GENE-000607-75])

HSP 1 Score: 142.51 bits (358), Expect = 3.657e-36
Identity = 82/277 (29.60%), Postives = 143/277 (51.62%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTRRP-NIEKINPNPVFEKYV 997
             K++   Y +  K  + + L  I   +  L    SL    SY + F+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +    PS +++E L+ PL Q+I+G I+L P +R+ P+R HC++ +  ++   K   P    ++EI    +FN+K  R S K IN  V+L  S   L    + +  +++++ LI+E     + S  FPE       ++++F K+C  + +    + L++K++++ + +   R +    +  +     +EK V
Sbjct:  331 LKQMYIAYVQNCKFTSPNTLPMINFMQRTLAEMYSLDTQVSYQHTFLYIRQLAIHLRNAMNLKKKETYQSVYNWQYVHCLYLWCRVLSTIYPS-EVLEPLIYPLCQVIIGCIKLVPISRYYPLRLHCVRAIILLSGNTKTFVPALPFLLEILQQEDFNKKPGRMSVKPINFAVILKLSKFNLQEKAYKDGLVEQLYDLILECFHTQACSIGFPELALPTIIQLKAFLKECKVANYCKQMRQLLEKIQENCSHITGRRQKAAFGVADVTAVAAWEKLV 606          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Xenopus
Match: pcgf6 (polycomb group ring finger 6 [Source:Xenbase;Acc:XB-GENE-6258271])

HSP 1 Score: 159.844 bits (403), Expect = 2.421e-42
Identity = 88/259 (33.98%), Postives = 144/259 (55.60%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y + SK  + + L  I   +  L    SL +  SY + F+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +    P N+++E L+ PLVQ+I G IRL P+ R+LP+RFHC++ L  ++       PV    +EIF  VNFN++  R S K IN  V+L  S + L      +  +++++  I+E L   +    FPE +     +++SF K+C  S +    + L++K+++++ ++  +R +
Sbjct:  310 LKKMYISYVKNSKFTSPNVLPMINFMQRTLTEMYSLDVQASYQHIFMYIRQLAIHLRSAMTLKKKMAYQSVYNWQYIHCLYLWCRVLSTIHP-NEILEPLIYPLVQVITGCIRLVPTVRYLPLRFHCIRALTLLSESTSVFIPVLPFSLEIFQMVNFNKRPGRISVKPINFAVILKLSNTNLQEKVFRDGIIEQIYDQILEYLHSQAHFIGFPELVLPCILQLKSFLKECKVSNYCKPMRQLLEKIQENSAYITSKRQK 567          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Xenopus
Match: pcgf6 (polycomb group ring finger 6 [Source:Xenbase;Acc:XB-GENE-6258271])

HSP 1 Score: 159.458 bits (402), Expect = 2.477e-42
Identity = 88/259 (33.98%), Postives = 144/259 (55.60%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y + SK  + + L  I   +  L    SL +  SY + F+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +    P N+++E L+ PLVQ+I G IRL P+ R+LP+RFHC++ L  ++       PV    +EIF  VNFN++  R S K IN  V+L  S + L      +  +++++  I+E L   +    FPE +     +++SF K+C  S +    + L++K+++++ ++  +R +
Sbjct:  297 LKKMYISYVKNSKFTSPNVLPMINFMQRTLTEMYSLDVQASYQHIFMYIRQLAIHLRSAMTLKKKMAYQSVYNWQYIHCLYLWCRVLSTIHP-NEILEPLIYPLVQVITGCIRLVPTVRYLPLRFHCIRALTLLSESTSVFIPVLPFSLEIFQMVNFNKRPGRISVKPINFAVILKLSNTNLQEKVFRDGIIEQIYDQILEYLHSQAHFIGFPELVLPCILQLKSFLKECKVSNYCKPMRQLLEKIQENSAYITSKRQK 554          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Xenopus
Match: pcgf6 (polycomb group ring finger 6 [Source:Xenbase;Acc:XB-GENE-6258271])

HSP 1 Score: 159.844 bits (403), Expect = 3.606e-42
Identity = 88/259 (33.98%), Postives = 144/259 (55.60%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y + SK  + + L  I   +  L    SL +  SY + F+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +    P N+++E L+ PLVQ+I G IRL P+ R+LP+RFHC++ L  ++       PV    +EIF  VNFN++  R S K IN  V+L  S + L      +  +++++  I+E L   +    FPE +     +++SF K+C  S +    + L++K+++++ ++  +R +
Sbjct:  305 LKKMYISYVKNSKFTSPNVLPMINFMQRTLTEMYSLDVQASYQHIFMYIRQLAIHLRSAMTLKKKMAYQSVYNWQYIHCLYLWCRVLSTIHP-NEILEPLIYPLVQVITGCIRLVPTVRYLPLRFHCIRALTLLSESTSVFIPVLPFSLEIFQMVNFNKRPGRISVKPINFAVILKLSNTNLQEKVFRDGIIEQIYDQILEYLHSQAHFIGFPELVLPCILQLKSFLKECKVSNYCKPMRQLLEKIQENSAYITSKRQK 562          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Xenopus
Match: pcgf6 (polycomb group ring finger 6 [Source:Xenbase;Acc:XB-GENE-6258271])

HSP 1 Score: 159.458 bits (402), Expect = 3.942e-42
Identity = 88/259 (33.98%), Postives = 144/259 (55.60%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y + SK  + + L  I   +  L    SL +  SY + F+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +    P N+++E L+ PLVQ+I G IRL P+ R+LP+RFHC++ L  ++       PV    +EIF  VNFN++  R S K IN  V+L  S + L      +  +++++  I+E L   +    FPE +     +++SF K+C  S +    + L++K+++++ ++  +R +
Sbjct:  321 LKKMYISYVKNSKFTSPNVLPMINFMQRTLTEMYSLDVQASYQHIFMYIRQLAIHLRSAMTLKKKMAYQSVYNWQYIHCLYLWCRVLSTIHP-NEILEPLIYPLVQVITGCIRLVPTVRYLPLRFHCIRALTLLSESTSVFIPVLPFSLEIFQMVNFNKRPGRISVKPINFAVILKLSNTNLQEKVFRDGIIEQIYDQILEYLHSQAHFIGFPELVLPCILQLKSFLKECKVSNYCKPMRQLLEKIQENSAYITSKRQK 578          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Xenopus
Match: pcgf6 (polycomb group ring finger 6 [Source:Xenbase;Acc:XB-GENE-6258271])

HSP 1 Score: 159.073 bits (401), Expect = 5.079e-42
Identity = 88/259 (33.98%), Postives = 144/259 (55.60%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y + SK  + + L  I   +  L    SL +  SY + F+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +    P N+++E L+ PLVQ+I G IRL P+ R+LP+RFHC++ L  ++       PV    +EIF  VNFN++  R S K IN  V+L  S + L      +  +++++  I+E L   +    FPE +     +++SF K+C  S +    + L++K+++++ ++  +R +
Sbjct:  303 LKKMYISYVKNSKFTSPNVLPMINFMQRTLTEMYSLDVQASYQHIFMYIRQLAIHLRSAMTLKKKMAYQSVYNWQYIHCLYLWCRVLSTIHP-NEILEPLIYPLVQVITGCIRLVPTVRYLPLRFHCIRALTLLSESTSVFIPVLPFSLEIFQMVNFNKRPGRISVKPINFAVILKLSNTNLQEKVFRDGIIEQIYDQILEYLHSQAHFIGFPELVLPCILQLKSFLKECKVSNYCKPMRQLLEKIQENSAYITSKRQK 560          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Mouse
Match: Noc2l (NOC2 like nucleolar associated transcriptional repressor [Source:MGI Symbol;Acc:MGI:1931051])

HSP 1 Score: 159.458 bits (402), Expect = 4.466e-42
Identity = 85/257 (33.07%), Postives = 145/257 (56.42%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKER 940
             K++  +Y    K  +   L  I   +  L   L+L    SY +AF+YIRQLA+ LR A+   KK +  SVYNWQY+  L LW   +   G S+++++ L+ PL Q+I+G I+L P+AR+ P+R HC++ L  ++       PV   I+EIF  V+FN++  R S K IN  V+L  S++ L    + +  L+++  L +E L   + S AFPE +     +++SF ++C  + +    + L++K++++A  ++  R
Sbjct:  337 LKQMYIMYVRNCKFTSPSTLPLISFMQRTLTEMLALDPSVSYQHAFLYIRQLAVHLRNAMTAGKKETHQSVYNWQYVHCLYLWCRVLSTLG-SSEILQPLLYPLSQIIIGCIKLLPTARFYPLRMHCVRALTLLSQTIGTFIPVLPFILEIFQQVDFNRRPGRMSSKPINFSVILKLSSTNLQEKAYRDGLLEQLCDLTLEYLHSQAHSIAFPELVLPTVLQLKSFLRECKVANYCRQVRQLLEKVQENAQHIQSLR 592          
BLAST of Nucleolar complex protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q9WV70|NOC2L_MOUSE (Nucleolar complex protein 2 homolog OS=Mus musculus OX=10090 GN=Noc2l PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 1.517e-41
Identity = 86/257 (33.46%), Postives = 145/257 (56.42%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKER 940
             K++  +Y    K  +   L  I   +  L   L+L    SY +AF+YIRQLA+ LR A+   KK +  SVYNWQY+  L LW   +   G S+++++ L+ PL Q+I+G I+L P+AR+ P+R HC++ L  ++       PV   I+EIF  V+FN++  R S K IN  V+L  S++ L    + +  L+++  LI+E L   + S AFPE +     +++SF ++C  + +    + L++K++++A  +   R
Sbjct:  334 LKQMYIMYVRNCKFTSPSTLPLISFMQRTLTEMLALDPSVSYQHAFLYIRQLAVHLRNAMTTGKKETHQSVYNWQYVHCLYLWCRVLSTLG-SSEILQPLLYPLSQIIIGCIKLLPTARFYPLRMHCVRALTLLSQTIGTFIPVLPFILEIFQQVDFNRRPGRMSSKPINFSVILKLSSTNLQEKAYRDGLLEQLCDLILEYLHSQAHSIAFPELVLPTVLQLKSFLRECKVANYCRQVRQLLEKVQENARHIESLR 589          
BLAST of Nucleolar complex protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q9Y3T9|NOC2L_HUMAN (Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4)

HSP 1 Score: 157.918 bits (398), Expect = 1.401e-40
Identity = 85/259 (32.82%), Postives = 141/259 (54.44%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y    K  +   L  I   +  L   L+L+   +Y +AF+YIRQLAI LR A+   KK +  SVYNWQY+  L LW   +   GPS  L + LV PL Q+I+G I+L P+AR+ P+R HC++ L  ++       PV   I+E+F  V+FN+K  R S K IN  V+L  S   L    + +  +++++ L +E L   +    FPE +  +  +++SF ++C  + +    + L+ K+++++ ++   R R
Sbjct:  333 LKQMYITYVRNCKFTSPGALPFISFMQWTLTELLALEPGVAYQHAFLYIRQLAIHLRNAMTTRKKETYQSVYNWQYVHCLFLWCRVLSTAGPSEAL-QPLVYPLAQVIIGCIKLIPTARFYPLRMHCIRALTLLSGSSGAFIPVLPFILEMFQQVDFNRKPGRMSSKPINFSVILKLSNVNLQEKAYRDGLVEQLYDLTLEYLHSQAHCIGFPELVLPVVLQLKSFLRECKVANYCRQVQQLLGKVQENSAYICSRRQR 590          
BLAST of Nucleolar complex protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q9VIF0|NOC2L_DROME (Nucleolar complex protein 2 homolog OS=Drosophila melanogaster OX=7227 GN=CG9246 PE=1 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.578e-40
Identity = 85/259 (32.82%), Postives = 141/259 (54.44%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K +   Y   SK V+ + L  I   +  L+   +L L+ SY + F+YIRQLAI LR A+   KK S  +VYNWQ++ +L LW D +  +     L + L+ PLV +  GVIRL P+A++ P+RFHCL+ L  +        PV   I+E+  S  FN+K    S K +    +L  +  QL      ++ +++V  L++E LA  S S AF + +      I+++ K+C  + ++   K L++K+++ A F+ ++R +
Sbjct:  350 LKAMYLAYVRNSKFVSPNTLPGINFMRRSLVEMFALDLNVSYQHVFLYIRQLAIHLRNAVILKKKDSFQAVYNWQFINSLRLWADLLGASANKPQL-QPLIYPLVTIATGVIRLIPTAQYFPLRFHCLQTLISLAKETNTYVPVLPLIVEVLKSNTFNRKHSAVSMKPVQFTCVLRLNKGQLAENGFRDEVIEQVCGLLLEYLAHESTSLAFSDLVVPTVMAIKTYLKECRNANYARKLKQLLEKIQESARFIEQQRGK 607          
BLAST of Nucleolar complex protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q3SYU1|NOC2L_BOVIN (Nucleolar complex protein 2 homolog OS=Bos taurus OX=9913 GN=NOC2L PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 5.500e-39
Identity = 82/259 (31.66%), Postives = 141/259 (54.44%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y    K  +   L  I   +  L   L+L    +Y +AF+YIRQLAI LR A+   +K +  SVYNWQ++  L LW   +    PS  L + L+ PL Q+++G I+L P+AR+ P+R HC++ L  ++       PV   I+EIF  V+FN++  R S + IN  V+L  S   L    + +  +++++ L +E L   + S AFPE +     +++SF ++C  + +    + L++K++++A  +R  R +
Sbjct:  328 LKQMYITYVRNCKFTSPSTLPLINFMQRTLTELLALDTGVAYQHAFLYIRQLAIHLRNAMTTRRKETYQSVYNWQFVHCLYLWCRALSTICPSEAL-QPLIYPLSQVVIGCIKLVPTARFYPLRMHCVRALTLLSESTGTFIPVLPFILEIFQQVDFNRRPGRISSRPINFAVILKLSKVNLQEKAYRDGLVEQLYDLTLEYLHSQAHSIAFPELVLPAVLQLKSFLRECKVANYCRQVRQLLEKVQENAEHIRSVRQK 585          
BLAST of Nucleolar complex protein 2 homolog vs. UniProt/SwissProt
Match: sp|Q9ZPV5|NOC2L_ARATH (Nucleolar complex protein 2 homolog OS=Arabidopsis thaliana OX=3702 GN=At2g18220 PE=3 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.392e-34
Identity = 79/258 (30.62%), Postives = 131/258 (50.78%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERT 943
            FK +   Y    + VNAD L +I    +  I  L   +  +Y +AF++IRQLA+ LR+A+    K +   VY W+++  LELWT  +      ++L   +  PL Q+I GV RL P+AR+ P+R  C+++LN++        PV   ++++      N+       K ++L  +L  S   + T    E  +  V + ++E+L+ +S S AF E  F  T  +RSF K      F    K L+ ++E ++ FV K+R 
Sbjct:  315 FKGMYKAYVLNCQFVNADKLKHISFLGNCFIELLGTDISAAYQHAFVFIRQLAMILREALNTKTKEAFRKVYQWKFIHCLELWTGAVCAYSSQSEL-RPVAYPLAQIITGVARLVPTARYTPLRLRCVRMLNRLAAATGTFIPVSMLLVDMLEMKELNRPPTGGVGKGVDLRTLLKVSKPAVKTRAFQEACVYTVVEELVEHLSQWSCSVAFFELSFIPTIRLRSFCKSTKAERFRKEMKQLISQIEANSEFVNKKRA 571          
BLAST of Nucleolar complex protein 2 homolog vs. TrEMBL
Match: A0A5K3FCE5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 6.278e-51
Identity = 97/267 (36.33%), Postives = 159/267 (59.55%), Query Frame = 2
Query:  191 YFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLS----------------PVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERT 943
            Y   SK +  +++    L K+ L+   SL+L+++Y +AFI+IRQLAI +R+A     K    SVYNWQ++ +L+ W +F+     SNDLI++L+ PL Q+I+G +RL P +RW+P+RFHC++ L+ +    K L                 P    ++++F  V+FN++    SK  ++L +MLHFS SQ     +L+  +  +  L+ E+L +YS S AFPEY     SEI++F K C  + F+  +KSL+ K  +H +FV+++R+
Sbjct:   80 YVRNSKFIYGNSIAKNNLMKNGLLEVYSLQLEEAYRHAFIFIRQLAIAVRKAFLHAGKEECRSVYNWQFICSLKFWCEFVAQRS-SNDLIKTLIHPLTQVILGAVRLSPGSRWIPLRFHCVECLHVLAGVDKRLRNVETQEGKALTRTVLVPSIPLLLDVFQLVDFNKRASSASKAPMDLRLMLHFSQSQRKETAYLDAVVSWLHDLLTESLCLYSNSVAFPEYAAPAISEIKAFLKSCRVAAFARNFKSLLTKAIEHVDFVKRKRS 345          
BLAST of Nucleolar complex protein 2 homolog vs. TrEMBL
Match: A0A0X3PJJ7 (Nucleolar complex protein 2 homolog OS=Schistocephalus solidus OX=70667 GN=NOC2L PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.822e-49
Identity = 103/342 (30.12%), Postives = 181/342 (52.92%), Query Frame = 2
Query:  188 IYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQI-------NYCYKNLSPVFANI----------------IEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTRRPN-------------IEKINPNPVFEKYVESYRVARLNELENIVKATRHTKFQLPQDDYEDKEKN 1105
            +Y + SK +   N+      K+ L+   SL L+++Y +AF++IRQLAIT+R+A     K    +VYNWQ++ +L  W++F+  N  S++L+ +LV PLVQ+I+G + L P +RW+ +RFHC++ L+ +       N    +  P                     +++F   +FN+++   S   ++L +MLHFS SQ      L+     +   + E+L +Y+ S AFPEY     +E+R+F K C  + F+  +K LVKK+++HA+FV+K R+   N             +   + +P+F  Y   +R AR+ EL  + +  ++    L  +D++  +K 
Sbjct:   41 VYVKSSKFIYGSNIGKNNFMKNGLLELYSLDLNEAYKHAFVFIRQLAITVRKAFLRASKEDTRAVYNWQFICSLRFWSEFVSRNANSSELVRTLVHPLVQVILGTVSLSPGSRWIALRFHCVECLHILAGVVQLRNRFSDDGEPAAGTAGASSFGTSLVPSLPLLLDVFRLFDFNKRSSMASSAPMDLRLMLHFSPSQRRETACLDAVCSWLHDFLTESLTLYAGSVAFPEYSLPAVTEMRAFLKTCRVANFTRNFKVLVKKVKEHADFVKKRRSCVKNLTDSQAITAVEAGLTTASDSPLFA-YYAIHRKARVLELTALAERFKNEDTALDAEDHKSAKKT 381          
BLAST of Nucleolar complex protein 2 homolog vs. TrEMBL
Match: A0A068WTJ8 (Nucleolar complex protein 2 OS=Echinococcus granulosus OX=6210 GN=EgrG_000530340 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.947e-49
Identity = 97/271 (35.79%), Postives = 158/271 (58.30%), Query Frame = 2
Query:  188 IYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNL-------------------SPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERT 943
            IY + SK +  +++    L K  L+   SL+LD++Y +AF++IRQLAIT+R+A     K  + SVYNWQ++ +L+ W +F+  N  S+DLI+SL  PL Q+I+G +RL P  RW+P+RFH ++ L+ +    K L                    P    ++++F   +FN++    S+  ++L +MLHFS SQL     ++   D +  L+ E L +Y+ S AFPEY     SE+R F K C  + F+  +KSL+ K ++H +FV+++R+
Sbjct:   45 IYVKNSKFIYGNSIAKNDLMKMGLLEVYSLQLDEAYKHAFVFIRQLAITVRKAFLHADKEEIRSVYNWQFICSLKFWCEFVAYNAASSDLIKSLTHPLTQVILGAVRLSPGNRWIPLRFHLVECLHLVAGVDKRLYNQEDNSSSEKGKSSATLLVPSLPLLLDVFQLFDFNKRASVASRAPMDLRLMLHFSPSQLKETACMDAVADWLHDLLTEALCLYANSIAFPEYSAAALSEVRGFLKSCRVANFTRNFKSLLTKAKEHVDFVKRKRS 315          
BLAST of Nucleolar complex protein 2 homolog vs. TrEMBL
Match: A0A068Y000 (Nucleolar complex protein 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000530340 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 3.308e-49
Identity = 98/271 (36.16%), Postives = 159/271 (58.67%), Query Frame = 2
Query:  188 IYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFH---CLKLLNQIN---YCYKNLSP-------------VFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERT 943
            IY + SK +  +++    L K  L+   SL+LD++Y +AF++IRQLAIT+R+A     K  + SVYNWQ++ +L+ W +F+  N  S+DLI+SL  PL Q+I+G +RL P  RW+P+RFH   CL L+  ++   Y  K+ S                  ++++F   +FN++    S+  ++L +MLHFS SQL     ++     +  L+ E L +Y+ S AFPEY     SE+R F K C  + F+  +KSL+ K ++H +FV+++R+
Sbjct:   45 IYVKNSKFIYGNSIAKNDLMKMGLLEVYSLQLDEAYKHAFVFIRQLAITVRKAFLHADKEEIRSVYNWQFICSLKFWCEFVAHNAASSDLIKSLTHPLTQVILGAVRLSPGNRWIPLRFHLVECLHLVAGVDKRLYNQKDNSSSEKKRSSATLLVPSLPLLLDVFQLFDFNKRASVASRAPMDLRLMLHFSPSQLKETACMDAVAGWLHDLLTEALCLYANSIAFPEYSATALSEVRGFLKSCRVANFTRNFKSLLTKAKEHVDFVKRKRS 315          
BLAST of Nucleolar complex protein 2 homolog vs. TrEMBL
Match: A0A0X3NZP3 (Nucleolar complex protein 2 homolog OS=Schistocephalus solidus OX=70667 GN=NOC2L PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.680e-49
Identity = 103/342 (30.12%), Postives = 181/342 (52.92%), Query Frame = 2
Query:  188 IYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQI-------NYCYKNLSPVFANI----------------IEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTRRPN-------------IEKINPNPVFEKYVESYRVARLNELENIVKATRHTKFQLPQDDYEDKEKN 1105
            +Y + SK +   N+      K+ L+   SL L+++Y +AF++IRQLAIT+R+A     K    +VYNWQ++ +L  W++F+  N  S++L+ +LV PLVQ+I+G + L P +RW+ +RFHC++ L+ +       N    +  P                     +++F   +FN+++   S   ++L +MLHFS SQ      L+     +   + E+L +Y+ S AFPEY     +E+R+F K C  + F+  +K LVKK+++HA+FV+K R+   N             +   + +P+F  Y   +R AR+ EL  + +  ++    L  +D++  +K 
Sbjct:   79 VYVKSSKFIYGSNIGKNNFMKNGLLELYSLDLNEAYKHAFVFIRQLAITVRKAFLRASKEDTRAVYNWQFICSLRFWSEFVSRNANSSELVRTLVHPLVQVILGTVSLSPGSRWIALRFHCVECLHILAGVVQLRNRFSDDGEPAAGTAGASSFGTSLVPSLPLLLDVFRLFDFNKRSSMASSAPMDLRLMLHFSPSQRRETACLDAVCSWLHDFLTESLTLYAGSVAFPEYSLPAVTEMRAFLKTCRVANFTRNFKVLVKKVKEHADFVKKRRSCVKNLTDSQAITAVEAGLTTASDSPLFA-YYAIHRKARVLELTALAERFKNEDTALDAEDHKSAKKT 419          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Cavefish
Match: noc2l (NOC2 like nucleolar associated transcriptional repressor [Source:NCBI gene;Acc:103036253])

HSP 1 Score: 148.673 bits (374), Expect = 2.262e-38
Identity = 84/259 (32.43%), Postives = 138/259 (53.28%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y +  K  + ++L  I   +  L    SL    SY + FIYIRQLAI LR A+   KK +  SVYNWQ++  L LW   +    PS D++E L+ PL Q++ G I+L P +R+ P+R HC++ L  +    K   PV   ++EI    +FN+K  R S K IN  V+L  S + L      +  +++++ LI+E L   + S  FPE       E+++F KKC  + +    + L++K++++ + +   R +
Sbjct:  322 LKQMYISYVQNCKFTSPNSLPIINFMQRTLAEMYSLDTQVSYQHGFIYIRQLAIHLRNAMNMKKKETYQSVYNWQFVHCLYLWCRVLSTIYPS-DVLEPLIYPLCQVVTGCIKLVPISRYYPLRLHCVRALILLCSTTKTFVPVLPFLLEILQQEDFNKKPGRMSVKPINFAVVLKLSKTHLQEKAFKDGLIEQLYDLILEYLHTQANSVGFPELALPTIIELKAFLKKCKVANYCKQIRQLLEKVQENCSHITSRRQK 579          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Yeast
Match: NOC2 (Protein involved in ribosome biogenesis; forms a nucleolar complex with Mak21p that binds to 90S and 66S pre-ribosomes; forms a nuclear complex with Noc3p that binds to 66S pre-ribosomes; both complexes mediate intranuclear transport of ribosomal precursors; acts as part of a Mak21p-Noc2p-Rrp5p module that associates with nascent pre-rRNA during transcription and has a role in bigenesis of the large ribosomal subunit [Source:SGD;Acc:S000005732])

HSP 1 Score: 96.2857 bits (238), Expect = 9.624e-22
Identity = 68/238 (28.57%), Postives = 121/238 (50.84%), Query Frame = 2
Query:  290 SYSYAFIYIRQLAITLRQAI-ADPKKSSVYS-------VYNWQYLKNLELWTDFIV-------DNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVM-----LHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERT 943
             Y   F YIRQLAI LR  + A  KKSS  +       VYNWQ+  +L+ W+  +        +NG S   +  L+ PLVQ+ +GVIRL P+ ++ P+RF+ +K L +++       P++  + EI  S  F     +  KK+ NL        +  + + L T  + E   ++   L+ +  A+Y ++ AFPE +  +   +R + K  +    +    ++V+KL  ++ F++++R+
Sbjct:  398 GYQVGFEYIRQLAIHLRNTMNATTKKSSKINSAEAYKIVYNWQFCHSLDFWSRVLSFACQPEKENG-SESPLRQLIYPLVQVTLGVIRLIPTPQFFPLRFYLIKSLIRLSQNSGVFIPIYPLLSEILTSTAFT----KAPKKSPNLAAFDFEHNIKCTQAYLNTKIYQEGLSEQFVDLLGDYFALYCKNIAFPELVTPVIISLRRYIKTSTNVKLNKRLSTVVEKLNQNSTFIQEKRS 630          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Nematostella
Match: EDO33413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSA7])

HSP 1 Score: 151.754 bits (382), Expect = 7.273e-40
Identity = 77/218 (35.32%), Postives = 127/218 (58.26%), Query Frame = 2
Query:  290 SYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERT 943
            +Y +AFIYIRQ+AI LR AI + KK +  SVYNWQ++  L LW   ++    S  +++ L+ PLVQ+I+G I+L P+ R+ P+RFHC++ L+ ++   K   P  + ++EI +S  FN++ K  + K  +   +L  S SQL T    +  +D VF+L +E  ++++ S AFPE        +R F K      +    K L+ K+E+ +  V ++R+
Sbjct:  416 TYQHAFIYIRQMAIHLRNAIINKKKDAHQSVYNWQFIHCLHLWCR-VLSEVSSQGVLDPLLYPLVQIIMGTIKLVPTCRYYPLRFHCIRSLHMLSQAMKTFVPTSSFLLEILDSPEFNKRVKMSTAKPTDFSCILKVSKSQLSTKPFEDAVIDNVFELFLEFFSIHAYSIAFPELSLSTVVRLRKFIKTTKIPQYRKQMKQLLDKIEETSKEVTEQRS 632          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Medaka
Match: noc2l (NOC2 like nucleolar associated transcriptional repressor [Source:NCBI gene;Acc:101162838])

HSP 1 Score: 159.458 bits (402), Expect = 5.951e-43
Identity = 82/259 (31.66%), Postives = 145/259 (55.98%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y +  K  + + L  +   +  L    SL    +Y + FIYIRQLAI LR A+   KK +  SVYNWQY+  L LW+  +    PS D+++ L+ PL Q+++G I+L P+A++ P+R HC + L  ++       PV   ++EIF  V+FN+K  R SKK IN  V+L  +   L    + +  +D+++ L++E     + S +FPE       ++++F K+C  + +S   + L+ K+++++N++  +R +
Sbjct:  174 LKQMYISYVQNCKFTSPNMLPMVNFMQRTLTEMYSLDTQATYQHGFIYIRQLAIHLRNAMTMKKKETYQSVYNWQYIHCLYLWSRVLSTLHPS-DVLQPLIYPLCQVVIGTIKLVPTAKYYPLRMHCCRALTLLSSSTNTFVPVLPFLLEIFQQVDFNKKPGRMSKKPINFAVILKLNKVNLMEKAYKDGLMDQLYDLMLEYFHSQASSISFPELALPTVIQLKAFLKECKVANYSKPMRQLLDKVQENSNYITAQRQK 431          
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Medaka
Match: noc2l (NOC2 like nucleolar associated transcriptional repressor [Source:NCBI gene;Acc:101162838])

HSP 1 Score: 159.844 bits (403), Expect = 2.851e-42
Identity = 82/259 (31.66%), Postives = 145/259 (55.98%), Query Frame = 2
Query:  170 FKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTR 946
             K++   Y +  K  + + L  +   +  L    SL    +Y + FIYIRQLAI LR A+   KK +  SVYNWQY+  L LW+  +    PS D+++ L+ PL Q+++G I+L P+A++ P+R HC + L  ++       PV   ++EIF  V+FN+K  R SKK IN  V+L  +   L    + +  +D+++ L++E     + S +FPE       ++++F K+C  + +S   + L+ K+++++N++  +R +
Sbjct:  317 LKQMYISYVQNCKFTSPNMLPMVNFMQRTLTEMYSLDTQATYQHGFIYIRQLAIHLRNAMTMKKKETYQSVYNWQYIHCLYLWSRVLSTLHPS-DVLQPLIYPLCQVVIGTIKLVPTAKYYPLRMHCCRALTLLSSSTNTFVPVLPFLLEIFQQVDFNKKPGRMSKKPINFAVILKLNKVNLMEKAYKDGLMDQLYDLMLEYFHSQASSISFPELALPTVIQLKAFLKECKVANYSKPMRQLLDKVQENSNYITAQRQK 574          
BLAST of Nucleolar complex protein 2 homolog vs. Planmine SMEST
Match: SMESG000010165.1 (SMESG000010165.1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 370/371 (99.73%), Postives = 371/371 (100.00%), Query Frame = 2
Query:   23 MPPKKLKSINVKQAKEEIRKKVRTEIKNNPNKLTALXXXXXXXXXXXXXFKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTRRPNIEKINPNPVFEKYVESYRVARLNELENIVKATRHTKFQLPQDDYEDKEKNFDSEDKDKVI 1135
            MPPKKLKSINVKQAKEEIRKKVRTEIKNNPNKLTALKKESKPKKEYHKEFKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNL+PVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTRRPNIEKINPNPVFEKYVESYRVARLNELENIVKATRHTKFQLPQDDYEDKEKNFDSEDKDKVI
Sbjct:    1 MPPKKLKSINVKQAKEEIRKKVRTEIKNNPNKLTALKKESKPKKEYHKEFKRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQLAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLVQPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLTPVFANIIEIFNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIENLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHANFVRKERTRRPNIEKINPNPVFEKYVESYRVARLNELENIVKATRHTKFQLPQDDYEDKEKNFDSEDKDKVI 371          
The following BLAST results are available for this feature:
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NOC2L2.918e-4132.82NOC2 like nucleolar associated transcriptional rep... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pro-23.224e-2327.35Nucleolar complex protein 2 homolog [Source:UniPr... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG92461.575e-4132.82gene:FBgn0032925 transcript:FBtr0081472[more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
noc2l3.094e-3629.60NOC2-like nucleolar associated transcriptional rep... [more]
noc2l3.171e-3629.60NOC2-like nucleolar associated transcriptional rep... [more]
noc2l3.657e-3629.60NOC2-like nucleolar associated transcriptional rep... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcgf62.421e-4233.98polycomb group ring finger 6 [Source:Xenbase;Acc:X... [more]
pcgf62.477e-4233.98polycomb group ring finger 6 [Source:Xenbase;Acc:X... [more]
pcgf63.606e-4233.98polycomb group ring finger 6 [Source:Xenbase;Acc:X... [more]
pcgf63.942e-4233.98polycomb group ring finger 6 [Source:Xenbase;Acc:X... [more]
pcgf65.079e-4233.98polycomb group ring finger 6 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Noc2l4.466e-4233.07NOC2 like nucleolar associated transcriptional rep... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WV70|NOC2L_MOUSE1.517e-4133.46Nucleolar complex protein 2 homolog OS=Mus musculu... [more]
sp|Q9Y3T9|NOC2L_HUMAN1.401e-4032.82Nucleolar complex protein 2 homolog OS=Homo sapien... [more]
sp|Q9VIF0|NOC2L_DROME1.578e-4032.82Nucleolar complex protein 2 homolog OS=Drosophila ... [more]
sp|Q3SYU1|NOC2L_BOVIN5.500e-3931.66Nucleolar complex protein 2 homolog OS=Bos taurus ... [more]
sp|Q9ZPV5|NOC2L_ARATH1.392e-3430.62Nucleolar complex protein 2 homolog OS=Arabidopsis... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FCE56.278e-5136.33Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PJJ71.822e-4930.12Nucleolar complex protein 2 homolog OS=Schistoceph... [more]
A0A068WTJ81.947e-4935.79Nucleolar complex protein 2 OS=Echinococcus granul... [more]
A0A068Y0003.308e-4936.16Nucleolar complex protein 2 OS=Echinococcus multil... [more]
A0A0X3NZP34.680e-4930.12Nucleolar complex protein 2 homolog OS=Schistoceph... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
noc2l2.262e-3832.43NOC2 like nucleolar associated transcriptional rep... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NOC29.624e-2228.57Protein involved in ribosome biogenesis; forms a n... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO334137.273e-4035.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
noc2l5.951e-4331.66NOC2 like nucleolar associated transcriptional rep... [more]
noc2l2.851e-4231.66NOC2 like nucleolar associated transcriptional rep... [more]
back to top
BLAST of Nucleolar complex protein 2 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010165.10.000e+099.73SMESG000010165.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029803 ID=SMED30029803|Name=Nucleolar complex protein 2 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1332bp
TTAGTTAAATTTGGAATTTAACATGCCACCGAAGAAACTTAAATCTATAA
ATGTTAAACAAGCAAAAGAAGAAATTAGAAAAAAAGTACGGACAGAAATT
AAAAATAATCCAAATAAATTGACTGCATTGAAAAAGGAATCAAAGCCTAA
GAAAGAATATCATAAAGAATTTAAAAGACTTATGAATATTTACTTTGAAG
GCTCTAAACACGTTAATGCTGATAATCTGGATAATATAAAGCTATCTAAA
GATGAATTAATCCATCATTTATCATTGAAACTCGATAAATCTTATTCTTA
TGCTTTCATTTATATCCGACAGCTTGCTATCACTCTTCGACAGGCTATAG
CCGATCCAAAAAAGTCCTCGGTTTATTCTGTCTATAATTGGCAGTATTTG
AAGAATTTAGAACTATGGACAGATTTCATTGTTGACAACGGCCCTTCCAA
TGATCTCATCGAATCTCTCGTACAGCCTCTAGTCCAATTGATCGTCGGTG
TAATCAGACTGAGACCTTCCGCTAGGTGGTTGCCAATACGTTTCCATTGT
CTCAAGCTTTTGAACCAGATAAATTATTGCTATAAGAATCTGAGTCCAGT
ATTTGCCAACATAATTGAGATTTTCAATTCTGTGAATTTCAATCAAAAAA
CAAAGCGCGATTCAAAAAAAACTATCAATCTCATGGTGATGTTGCACTTC
TCAACGAGTCAACTCGGCACATTTGAGCATCTTGAACAAACACTTGACGA
AGTGTTCCAATTGATAATTGAGAATCTGGCCGTGTATTCACGCAGCCCCG
CATTTCCTGAATATATCTTCTGTCTGACTTCTGAGATCCGATCTTTCTAC
AAGAAATGTTCCGAATCTATGTTCTCAAATGCCTATAAATCGTTGGTGAA
AAAACTCGAGGATCACGCAAATTTCGTGAGAAAAGAGCGAACTCGTCGGC
CAAATATTGAGAAAATCAATCCAAATCCAGTGTTTGAGAAATACGTCGAA
TCCTACCGAGTTGCCCGGCTGAATGAGTTGGAGAATATTGTCAAGGCTAC
TCGGCATACTAAATTCCAATTGCCACAAGATGACTACGAGGACAAGGAGA
AGAATTTCGATTCTGAGGACAAAGATAAAGTGATTGAGGATGGTAATGAA
TCTAGTGATCTCGACGAGGAGGAGGATGATGATGAATATGATATCGATAG
TGCACAAGAAGTCGATGATGATTAATAAATTATTGATTTTTTAACTTTTT
GTATATTTTTACAAAACCATTAAACCGCTAAAAAATTCAATATGGAAAAC
AGCCTCCAAATTCTAAAAAAATTTTACCGTTC
back to top

protein sequence of SMED30029803-orf-1

>SMED30029803-orf-1 ID=SMED30029803-orf-1|Name=SMED30029803-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=401bp
MPPKKLKSINVKQAKEEIRKKVRTEIKNNPNKLTALKKESKPKKEYHKEF
KRLMNIYFEGSKHVNADNLDNIKLSKDELIHHLSLKLDKSYSYAFIYIRQ
LAITLRQAIADPKKSSVYSVYNWQYLKNLELWTDFIVDNGPSNDLIESLV
QPLVQLIVGVIRLRPSARWLPIRFHCLKLLNQINYCYKNLSPVFANIIEI
FNSVNFNQKTKRDSKKTINLMVMLHFSTSQLGTFEHLEQTLDEVFQLIIE
NLAVYSRSPAFPEYIFCLTSEIRSFYKKCSESMFSNAYKSLVKKLEDHAN
FVRKERTRRPNIEKINPNPVFEKYVESYRVARLNELENIVKATRHTKFQL
PQDDYEDKEKNFDSEDKDKVIEDGNESSDLDEEEDDDEYDIDSAQEVDDD
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR005343Noc2
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003674molecular_function
GO:0003714transcription corepressor activity
GO:0042393histone binding
GO:0070491repressing transcription factor binding
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0022008neurogenesis
GO:0035067negative regulation of histone acetylation
GO:0042273ribosomal large subunit biogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0030690Noc1p-Noc2p complex
GO:0030691Noc2p-Noc3p complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005343Nucleolar complex protein 2PFAMPF03715Noc2coord: 50..308
e-value: 2.9E-66
score: 223.7
IPR005343Nucleolar complex protein 2PANTHERPTHR12687NUCLEOLAR COMPLEX 2 AND RAD4-RELATEDcoord: 50..392
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 352..374
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 352..400
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..400
NoneNo IPR availablePANTHERPTHR12687:SF4NUCLEOLAR COMPLEX PROTEIN 2 HOMOLOGcoord: 50..392
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 129..396