MKS transition zone complex subunit 1

Overview
NameMKS transition zone complex subunit 1
Smed IDSMED30029802
Length (bp)1858
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MKS transition zone complex subunit 1 (SMED30029802) t-SNE clustered cells

Violin plots show distribution of expression levels for MKS transition zone complex subunit 1 (SMED30029802) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MKS transition zone complex subunit 1 (SMED30029802) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MKS transition zone complex subunit 1 (SMED30029802) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029802

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029802SMESG000058562.1 SmedASXL_015366SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029802SMESG000058562.1 dd_Smed_v4_14053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029802SMESG000058562.1 dd_Smed_v4_14053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029802SMESG000058562.1 dd_Smed_v4_14053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029802SMESG000058562.1 dd_Smed_v4_14053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30029802SMESG000058562.1 Contig4320newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029802SMESG000058562.1 Contig4320uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029802SMESG000016838.1 Contig4320newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029802SMESG000016838.1 Contig4320uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30029802SMESG000058563.1 dd_Smed_v6_9884_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029802SMESG000058562.1 dd_Smed_v6_14053_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029802SMESG000058563.1 OX_Smed_1.0.01614ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029802SMESG000058562.1 dd_Smed_v4_14053_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Human
Match: MKS1 (MKS transition zone complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:7121])

HSP 1 Score: 286.574 bits (732), Expect = 2.713e-88
Identity = 188/554 (33.94%), Postives = 298/554 (53.79%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNY--AEEF--------TF---------------------SWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFA---QQIPILTTKDPNTLSYIGE-MVDKKKQSVDEIWKSGG--KYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNK-ENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVP-EDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G A YR + + + NL++RV + ++TS       SN L+Y  A E         TF                      WQ+K+FS  E   +       S ++ +Y +E+  ++ + G   +R+FTY + D +    +    +TT      S++ E M + +++  D     GG  K   V  +P+E  +R  H + +  Q M IMADLG P   L      ++  E VLC + VD +G I ++PDF+     Y +E    K E ++Y+I N+S      E+E+E ++ K+LY R    + SLVG +F+  +P  ++RLFV+GE+  A  +E+ N+Y  +FV++P   W     +QL+G+TQ    K+     ++HF +P  F+  +      E+E+ D++ +WPV+Y EV S+D W RYR EGYG + +P TPG H   V  WRPV      ELRR+F+GGS ELEDL++  IP +F+G+ LS++G RT +TG V  +++C+QQS AF+E    +   +S++ R+ G +    +  V+ AFRRAR R+   RES
Sbjct:   11 GEAVYRSR-DPVRNLRLRVHLQRITS-------SNFLHYQPAAELGKDLIDLATFRPQPTASGHRPEEDEEEEIVIGWQEKLFSQFEVDLYQNETACQSPLDYQYRQEILKLENSGGKKNRRIFTYTDSDRYTNLEEHCQRMTTAASEVPSFLVERMANVRRRRQDRRGMEGGILKSRIVTWEPSEEFVRNNHVINTPLQTMHIMADLG-PYKKLG-----YKKYEHVLCTLKVDSNGVITVKPDFTGLKGPYRIETEGEKQELWKYTIDNVSPHAQPEEEERERRVFKDLYGRHKEYLSSLVGTDFEMTVPG-ALRLFVNGEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTTKSLAMDKVAHFSYPFTFEAFF----LHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVAELRRFFIGGSLELEDLSYVRIPGSFKGERLSRFGLRTETTGTVTFRLHCLQQSRAFMESSSLQKRMRSVLDRLEGFSQQSSIHNVLEAFRRARRRMQEARES 545          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Human
Match: MKS1 (MKS transition zone complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:7121])

HSP 1 Score: 285.034 bits (728), Expect = 6.479e-88
Identity = 170/477 (35.64%), Postives = 271/477 (56.81%), Query Frame = 3
Query:  201 WQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFA---QQIPILTTKDPNTLSYIGE-MVDKKKQSVDEIWKSGG--KYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNK-ENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVP-EDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            WQ+K+FS  E   +       S ++ +Y +E+  ++ + G   +R+FTY + D +    +    +TT      S++ E M + +++  D     GG  K   V  +P+E  +R  H + +  Q M IMADLG P   L      ++  E VLC + VD +G I ++PDF+     Y +E    K E ++Y+I N+S      E+E+E ++ K+LY R    + SLVG +F+  +P  ++RLFV+GE+  A  +E+ N+Y  +FV++P   W     +QL+G+TQ    K+     ++HF +P  F+  +      E+E+ D++ +WPV+Y EV S+D W RYR EGYG + +P TPG H   V  WRPV      ELRR+F+GGS ELEDL++  IP +F+G+ LS++G RT +TG V  +++C+QQS AF+E    +   +S++ R+ G +    +  V+ AFRRAR R+   RES
Sbjct:   70 WQEKLFSQFEVDLYQNETACQSPLDYQYRQEILKLENSGGKKNRRIFTYTDSDRYTNLEEHCQRMTTAASEVPSFLVERMANVRRRRQDRRGMEGGILKSRIVTWEPSEEFVRNNHVINTPLQTMHIMADLG-PYKKLG-----YKKYEHVLCTLKVDSNGVITVKPDFTGLKGPYRIETEGEKQELWKYTIDNVSPHAQPEEEERERRVFKDLYGRHKEYLSSLVGTDFEMTVPG-ALRLFVNGEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTTKSLAMDKVAHFSYPFTFEAFF----LHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVAELRRFFIGGSLELEDLSYVRIPGSFKGERLSRFGLRTETTGTVTFRLHCLQQSRAFMESSSLQKRMRSVLDRLEGFSQQSSIHNVLEAFRRARRRMQEARES 535          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Human
Match: MKS1 (MKS transition zone complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:7121])

HSP 1 Score: 173.711 bits (439), Expect = 3.215e-47
Identity = 135/443 (30.47%), Postives = 224/443 (50.56%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTS--------------------TFQIDENSNA----LNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFA---QQIPILTTKDPNTLSYIGE-MVDKKKQSVDEIWKSGG--KYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNK-ENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVP-EDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVP-------CW 1259
            G A YR + + + NL++RV + ++TS                    TF+    ++      +  EE    WQ+K+FS  E   +       S ++ +Y +E+  ++ + G   +R+FTY + D +    +    +TT      S++ E M + +++  D     GG  K   V  +P+E  +R  H + +  Q M IMADLG P   L      ++  E VLC + VD +G I ++PDF+     Y +E    K E ++Y+I N+S      E+E+E ++ K+LY R    + SLVG +F+  +P  ++RLFV+GE+  A  +E+ N+Y  +FV++P   W     +QL+G+TQ    K+     ++HF +P  F+  +      E+E+ D++ +WPV+Y EV S+D W RYR EGYG + +P TPG      P       CW
Sbjct:   11 GEAVYRSR-DPVRNLRLRVHLQRITSSNFLHYQPAAELGKDLIDLATFRPQPTASGHRPEEDEEEEIVIGWQEKLFSQFEVDLYQNETACQSPLDYQYRQEILKLENSGGKKNRRIFTYTDSDRYTNLEEHCQRMTTAASEVPSFLVERMANVRRRRQDRRGMEGGILKSRIVTWEPSEEFVRNNHVINTPLQTMHIMADLG-PYKKLG-----YKKYEHVLCTLKVDSNGVITVKPDFTGLKGPYRIETEGEKQELWKYTIDNVSPHAQPEEEERERRVFKDLYGRHKEYLSSLVGTDFEMTVPG-ALRLFVNGEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTTKSLAMDKVAHFSYPFTFEAFF----LHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGPSWNRAPFRKGCGVCW 441          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Human
Match: MKS1 (MKS transition zone complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:7121])

HSP 1 Score: 119.398 bits (298), Expect = 3.833e-30
Identity = 64/170 (37.65%), Postives = 105/170 (61.76%), Query Frame = 3
Query:  729 FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVP-EDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPG 1232
            ++Y+I N+S      E+E+E ++ K+LY R    + SLVG +F+  +P  ++RLFV+GE+  A  +E+ N+Y  +FV++P   W     +QL+G+TQ    K+     ++HF +P  F+  +      E+E+ D++ +WPV+Y EV S+D W RYR EGYG + +P TPG
Sbjct:    2 WKYTIDNVSPHAQPEEEERERRVFKDLYGRHKEYLSSLVGTDFEMTVPG-ALRLFVNGEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTTKSLAMDKVAHFSYPFTFEAFF----LHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPG 166          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Human
Match: MKS1 (MKS transition zone complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:7121])

HSP 1 Score: 92.8189 bits (229), Expect = 6.425e-22
Identity = 42/113 (37.17%), Postives = 67/113 (59.29%), Query Frame = 3
Query:  900 GEIAYAYDFEHQNIYAQYFVDVPE-DWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPG 1232
            GE+  A  +E+ N+Y  +FV++P   W     +QL+G+TQ    K+     ++HF +P  F+  +      E+E+ D++ +WPV+Y EV S+D W RYR EGYG + +P TP 
Sbjct:    2 GEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTTKSLAMDKVAHFSYPFTFEAFF----LHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPA 110          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Celegans
Match: mksr-2 (MecKel Syndrome 1 (MKS1)-Related [Source:UniProtKB/TrEMBL;Acc:Q9N423])

HSP 1 Score: 62.7734 bits (151), Expect = 2.927e-11
Identity = 52/184 (28.26%), Postives = 79/184 (42.93%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIK-WPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            +FVSG+I  A  F    +  +Y +     W V   E   G TQ       +    +HF  PI+  +           A  SI+ WP + ++++  D++ R    GYG + +P +PG H     CWRP   S   E+    VGG  +L  L+    P+  E K +S       S G V  ++N I
Sbjct:    4 VFVSGQILSARGFGDNRLSIRYQLSFGGGWRVVQGES-EGQTQTDCPSVFEN---AHFAHPIDLHL-----------ATSSIQGWPRLLLQIWHHDNYGRQEIAGYGTLLLPTSPGKHVLTSGCWRP-KGSWREEMMHKLVGGGLQLTSLSALEDPSIRE-KIVS------VSAGVVKFELNII 164          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Celegans
Match: mks-1 (MecKel-Gruber Syndrome (MKS) homolog [Source:UniProtKB/TrEMBL;Acc:O17269])

HSP 1 Score: 57.3806 bits (137), Expect = 1.771e-8
Identity = 40/153 (26.14%), Postives = 71/153 (46.41%), Query Frame = 3
Query: 1140 PVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEE----KLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIR 1586
            P++ +   ++D W R    GYG   +  TPG     +  WRP+S+   N L   FVG +    D+ +   P +     L + G     +G V++K +C+ QS  F+      +L   +  + +G    S+ +  +++V+  F  AR +LI  R
Sbjct:  294 PLLMLRFMAVDYWGRQYIAGYGSGYVSLTPGKSLSKIHLWRPISH---NSLYEMFVGQAI---DIDYFGTPKS----SLERVGRDGQPSGIVIMKTDCVAQSRQFMARDILYQLKYGSKMADMG--LRSDFYQRIIKVLMEFEEARSKLIIAR 434          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Celegans
Match: mks-1 (MecKel-Gruber Syndrome (MKS) homolog [Source:UniProtKB/TrEMBL;Acc:O17269])

HSP 1 Score: 56.6102 bits (135), Expect = 3.213e-8
Identity = 40/153 (26.14%), Postives = 71/153 (46.41%), Query Frame = 3
Query: 1140 PVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEE----KLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIR 1586
            P++ +   ++D W R    GYG   +  TPG     +  WRP+S+   N L   FVG +    D+ +   P +     L + G     +G V++K +C+ QS  F+      +L   +  + +G    S+ +  +++V+  F  AR +LI  R
Sbjct:  294 PLLMLRFMAVDYWGRQYIAGYGSGYVSLTPGKSLSKIHLWRPISH---NSLYEMFVGQAI---DIDYFGTPKS----SLERVGRDGQPSGIVIMKTDCVAQSRQFMARDILYQLKYGSKMADMG--LRSDFYQRIIKVLMEFEEARSKLIIAR 434          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Celegans
Match: mksr-1 (MecKel Syndrome 1 (MKS1)-Related [Source:UniProtKB/TrEMBL;Acc:Q21191])

HSP 1 Score: 54.299 bits (129), Expect = 5.019e-8
Identity = 47/185 (25.41%), Postives = 73/185 (39.46%), Query Frame = 3
Query:  876 DSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMN 1430
            DSI L + G +      E  N+  +       DW + N E ++  +   RG   +         P E  +          +      WP + +  FS D   +    GYG + IP  PG H   V C+ P  +S   +L       +AE  D     +PA  +G    +Y  RT++ GYV L++N
Sbjct:    5 DSIVLTIHGNVRTTEFPEESNVCVKLSTVATGDWKIINGETVSLSSFSFRGADNQI----FIDLPFECGL----------KGSSPFMWPRLVLNCFSKDHSGKDCVTGYGMLPIPTEPGKHVCRVHCFLPEPSSTVQQLIAKLRRVNAEFVD---PMLPANADG----RYACRTSTKGYVDLEIN 168          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Fly
Match: B9d2 (gene:FBgn0261683 transcript:FBtr0303078)

HSP 1 Score: 67.3958 bits (163), Expect = 1.050e-12
Identity = 43/184 (23.37%), Postives = 87/184 (47.28%), Query Frame = 3
Query:  894 VSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIK-WPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            + G+I  A DF   ++Y ++ +     W +   E + G + ++  +   +   S F  P++  +           +  S++ WP + +EV++++   +    GYG++ +P TPG H+  +  W+   N +   LR  F GG A L   DL ++ +          +Y  +T S+G V++++N I
Sbjct:    6 IIGQILKAVDFAEPHLYCKWSLQSGNAWRLVQGE-VQGQSHVASHRLQSS---SDFAQPLDIHL-----------STASVQGWPRLLVEVYAVNVLQQSWPVGYGFVHVPSTPGTHRLEIGTWKVAPNGLWQSLRERFGGGGAALSKTDLLYSGV---------ERYKLQTLSSGKVIVELNLI 165          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Fly
Match: Mks1 (gene:FBgn0030395 transcript:FBtr0073667)

HSP 1 Score: 60.8474 bits (146), Expect = 2.434e-9
Identity = 50/200 (25.00%), Postives = 88/200 (44.00%), Query Frame = 3
Query:  870 PNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWI---VSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVV--PCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRT----ASTGYVVLKMNCIQQ 1442
            P    R+ +  E+    +FE+ NI+ +Y++  P +        ++ + G T   R         +H G   +  +L ++  +  +          +Y EV SIDSW R R EGY +  IP T  +    +   C RP+ N + + L RYF+GG    +  +F  +    E    S+  F +     +TG + L++  +QQ
Sbjct:  430 PKRMKRVSLLLELQEGQNFENPNIHVRYYLKAPANTFYEGTPGVDTMQGATATCRNAGDWRS--AHLGHCWQVTLLLEEQHHPADLLH-------LYFEVISIDSWQRERCEGYAHYAIPLTSALPTDSIRLQCIRPLGNWL-DALNRYFIGGRQLFDFESFFDVHRQSEMH--SRLNFNSDRPMTTTGTLSLRLQKLQQ 617          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Zebrafish
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 289.656 bits (740), Expect = 1.036e-89
Identity = 177/544 (32.54%), Postives = 292/544 (53.68%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNYA----------------------EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAF------AQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEI----RHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNK-ENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G + YR + +A+ N +IRV+I +VTST  + E+ +    +                      EE   +WQ+K FS  E   + T  N  + +E +Y  ++  ++++     +R+FTY + D F      AQ + I     P  L+     V  ++Q    +  +  K   +  +P+E      H + +  Q M+IMADLG P   L       +  E VLC I  D +G I ++PDF+     Y +E    K E +   ++N S+   + EK++E ++ ++LY R  + + SLVG +F+   P   +RL V+GEI  A  +E+ N+Y  +FVD+P +W   +   L+G+TQ  R ++ +   ++ F +P  F+  +    +KE+E+D S+ +WPV+Y +V S+D W R+RTEGYGY+ IP T G H+     WR V      ELRR+F+GG+ ELED+++  IP TF+G+ LS++GFRT +TG V   +NCIQ + AFI+    K   ++++ ++ G +    V  V+ AF+RA +R+   RE+
Sbjct:   10 GESVYRSR-DAVKNFRIRVRIQRVTSTAALSEHRHQQVLSQQERGVIELETFSTQTASSTDEEELVVAWQEKFFSQYEVDLYQTESNCQTPLERQYHTDIMAMERSKRRQNQRIFTYTDFDRFSKWEEQAQSLVIPAQPTPTFLAERMANVRHRRQERRPVESNVPKSRLITWEPSEEFVKNSHIINTPVQTMYIMADLG-PTGKLG-----LKENEYVLCTIKADGNGVISIKPDFNNNRGAYRLETEGEKREVWRLYLENASSDIQAEEKDREQRMYRDLYTRHKDYLNSLVGQDFEMPPPG-ILRLIVNGEIVSAQGYEYDNLYVHFFVDLPNNWSSVSSHCLSGVTQTCRTRSIEKEDVAFFSYPFSFETFF----HKEDESDGSLPQWPVLYFKVLSLDFWQRFRTEGYGYLVIPSTAGRHRMTCRTWRAVQRGTVAELRRFFIGGAPELEDISYVRIPGTFKGERLSRFGFRTQTTGSVTFTLNCIQHARAFIDASTLKKRRQTVLDQLGGHSQQGSVYNVLEAFQRAHKRMQEARET 541          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Zebrafish
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 287.73 bits (735), Expect = 5.810e-89
Identity = 177/544 (32.54%), Postives = 291/544 (53.49%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQIDEN----------------------SNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAF------AQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEI----RHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNK-ENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G + YR + +A+ N +IRV+I +VTST  + E+                      + +    EE   +WQ+K FS  E   + T  N  + +E +Y  ++  ++++     +R+FTY + D F      AQ + I     P  L+     V  ++Q       +  K   +  +P+E      H + +  Q M+IMADLG P   L       +  E VLC I  D +G I ++PDF+     Y +E    K E +   ++N S+   + EK++E ++ ++LY R  + + SLVG +F+   P   +RL V+GEI  A  +E+ N+Y  +FVD+P +W   +   L+G+TQ  R ++ +   ++ F +P  F+  +    +KE+E+D S+ +WPV+Y +V S+D W R+RTEGYGY+ IP T G H+     WR V      ELRR+F+GG+ ELED+++  IP TF+G+ LS++GFRT +TG V   +NCIQ + AFI+    K   ++++ ++ G +    V  V+ AF+RA +R+   RE+
Sbjct:   10 GESVYRSR-DAVKNFRIRVRIQRVTSTAALSEHLHQQVLSQQERGVIELETFSTQTASSTDEEELVVAWQEKFFSQYEVDLYQTESNCQTPLERQYHTDIMAMERSKRRQNQRIFTYTDFDRFSKWEEQAQSLVIPAQPTPTFLAERMANVRHRRQERRPAESNVPKSRLITWEPSEEFVKNSHIINTPVQTMYIMADLG-PTGKL-----GLKENEYVLCTIKADGNGVISIKPDFNNNRGAYRLETEGEKREVWRLYLENASSDIQAEEKDREQRMYRDLYTRHKDYLNSLVGQDFEMPPPG-ILRLIVNGEIVSAQGYEYDNLYVHFFVDLPNNWSSVSSHCLSGVTQTCRTRSIEKEDVAFFSYPFSFETFF----HKEDESDGSLPQWPVLYFKVLSLDFWQRFRTEGYGYLVIPSTSGRHRMTCRTWRAVQRGTVAELRRFFIGGAPELEDISYVRIPGTFKGERLSRFGFRTQTTGSVTFTLNCIQHARAFIDASTLKKRRQTVLDQLGGHSQQGSVYNVLEAFQRAHKRMQEARET 541          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Zebrafish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 69.707 bits (169), Expect = 1.892e-13
Identity = 54/186 (29.03%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            L + G+I  A  F   +++ ++ V     W ++S L +  G TQ+   +T    Y SH   PI  D+ Y     +         WP ++++V+  DS+ R +  GYGYI +P +PG H+     WRP+  S  ++L   FVGG  +L   DL ++            +Y   T   G V L++ CI
Sbjct:    4 LHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLRE--GQTQVDMPQTGDMAYWSH---PI--DLHYTTKGLQ--------GWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRPL-GSWQDQLSEMFVGGGPQLRSPDLIYSGA---------DRYRLHTVGMGTVELEL-CI 163          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Zebrafish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 69.707 bits (169), Expect = 1.892e-13
Identity = 54/186 (29.03%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            L + G+I  A  F   +++ ++ V     W ++S L +  G TQ+   +T    Y SH   PI  D+ Y     +         WP ++++V+  DS+ R +  GYGYI +P +PG H+     WRP+  S  ++L   FVGG  +L   DL ++            +Y   T   G V L++ CI
Sbjct:    4 LHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLRE--GQTQVDMPQTGDMAYWSH---PI--DLHYTTKGLQ--------GWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRPL-GSWQDQLSEMFVGGGPQLRSPDLIYSGA---------DRYRLHTVGMGTVELEL-CI 163          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Zebrafish
Match: b9d1 (B9 protein domain 1 [Source:NCBI gene;Acc:554150])

HSP 1 Score: 65.855 bits (159), Expect = 8.526e-12
Identity = 54/189 (28.57%), Postives = 88/189 (46.56%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDWI-VSNLEQLTGITQLSRGKTTKTGYLSH---FGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQ 1442
            L V+G+I  A   E+ ++Y +Y      DW   S LE+  GI+Q+     T  G LS    + FP++        T+K   + +   WP I + V+  D++      GYG + IP TPG H + +P + P S S   +   + +G   E  D     + A  EG+ ++    R  S G+V L+ N + +
Sbjct:   11 LMVNGQIESADFPEYDDLYCKYCFVYGHDWAPTSGLEE--GISQI-----TSKGRLSQSLVWNFPLDI-------TFK---STNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTKTIPMFVPESTSRLQKFTSWLMGRRPEFTD---PKVVAQGEGREVT----RVRSQGFVTLQFNIVTK 175          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Xenopus
Match: hnrnpr (heterogeneous nuclear ribonucleoprotein R [Source:Xenbase;Acc:XB-GENE-5726055])

HSP 1 Score: 267.7 bits (683), Expect = 1.934e-81
Identity = 160/532 (30.08%), Postives = 283/532 (53.20%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQI-------DENSNALNYA------------------EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAF------AQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKEN-FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINA 1550
            G A YR + + + NL+IRV + +VT    +       D N   L                     EE   SWQ+K++S  E   +       + ++ +Y ++V ++++  G   +R+FTY +HD +      +Q +     + P  L      V +++Q   +I   G  +  +   P++  IR  H + +  Q M+IMADLG P  +L          E VLC + VD +G I L+PD +     Y +E    K   + Y+++++S      E+E+E  + K+LY+R    + SLVG +F+   P  ++R+F++GEI  A +FE+ N+Y  +FV++P++W     ++L+G+TQ  R KT     +++F +P  F++   +    E +++++ + PV++ EV S+D W RYR EGYG + +P TPG+H      WRPV   +  EL+R+F+GGS ELEDLT+  +P TF+G+ LS+ GFRT S+G + ++++C+  S +F++ +  +   +S++  +  S+    +  V+  
Sbjct:   10 GEAVYRSR-DPIKNLRIRVTLQRVTPAIALVQRVQEEDANRGGLELQALHNNPEANRGPHPNEEKEEVVISWQEKLYSQFEYELYQNEAACRTPLDHQYYQDVLSLERGGGRKNRRIFTYTDHDRYTNLEEHSQSVTTSLDETPTFLVERMANVRRRRQDKRQIDGVGMWHRFITWKPSDDFIRSNHIINTPVQTMYIMADLG-PGGNLG-----LREHEHVLCTVRVDANGVITLKPDVTGTKGPYRLEVEGEKRQLWRYTLQHVSESVQKEEQEREQHIYKDLYSRHKEYLNSLVGSDFEMP-PAGTLRVFINGEIVSAQEFEYDNLYVHFFVELPKNWSSPGFQELSGVTQTCRTKTRARDSVAYFCYPFNFELFLSE----EADSEETTQLPVLFFEVLSLDFWQRYRVEGYGSVVLPGTPGMHVLTAQTWRPVELGVLTELKRFFIGGSPELEDLTYVRVPETFQGQRLSRLGFRTKSSGSLTVRLHCLHHSRSFLDGRSLRKRMQSVLDHLGHSSQQSSIQNVLGT 529          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Xenopus
Match: hnrnpr (heterogeneous nuclear ribonucleoprotein R [Source:Xenbase;Acc:XB-GENE-5726055])

HSP 1 Score: 264.618 bits (675), Expect = 4.738e-80
Identity = 161/533 (30.21%), Postives = 282/533 (52.91%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQI-------DENSNALNYA------------------EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAF------AQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKEN-FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAF 1553
            G A YR + + + NL+IRV + +VT    +       D N   L                     EE   SWQ+K++S  E   +       + ++ +Y ++V ++++  G   +R+FTY +HD +      +Q +     + P  L      V +++Q   +I   G  +  +   P++  IR  H + +  Q M+IMADLG P  +L          E VLC + VD +G I L+PD +     Y +E    K   + Y+++++S      E+E+E  + K+LY+R    + SLVG +F+   P  ++R+F++GEI  A +FE+ N+Y  +FV++P++W     ++L+G+TQ  R KT     +++F +P  F++   +    E +++++ + PV++ EV S+D W RYR EGYG + +P TPG+H      WRPV   +  EL+R+F+GGS ELEDLT+  +P TF+G+ LS+ GFRT S+G + ++++C+  S +       +   +S++  +  S+    +  V++AF
Sbjct:   10 GEAVYRSR-DPIKNLRIRVTLQRVTPAIALVQRVQEEDANRGGLELQALHNNPEANRGPHPNEEKEEVVISWQEKLYSQFEYELYQNEAACRTPLDHQYYQDVLSLERGGGRKNRRIFTYTDHDRYTNLEEHSQSVTTSLDETPTFLVERMANVRRRRQDKRQIDGVGMWHRFITWKPSDDFIRSNHIINTPVQTMYIMADLG-PGGNLG-----LREHEHVLCTVRVDANGVITLKPDVTGTKGPYRLEVEGEKRQLWRYTLQHVSESVQKEEQEREQHIYKDLYSRHKEYLNSLVGSDFEMP-PAGTLRVFINGEIVSAQEFEYDNLYVHFFVELPKNWSSPGFQELSGVTQTCRTKTRARDSVAYFCYPFNFELFLSE----EADSEETTQLPVLFFEVLSLDFWQRYRVEGYGSVVLPGTPGMHVLTAQTWRPVELGVLTELKRFFIGGSPELEDLTYVRVPETFQGQRLSRLGFRTKSSGSLTVRLHCLHHSRSL------RKRMQSVLDHLGHSSQQSSIQNVLDAF 524          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Xenopus
Match: hnrnpr (heterogeneous nuclear ribonucleoprotein R [Source:Xenbase;Acc:XB-GENE-5726055])

HSP 1 Score: 253.832 bits (647), Expect = 4.598e-76
Identity = 157/533 (29.46%), Postives = 276/533 (51.78%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQI-------DENSNALNYA------------------EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAF------AQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKEN-FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAF 1553
            G A YR + + + NL+IRV + +VT    +       D N   L                     EE   SWQ+K++S  E   +       + ++ +Y ++V ++++  G   +R+FTY +HD +      +Q +     + P  L      V +++Q   +I   G  +  +   P++  IR  H + +  Q M+IMADLG P  +L          E VLC + VD +G I L+PD +     Y +E    K   + Y+++++S      E+E+E  + K+LY+R    + SLVG +F+  I               A +FE+ N+Y  +FV++P++W     ++L+G+TQ  R KT     +++F +P  F++   +    E +++++ + PV++ EV S+D W RYR EGYG + +P TPG+H      WRPV   +  EL+R+F+GGS ELEDLT+  +P TF+G+ LS+ GFRT S+G + ++++C+  S +F++ +  +   +S++  +  S+    +  V++AF
Sbjct:   10 GEAVYRSR-DPIKNLRIRVTLQRVTPAIALVQRVQEEDANRGGLELQALHNNPEANRGPHPNEEKEEVVISWQEKLYSQFEYELYQNEAACRTPLDHQYYQDVLSLERGGGRKNRRIFTYTDHDRYTNLEEHSQSVTTSLDETPTFLVERMANVRRRRQDKRQIDGVGMWHRFITWKPSDDFIRSNHIINTPVQTMYIMADLG-PGGNLG-----LREHEHVLCTVRVDANGVITLKPDVTGTKGPYRLEVEGEKRQLWRYTLQHVSESVQKEEQEREQHIYKDLYSRHKEYLNSLVGSDFEMVIS--------------AQEFEYDNLYVHFFVELPKNWSSPGFQELSGVTQTCRTKTRARDSVAYFCYPFNFELFLSE----EADSEETTQLPVLFFEVLSLDFWQRYRVEGYGSVVLPGTPGMHVLTAQTWRPVELGVLTELKRFFIGGSPELEDLTYVRVPETFQGQRLSRLGFRTKSSGSLTVRLHCLHHSRSFLDGRSLRKRMQSVLDHLGHSSQQSSIQNVLDAF 517          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Xenopus
Match: hnrnpr (heterogeneous nuclear ribonucleoprotein R [Source:Xenbase;Acc:XB-GENE-5726055])

HSP 1 Score: 226.483 bits (576), Expect = 4.512e-66
Identity = 145/527 (27.51%), Postives = 256/527 (48.58%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQI-------DENSNALNYA------------------EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFA----QQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKEN-FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAF 1553
            G A YR + + + NL+IRV + +VT    +       D N   L                     EE   SWQ+K++S  E   +       + ++ +Y ++V ++++  G   +R+FTY +HD +         + T+ D      +  M + +++  D+                      R     +FI+  L   I      S      E VLC + VD +G I L+PD +     Y +E    K   + Y+++++S      E+E+E  + K+LY+R    + SLVG +F+  I               A +FE+ N+Y  +FV++P++W     ++L+G+TQ  R KT     +++F +P  F++   +    E +++++ + PV++ EV S+D W RYR EGYG + +P TPG+H      WRPV   +  EL+R+F+GGS ELEDLT+  +P TF+G+ LS+ GFRT S+G + ++++C+  S +       +   +S++  +  S+    +  V++AF
Sbjct:   10 GEAVYRSR-DPIKNLRIRVTLQRVTPAIALVQRVQEEDANRGGLELQALHNNPEANRGPHPNEEKEEVVISWQEKLYSQFEYELYQNEAACRTPLDHQYYQDVLSLERGGGRKNRRIFTYTDHDRYTNLEEHSQSVTTSLDETPTFLVERMANVRRRRQDK----------------------RQICNWLFIILLLYLCIYS----SLGLREHEHVLCTVRVDANGVITLKPDVTGTKGPYRLEVEGEKRQLWRYTLQHVSESVQKEEQEREQHIYKDLYSRHKEYLNSLVGSDFEMVIS--------------AQEFEYDNLYVHFFVELPKNWSSPGFQELSGVTQTCRTKTRARDSVAYFCYPFNFELFLSE----EADSEETTQLPVLFFEVLSLDFWQRYRVEGYGSVVLPGTPGMHVLTAQTWRPVELGVLTELKRFFIGGSPELEDLTYVRVPETFQGQRLSRLGFRTKSSGSLTVRLHCLHHSRSL------RKRMQSVLDHLGHSSQQSSIQNVLDAF 485          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Xenopus
Match: hnrnpr (heterogeneous nuclear ribonucleoprotein R [Source:Xenbase;Acc:XB-GENE-5726055])

HSP 1 Score: 225.328 bits (573), Expect = 7.683e-66
Identity = 148/516 (28.68%), Postives = 270/516 (52.33%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIR--VKISKVTSTFQIDENSNALN---YAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAF------AQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKEN-FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKI-PNDS-IRLFVSGEIAY-AYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAF 1553
            G A YR + + + NL+IR  ++ +++   F I + +N ++   Y  +F +   Q   + R            + ++ +Y ++V ++++  G   +R+FTY +HD +      +Q +     + P  L      V +++Q   +I   G  +  +   P++  IR  H + +  Q M+IMADLG P  +L          E VLC + VD +G I L+PD +     Y +E    K   + Y+++++S      E+E+E  + K+LY+R    + SLVG +F+  + P  S I LF+   +   A +FE+ N+Y  +FV++P++W     ++L+G+TQ  R KT                    + + + ++ + ++  PV++ EV S+D W RYR EGYG + +P TPG+H      WRPV   +  EL+R+F+GGS ELEDLT+  +P TF+G+ LS+ GFRT S+G + ++++C+  S +F++ +  +   +S++  +  S+    +  V+  +
Sbjct:   10 GEAVYRSR-DPIKNLRIRRLLEATELLQLFLISQATNVISCSVYLLQFEYELYQNEAACR------------TPLDHQYYQDVLSLERGGGRKNRRIFTYTDHDRYTNLEEHSQSVTTSLDETPTFLVERMANVRRRRQDKRQIDGVGMWHRFITWKPSDDFIRSNHIINTPVQTMYIMADLG-PGGNLG-----LREHEHVLCTVRVDANGVITLKPDVTGTKGPYRLEVEGEKRQLWRYTLQHVSESVQKEEQEREQHIYKDLYSRHKEYLNSLVGSDFEMPLQPCPSLIHLFIFFYLTVSAQEFEYDNLYVHFFVELPKNWSSPGFQELSGVTQTCRTKTRA------------------RVSTQCHQCNSAVSLPVLFFEVLSLDFWQRYRVEGYGSVVLPGTPGMHVLTAQTWRPVELGVLTELKRFFIGGSPELEDLTYVRVPETFQGQRLSRLGFRTKSSGSLTVRLHCLHHSRSFLDGRSLRKRMQSVLDHLGHSSQQSSIQNVLGTY 488          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Mouse
Match: Mks1 (Meckel syndrome, type 1 [Source:MGI Symbol;Acc:MGI:3584243])

HSP 1 Score: 280.796 bits (717), Expect = 3.120e-86
Identity = 180/550 (32.73%), Postives = 298/550 (54.18%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTS--------------------TFQIDENSNA----LNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHD------AFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEI----RHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKEN----FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPE-DWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G A YR + + + NL++RV + ++TS                    TF+  + ++         EE    WQ+K+FS  E   +       S ++ +Y +E+  ++ + G   +R+FTY + D       + Q+I    ++ P+ L+     V +++Q    +  S  K   V  +P+E      H++ +  Q M+IMADLG P   L      ++  E VLC + VD +G I ++PDF+     Y +E    K+     ++Y+I N+S+     E+E+E ++ K+LY R    + SLVG +F+   P  ++RLFV+GE+  A  +E+ N+Y  +FV++P  +W     +QL+G+TQ    K+     +++F FP  F+  +      E+E+ +S+ +WPV+Y +V S+D W RYR EGYG + +P TPG H   V  WRP+   +  ELRR+F+GGS ELED ++  IP TF+G+ LS++GFRT +TG V  +++C+QQS AF+E    +   +S++ R+ G +       V+ AFRRAR R+   RES
Sbjct:   11 GEAVYRSR-DPVRNLRLRVHLQRITSSNFLHYQPAAQMGKDLIDLATFRPPQAASGHRPDEEEEEEVVIGWQEKLFSQFEVDLYQNESACQSPLDHQYRQEILKLENSGGRKNRRIFTYTDSDRYTDLEEYCQKITTSASEVPSFLAERMANVRRRRQDRRGVEGSKLKSRIVTWEPSEDFIKNNHAINTPLQTMYIMADLG-PYGKLG-----YKVHEHVLCILKVDSNGVITVKPDFTGIKGPYRIETEGEKQEHTSAWKYTIDNVSSLAQPEEEEREQRVFKDLYGRHKEYLSSLVGTDFEMIAPG-ALRLFVNGEVVSAQGYEYDNLYVHFFVELPAANWSSPPFQQLSGVTQACATKSLGMDKVAYFSFPFTFEAFF----LHEDESAESLPEWPVLYCKVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPMELGLVAELRRFFIGGSLELEDPSYVRIPGTFKGERLSRFGFRTETTGTVTFRLHCLQQSRAFMESNSLQKQMRSVLDRLEGFSQQSSTHNVLEAFRRARRRMQEARES 548          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Mouse
Match: B9d2 (B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:2387643])

HSP 1 Score: 67.781 bits (164), Expect = 1.191e-12
Identity = 49/184 (26.63%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  894 VSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAEL--EDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            V G+I  A  F   +++ ++ +     W ++S + +  G TQ+   +     Y SH   PI  D+ +     +         WP ++++V+S DS+ R +  GYG+  +P +PG H+   P WRP+  S   +L R FVGG  +L   D  ++            +Y   TA+ G V L +  +
Sbjct:    6 VIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVRE--GQTQVDTPQIGDMAYWSH---PI--DLHFATKGLQ--------GWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPL-GSWREQLARAFVGGGPQLLHADTIYSGA---------DRYRLHTAAGGTVHLGIGLL 164          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Mouse
Match: B9d2 (B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:2387643])

HSP 1 Score: 67.781 bits (164), Expect = 1.191e-12
Identity = 49/184 (26.63%), Postives = 85/184 (46.20%), Query Frame = 3
Query:  894 VSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAEL--EDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            V G+I  A  F   +++ ++ +     W ++S + +  G TQ+   +     Y SH   PI  D+ +     +         WP ++++V+S DS+ R +  GYG+  +P +PG H+   P WRP+  S   +L R FVGG  +L   D  ++            +Y   TA+ G V L +  +
Sbjct:    6 VIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVRE--GQTQVDTPQIGDMAYWSH---PI--DLHFATKGLQ--------GWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPL-GSWREQLARAFVGGGPQLLHADTIYSGA---------DRYRLHTAAGGTVHLGIGLL 164          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Mouse
Match: B9d1 (B9 protein domain 1 [Source:MGI Symbol;Acc:MGI:1351471])

HSP 1 Score: 65.0846 bits (157), Expect = 1.446e-11
Identity = 51/205 (24.88%), Postives = 94/205 (45.85%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDWI-VSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVG 1499
            L ++G++  A   E+ ++Y +Y     +DW   + LE+  GI+Q++  K+        + FPI+        T+K     +   WP I + V+  D +      GYG + +P +PG HKR +P + P S S   +   +F+G   E  D     + A  EG+ ++    R  S G+V L  N + +    +       +++ ++G
Sbjct:   11 LMITGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEE--GISQIAS-KSQDVRQALVWNFPIDV-------TFKST---NPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPLSPGRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTD---PKVVAQGEGREVT----RVRSQGFVTLLFNVVTKDMKKLGYDTGPVDTQGVLG 195          
BLAST of MKS transition zone complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9NXB0|MKS1_HUMAN (Meckel syndrome type 1 protein OS=Homo sapiens OX=9606 GN=MKS1 PE=1 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 1.303e-87
Identity = 188/554 (33.94%), Postives = 298/554 (53.79%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNY--AEEF--------TF---------------------SWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFA---QQIPILTTKDPNTLSYIGE-MVDKKKQSVDEIWKSGG--KYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNK-ENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVP-EDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G A YR + + + NL++RV + ++TS       SN L+Y  A E         TF                      WQ+K+FS  E   +       S ++ +Y +E+  ++ + G   +R+FTY + D +    +    +TT      S++ E M + +++  D     GG  K   V  +P+E  +R  H + +  Q M IMADLG P   L      ++  E VLC + VD +G I ++PDF+     Y +E    K E ++Y+I N+S      E+E+E ++ K+LY R    + SLVG +F+  +P  ++RLFV+GE+  A  +E+ N+Y  +FV++P   W     +QL+G+TQ    K+     ++HF +P  F+  +      E+E+ D++ +WPV+Y EV S+D W RYR EGYG + +P TPG H   V  WRPV      ELRR+F+GGS ELEDL++  IP +F+G+ LS++G RT +TG V  +++C+QQS AF+E    +   +S++ R+ G +    +  V+ AFRRAR R+   RES
Sbjct:   11 GEAVYRSR-DPVRNLRLRVHLQRITS-------SNFLHYQPAAELGKDLIDLATFRPQPTASGHRPEEDEEEEIVIGWQEKLFSQFEVDLYQNETACQSPLDYQYRQEILKLENSGGKKNRRIFTYTDSDRYTNLEEHCQRMTTAASEVPSFLVERMANVRRRRQDRRGMEGGILKSRIVTWEPSEEFVRNNHVINTPLQTMHIMADLG-PYKKLG-----YKKYEHVLCTLKVDSNGVITVKPDFTGLKGPYRIETEGEKQELWKYTIDNVSPHAQPEEEERERRVFKDLYGRHKEYLSSLVGTDFEMTVPG-ALRLFVNGEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTTKSLAMDKVAHFSYPFTFEAFF----LHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVAELRRFFIGGSLELEDLSYVRIPGSFKGERLSRFGLRTETTGTVTFRLHCLQQSRAFMESSSLQKRMRSVLDRLEGFSQQSSIHNVLEAFRRARRRMQEARES 545          
BLAST of MKS transition zone complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q499Q5|MKS1_RAT (Meckel syndrome type 1 protein homolog OS=Rattus norvegicus OX=10116 GN=Mks1 PE=2 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 1.678e-86
Identity = 182/550 (33.09%), Postives = 299/550 (54.36%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTS--------------------TFQIDENSNA----LNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHD------AFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKEN----FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPE-DWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G A YR + + + NL++RV + ++TS                    TF+  + ++         EE    WQ+K+FS  E   +       S ++ +Y +EV  ++ + G   +R+FTY + D       + Q+I     + P+ L      V +++Q    +  S  K   +  +P+E  IR  H++ +  Q M+IMADLG P   L      ++  E VLC + VD +G I ++PDF+     Y +E    K+     ++Y+I N+S+     E+E+E ++ K+LY R    + SLVG +F+   P  ++RLFV+GE+  A  +EH N+Y  +FV++P  +W   + +QL+G+TQ    ++     +++F FP  F+  +      E+E+D+S+ +WPV+Y +V S+D W RYR EGYG + +P TPG H      WRP+   +  ELRR+F+GGS ELED ++  IP TF+G+ LS++GFRT +TG V  +++C+QQS AF+E    +   +S++ R+ G +       V+ AFRRAR R+   RES
Sbjct:   11 GEAVYRSR-DPVRNLRLRVHLQRITSSNFLHYQPAAQMGKDLIDLATFKPPQAASGHRPDEEEEEEVIIGWQEKLFSQFEVDLYQNESACQSPLDHQYRQEVLKLENSGGRKNRRIFTYTDSDRYTDLEEYCQKITTSAGEAPSFLVERMANVRRRRQDRRGVEGSKLKSRIITWEPSEDFIRNSHAINTPLQTMYIMADLG-PYGKLG-----YKIHEHVLCVLKVDSNGVITVKPDFTGIKGPYRIETEGEKQEHTSAWKYTIDNVSSLAQPEEEEREQRVFKDLYGRHKEYLSSLVGTDFEMIAPG-ALRLFVNGEVVSARGYEHDNLYVHFFVELPATNWSSPSFQQLSGVTQTCVTRSLGMDKVAYFSFPFTFEAFF----LHEDESDESLPEWPVLYCKVLSLDFWQRYRVEGYGAVVLPVTPGSHTLTASTWRPMELGLVAELRRFFIGGSLELEDPSYVRIPGTFKGERLSRFGFRTETTGTVTFRLHCLQQSRAFMESNSLRKQMRSVLDRLEGFSQQSSTHNVLEAFRRARRRMQEARES 548          
BLAST of MKS transition zone complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q5SW45|MKS1_MOUSE (Meckel syndrome type 1 protein homolog OS=Mus musculus OX=10090 GN=Mks1 PE=1 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 2.182e-85
Identity = 180/550 (32.73%), Postives = 298/550 (54.18%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTS--------------------TFQIDENSNA----LNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHD------AFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEI----RHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKEN----FEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPE-DWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G A YR + + + NL++RV + ++TS                    TF+  + ++         EE    WQ+K+FS  E   +       S ++ +Y +E+  ++ + G   +R+FTY + D       + Q+I    ++ P+ L+     V +++Q    +  S  K   V  +P+E      H++ +  Q M+IMADLG P   L      ++  E VLC + VD +G I ++PDF+     Y +E    K+     ++Y+I N+S+     E+E+E ++ K+LY R    + SLVG +F+   P  ++RLFV+GE+  A  +E+ N+Y  +FV++P  +W     +QL+G+TQ    K+     +++F FP  F+  +      E+E+ +S+ +WPV+Y +V S+D W RYR EGYG + +P TPG H   V  WRP+   +  ELRR+F+GGS ELED ++  IP TF+G+ LS++GFRT +TG V  +++C+QQS AF+E    +   +S++ R+ G +       V+ AFRRAR R+   RES
Sbjct:   11 GEAVYRSR-DPVRNLRLRVHLQRITSSNFLHYQPAAQMGKDLIDLATFRPPQAASGHRPDEEEEEEVVIGWQEKLFSQFEVDLYQNESACQSPLDHQYRQEILKLENSGGRKNRRIFTYTDSDRYTDLEEYCQKITTSASEVPSFLAERMANVRRRRQDRRGVEGSKLKSRIVTWEPSEDFIKNNHAINTPLQTMYIMADLG-PYGKLG-----YKVHEHVLCILKVDSNGVITVKPDFTGIKGPYRIETEGEKQEHTSAWKYTIDNVSSLAQPEEEEREQRVFKDLYGRHKEYLSSLVGTDFEMIAPG-ALRLFVNGEVVSAQGYEYDNLYVHFFVELPAANWSSPPFQQLSGVTQACATKSLGMDKVAYFSFPFTFEAFF----LHEDESAESLPEWPVLYCKVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPMELGLVAELRRFFIGGSLELEDPSYVRIPGTFKGERLSRFGFRTETTGTVTFRLHCLQQSRAFMESNSLQKQMRSVLDRLEGFSQQSSTHNVLEAFRRARRRMQEARES 548          
BLAST of MKS transition zone complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q6DGZ1|B9D2_DANRE (B9 domain-containing protein 2 OS=Danio rerio OX=7955 GN=b9d2 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.428e-12
Identity = 54/186 (29.03%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            L + G+I  A  F   +++ ++ V     W ++S L +  G TQ+   +T    Y SH   PI  D+ Y     +         WP ++++V+  DS+ R +  GYGYI +P +PG H+     WRP+  S  ++L   FVGG  +L   DL ++            +Y   T   G V L++ CI
Sbjct:    4 LHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLRE--GQTQVDMPQTGDMAYWSH---PI--DLHYTTKGLQ--------GWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRPL-GSWQDQLSEMFVGGGPQLRSPDLIYSGA---------DRYRLHTVGMGTVELEL-CI 163          
BLAST of MKS transition zone complex subunit 1 vs. UniProt/SwissProt
Match: sp|P0C5J3|B9D2_RAT (B9 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=B9d2 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.730e-12
Identity = 50/184 (27.17%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  894 VSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAEL--EDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            V G+I  A  F   +++ ++ +     W ++S + +  G TQ+   +T    Y SH   PI  D+ +     +         WP ++++V+S DS+ R +  GYG+  +P +PG H+   P WRP+  S   +L R FVGG  +L   D  ++            +Y   TA+ G V L +  +
Sbjct:    6 VIGQIIGATGFSEGSLFCKWGIHTGAAWKLLSGVRE--GQTQVDTPQTGDMAYWSH---PI--DLHFATKGLQ--------GWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPL-GSWREQLARAFVGGGPQLLHADTIYSGA---------DRYRLHTAAGGTVHLGIGLL 164          
BLAST of MKS transition zone complex subunit 1 vs. TrEMBL
Match: A0A1S3HGE1 (Meckel syndrome type 1 protein OS=Lingula unguis OX=7574 GN=LOC106154314 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 1.704e-108
Identity = 209/553 (37.79%), Postives = 318/553 (57.50%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTST-----FQID-ENSNALNYA--------------EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAF------AQQIPILTTKDPNTLS-------YIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNE----IRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVE-NPFNKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRESDMLSF 1607
            G   YR + + + NLKIRV + +VTS       Q++ E+   +                 EE+TFSWQ+KVFS RE   +S   N   V+E KY ++V+ +K+  G PTKRLF+Y  +D F       Q      ++ PN LS           + ++K++S + I     K N V  +P E      H + + +  M+IM DL        +D +  E  E VLC I VD +G I ++PDFSKG   Y +E     +E +EY++++ S      E+++E K+ KELY R    + ++VG +F+   P D +R+ V GEI  A +F++ N+Y  YFV++P +W V   +QL+G+TQ    K      ++++ FP  F++ Y+  T  E   D   KWPV+YIEV S+DSW RYRTEGYGY+ +P  PGV    V CWRP  NS+ +ELRR+F+GGS ELEDL++ S+P+TFEG +LSKYGF+T +TG V +++N + QS AF+++  +K    +L+ R+  ++    +M V++AF+RAR+R+I  RE+ +  F
Sbjct:   10 GAGYYRSR-DPVKNLKIRVCVERVTSASIVPQAQLEKEHGGGMGLQDVRKQQQAMSKKDREEYTFSWQEKVFSQREVDLYSKEENCTGVLERKYHQDVQPLKEK-GRPTKRLFSYTANDPFTDQKEHVQHATTSVSEQPNILSQRAANVRRRRVVANRKRESENAIVP---KINIVDLEPTEESVKQNHFISTPQHTMYIMVDLSSA-----DDEATIED-EYVLCVIKVDINGVISIKPDFSKGKKPYRIETQSIGREVYEYTLEDASAKMSRQEQDRERKMYKELYNRHGEFLTAVVGHDFEMP-PPDVLRMLVYGEIVSAKNFDYDNLYIHYFVELPRNWRVDRNQQLSGVTQTCTTKVEGRDNVAYYSFPFNFEVFYKNETVIEENKDLLPKWPVMYIEVLSLDSWQRYRTEGYGYLTLPCIPGVSTEEVTCWRPTGNSVVSELRRFFIGGSPELEDLSYISVPSTFEGSHLSKYGFKTETTGSVTVRLNILHQSQAFLDKAHSKKKMGNLMDRLGATSSQLSIMNVLDAFQRARQRMISARENLLKEF 550          
BLAST of MKS transition zone complex subunit 1 vs. TrEMBL
Match: R7URQ4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_157534 PE=4 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 2.395e-105
Identity = 196/550 (35.64%), Postives = 310/550 (56.36%), Query Frame = 3
Query:   60 YGVASYRIKPNALPNLKIRVKISKVTST--------------------FQIDENSNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFA---QQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGG-KYNPVLEDPNE----IRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENP-FNKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATF-----EGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRESDMLSF 1607
            YG A YR + N++ NLK+R+ + +VTS                      ++ +N       E +TF WQ+KVF  RE   +  + N  +V+E KY +++  +K+ +  PTKRLF+YV HD+F    + + ++TT      + + E ++  +       + G  K N V  +P+E      H + +  Q M+IMADL     + NE      + E V+C I VD +G + ++PDF+KG   Y +E P   ++ F+Y+I++ S      ++E+E K+ +E + R     ++ +G +F+  +P D +R  V GEI  A DFE+ ++Y  +F+D+P+ W+ +   QL G+TQ    K      +++F FP EFD+ Y++N   E   +    WP +YIEV S+DSW RYRTEGYG+  +P  PGVH+  V CWRP   S  +ELRR+F+GGS ELED+T+ + P+TF     +GK LSK+GFRT STG V L+MN IQQS +F+    +K     ++ RI  S+    +  V++AF+RA++R+I  R++    F
Sbjct:    6 YGSAFYRSQ-NSIKNLKVRINLERVTSASIVPQVELEQEAGSDLELKEARLKQNFGGQKDVETYTFKWQEKVFCQREINIYGDSSNCHTVLERKYHQDINQLKEQSSRPTKRLFSYVEHDSFTCKDENVRMMTTSPNEGPTIMAEKMNGLRHRRAPGNRVGAPKMNLVDLNPSEDLIKQNHLMSTPVQTMYIMADLTPSSREPNE------ADEFVICTIRVDGNGVLSIKPDFNKGGRPYKLEAPGMGRDMFDYTIEHGSILLSRQDQERENKMQREFFGRHAEYNRAHIGYDFE-PVPGDMLRQVVYGEIESAKDFEYGDLYISFFLDLPDGWLPNGQRQLQGVTQTCSTKVIGRDNVAYFSFPFEFDLYYKQNVLDEKGNETLPSWPQLYIEVLSLDSWQRYRTEGYGFFTLPCRPGVHREDVHCWRPAGQSAVSELRRFFIGGSPELEDVTYAAKPSTFDISFYQGKRLSKFGFRTISTGSVSLRMNVIQQSQSFLRTSSSKKKVGHIMDRIGYSHAQVNIANVLDAFQRAKQRMISARDTLRTGF 547          
BLAST of MKS transition zone complex subunit 1 vs. TrEMBL
Match: V4ASP5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_228399 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 7.623e-103
Identity = 199/551 (36.12%), Postives = 310/551 (56.26%), Query Frame = 3
Query:   36 MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTF-----------------QIDENSNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPIL------TTKDPNTLS----YIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIR----HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVE-NPFNKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            M+ L E   G A YR   + L NL+ RV + ++TST                   +D+ S+  +  E+    WQ+KVF  RE   +S   N  +V+++KY  +V  + +  G PT R+F+YV+HD+F+ Q   L        + P+ L+    +I       +Q+ +       K N V+ DP++ R    H      Q M+IMADL       +E+S N      +LC + VD  G + ++PDF++G   Y++E     KE FEY+I++ S P    E+EKEMK+ +E+Y R    +Q+ VG  F+   P D +RL V GE+  A DF+  NIY Q+F+D+P+DW   + +QL+ +TQ  + KT     ++HFGFP + ++ Y++    E   D    +P+IY+EV S+DSW RYRTEGY Y  +P  PG       CWRP+ +S+ + LRR+F+GGS ELE  T+T+IP+TF+G +LSK+GFRT +TG V ++ N + QS  F+++K NK +  +L+  +  ++    V  VI AF++AR +++  RES
Sbjct:    1 MADLYEPDVGTAYYRSN-DPLKNLRFRVTLKRITSTSIVPQAQNKSEDDDVELQSVDQKSSVQSDEEQMVILWQEKVFGQREIDLYSNADNCYNVMDQKYFEDVSKLLEK-GRPTNRIFSYVDHDSFSNQDETLNYMTSSAKEKPSNLAKNMAHIRRRRIGGRQAKERELGIIPKTNIVVADPSDERIAKNHIDAPPMQVMYIMADLSPREQPASEESEN------ILCSLHVDAHGVLSIRPDFNRGRKAYIIETGTLGKEVFEYTIEHASKPMNRLEQEKEMKMYREVYTRHKEFLQACVGSEFEMP-PPDVLRLLVFGELEMAKDFDSDNIYIQFFIDLPKDWYAESPQQLSWVTQTCQLKTKGQNNIAHFGFPFQVELFYKREIITEENKDVMPHFPIIYVEVLSLDSWQRYRTEGYTYFSLPGKPGTSYETQDCWRPLKDSVVSNLRRFFIGGSPELEFPTYTAIPSTFDGSHLSKFGFRTETTGSVCMRFNTMLQSRMFVQKKSNKKSLGALLDNLGITSQQASVASVIEAFKKARLKMLQARES 542          
BLAST of MKS transition zone complex subunit 1 vs. TrEMBL
Match: A0A210PUU5 (Meckel syndrome type 1 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16825 PE=4 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 7.146e-102
Identity = 200/521 (38.39%), Postives = 298/521 (57.20%), Query Frame = 3
Query:   36 MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTFQI--------DENSNALNYA-------EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQ---IPILTTKDPNTLSYIGE-MVDKKKQSV----DEIWKSGG---KYNPVLEDP-NEIR---HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRIS 1508
            M+ L E   G A YR   + + NL I VK+ +VTS+  +        D+N    N +       EE  F WQ+K+F  RE   +S   N   V+E+KY R+V  I    G P  RLF+YV+HD F+Q    I  LTT      S + E M + +++ V     E+ +  G   K N V  DP +E+R   H + +  Q  +IMADL        E+ +  + +E VLC + +D +G I LQPDF+KG   YVVEN    + FEY+I++ S      E++KE K+ +E+Y+R  + +Q+ VG +F+   P   +RL V GE+  A DFE+ ++Y  +FVD+P+ W     +QL+ +TQ  + K  +   +++F FP  F++ Y+  + +E + +    +P+I +EV S+D W R+RTEGY YI IP  PG +K    CWRP+  S   ELRR+F+GGS ELED+T+T++P+TF+G +LSKYGFRT STG V  K+N I QS  F+E+K NK    +L+  + 
Sbjct:    1 MADLYEPDLGAAYYRSN-DPVKNLNISVKLERVTSSSIVPQQADEKEDQNVEMQNMSDEVQKDEEEKVFHWQEKIFCLREVDLYSNEANCEGVMEKKYHRDVTEILDK-GKPNNRLFSYVDHDKFSQHDETIKYLTTSANEKPSLLSEKMANLRRRKVGGGKKEVNRDVGFVPKINTVDYDPSDELRNRNHIMAAPMQVHYIMADLSR-----REEGNGTKEEEAVLCTVQIDANGVISLQPDFNKGKKPYVVENNIKGDVFEYTIEHSSKTMNRQEQDKEQKMYREVYSRHADFLQACVGEDFELP-PMGVLRLLVYGEMECARDFEYDDLYLHFFVDLPKHWTADRSQQLSWVTQTCKTKVERRDNVAYFSFPFNFELFYKDTSIREQDKEPLPHFPIIMVEVLSLDMWNRFRTEGYTYINIPTHPGTYKENARCWRPIGRSAAAELRRFFIGGSPELEDITYTAVPSTFQGSHLSKYGFRTESTGTVKAKLNVILQSQGFMEKKANKKTLGNLLDNLG 513          
BLAST of MKS transition zone complex subunit 1 vs. TrEMBL
Match: C3YD63 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_279949 PE=4 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 7.722e-101
Identity = 180/479 (37.58%), Postives = 290/479 (60.54%), Query Frame = 3
Query:  183 EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFA--QQIPILTTKDPNTLSYIGEMVD--KKKQSVDEIWKSGGKYNPVLEDPNE--IR--HSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPF-NKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            EEFTF WQQK+FS RE   +S   N  + ++EKY  EV +++Q  G P KR+F+YV+HD F   ++   +TT      S++ E +   ++++  D         N V   P E  IR  H + + +Q M+IMADL         + +   S E VLC I VD +G I ++PDF++    Y +E     +E +EY+++++S    S E+++E K+ KELYA+    + + VG  F+   P   +RL + GEI  A +FE+ N++  +F+++P +W   + +QL+G+T     K      +++F +P E+++ ++  T      DD  +WP+++++V S+DSW RYRTEGYGY  IP  PGVH + +  WRPV NS+ + +RR+FVGGS ELED T+T++P TF+G+ LSK+GFRT S+G + +K+ C+QQS AF+E    K  + +L+ R+ G +    +M V++AF++AR+R+   RE+
Sbjct:   70 EEFTFQWQQKLFSQREMDVYSNKSNVLTYLDEKYNHEVTSLEQKGGRPNKRIFSYVDHDRFTNLEEYDTMTTSPNEDQSFLVERMSQVRRRRHADRGGNIPRNKNLVNMKPTEDFIRNNHVINTPQQTMYIMADLS------ARNRTPELSDEYVLCTIQVDNNGVISIKPDFNRSRGPYRLETEGERREIYEYTLQHVSKAMSSQEQDREHKMYKELYAKHIETLAASVGEQFEMPPPG-ILRLNLYGEIVSARNFEYDNLHINFFLELPRNWTADHGQQLSGVTHTVATKVEDRDNVAYFSYPFEYEVFFRNET-----EDDMPQWPLLFLQVLSVDSWQRYRTEGYGYCSIPSAPGVHHKTIHTWRPVGNSLVDPMRRFFVGGSPELEDPTYTAVPTTFDGQRLSKFGFRTESSGSIQIKLYCVQQSQAFLETTTKKRKTATLLDRLGGMSAQSNIMNVLDAFQKARKRMQSAREN 536          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Cavefish
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 265.388 bits (677), Expect = 6.883e-81
Identity = 159/479 (33.19%), Postives = 261/479 (54.49%), Query Frame = 3
Query:  183 EEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEM---VDKKKQSVDEIWKSGGKYNPVLEDPN----EIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNK-ENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            EE    WQ+K FS  E   + T     + +E++Y  E+  +++      +R+F+Y + D F     +      N+ +++ +    V  ++Q    I  +  K   ++ +P+    +  H V +S Q M IMADLG P   L       +  E VLC I  D +G I ++PDF+     Y +E    K E +   ++N S P  S EK++E ++ ++LY+R  + + SLVG +F+       I +F    I  A  +E+ N+Y  +F+++P  W     + L+G+TQ  R +T     ++ F +P  F+  ++K    E+E+ DS+ KWPV+Y +V S+D W RYRTEGYGY+ +P TPG H+     WRP+      ELRR+F+GG+ ELED++   IP TF+G +LS++GF T +TG V   +NCIQ + AF++    K   ++++ ++ G +    V  V+ AF+RAR+R+   RES
Sbjct:   55 EELVVGWQEKFFSQYEVDLYQTESLCQTPLEKQYHAEIVAMEKARKRKNQRIFSYTDFDRFTNWEEVTQ----NSTTFLADRMANVRHRRQERRPIDTNIPKTRLIVWEPSTEFMKNSHIVNTSMQTMHIMADLG-PAGKLG-----LKENEYVLCTIRADSNGVITVKPDFNNNRGPYRLETEGEKREVWRLYLENASAPIHSEEKQREQRMYRDLYSRHKDYLNSLVGQDFEMV---GIICMFYQSTIFSARGYEYDNLYVNFFLELPNSWSGVPFQSLSGVTQTCRTRTLGKDNVAFFSYPFSFESFFRK----EDESADSLPKWPVLYFKVLSLDFWQRYRTEGYGYLVVPSTPGYHRVTCHTWRPLQTGTVAELRRFFIGGAPELEDISDVRIPGTFKGDHLSRFGFHTQTTGSVTFNLNCIQHARAFVDANTLKKKRQTVLDQLGGHSQQGSVYNVLEAFQRARKRMQEARES 516          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Cavefish
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 247.669 bits (631), Expect = 3.918e-74
Identity = 164/541 (30.31%), Postives = 274/541 (50.65%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQIDEN----------------------SNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEM---VDKKKQSVDEIWKSGGKYNPVLEDPN----EIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNK-ENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G A YR + +A+ N KIRV+I +VTST  +  +                      + + +  EE    WQ+K FS  E   + T     + +E++Y  E+  ++++     +R+F+Y + D F     +      N+ +++ +    V  ++Q    I  +  K   V+ +P+    +  H V +S Q M IMADLG P   L       +  E VLC I  D +G I ++PDF+     Y +E    K E +   ++N S P  S EK++E ++ ++LY+R  + + SLVG +F+           + G    A  +E+ N+Y  +F+++P  W     + L+G+TQ  R +T     ++ F +P  F+  ++K    E+E++DS+ KWPV+Y +V S+D W RYRTEGYGY+ +P +PG H+     WRP+      ELRR+F+GG+ ELE                 ++GF T +TG V   +NCIQ + AF++    K   ++++ ++ G +    V  V+ AF+RAR+R+   RES
Sbjct:   10 GEAVYRSR-DAVKNFKIRVRIQRVTSTAALSHHLQQQVLSQQERGIIELDTFVSQTRSTSDEEELVVGWQEKFFSQYEVDLYQTESLCQTPLEKQYHAEIVAMEKSRKRKNQRIFSYTDFDRFTNWEEVTQ----NSTTFLADRMANVRHRRQERRPIDTNIPKTRLVVWEPSTEFMKNSHIVNTSMQTMHIMADLG-PAGKLG-----LKENEYVLCTIRADSNGVITVKPDFNNNRGPYRLETEGEKREVWRLYLENASAPIHSEEKQREQRMYRDLYSRHKDYLNSLVGQDFE-----------MVGRSFSAQGYEYDNLYVNFFLELPNSWSSVPFQSLSGVTQTCRTRTLGKDNVAFFSYPFSFESFFRK----EDESEDSLPKWPVLYFKVLSLDFWQRYRTEGYGYLVVPSSPGYHRVTCHTWRPLQTGTVAELRRFFIGGAPELEG--------------YHRFGFHTQTTGSVTFNLNCIQHARAFVDANTLKKKRQTVLDQLGGHSQQGSVYNVLEAFQRARKRMQEARES 510          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Cavefish
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:103038659])

HSP 1 Score: 68.5514 bits (166), Expect = 8.427e-13
Identity = 55/192 (28.65%), Postives = 90/192 (46.88%), Query Frame = 3
Query:  870 PNDSI-RLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWI-VSNLEQLTGITQL-SRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            PN S+  L +SG+I  A   E+ ++Y +Y      DW   S LE+  GI+Q+ S+G+ +    + +F   I F            ++ +   WP I + V+  D++      GYG + IP TPG H R +P + P S S   +   + +G   E  D     + A  EG+ ++    R  S G+V L+ + I
Sbjct:    4 PNPSVFLLMISGQIEGAQFPEYDDLYCKYCFVYGHDWAPTSGLEE--GISQITSKGRGSTQSLVWNFPLDITF------------KSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTRTIPMFVPESTSRLQKFTSWLMGRRPEYTD---PKVVAQGEGREVT----RVRSQGFVTLQFSII 174          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Cavefish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:103043513])

HSP 1 Score: 67.0106 bits (162), Expect = 1.321e-12
Identity = 52/186 (27.96%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            L + G+I  A  F   +++ ++ V     W ++S L++  G TQ+   +   T Y SH   PI  D+ Y     +         WP ++++V+  DS+ R    GYGY  IP +PG H+     WRP+  +   +L + FVGG  +L   DL ++            +Y   T + G V L +  I
Sbjct:    4 LHIIGQIVGASGFPQSSLFCKWGVHTGGAWRLLSGLKE--GQTQVDMPQIGDTAYWSH---PI--DLHYTTKGLQ--------GWPKLHLQVWYQDSFGRCELYGYGYCHIPSSPGQHRLQCATWRPL-GTWQEQLAQMFVGGGPQLRSPDLIYSGA---------DRYRLHTVAMGNVELDLCVI 164          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Cavefish
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:103038659])

HSP 1 Score: 60.4622 bits (145), Expect = 3.177e-10
Identity = 47/174 (27.01%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  927 EHQNIYAQYFVDVPEDWI-VSNLEQLTGITQL-SRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQ 1442
            E+ ++Y +Y      DW   S LE+  GI+Q+ S+G+ +    + +F   I F            ++ +   WP I + V+  D++      GYG + IP TPG H R +P + P S S   +   + +G   E  D     + A  EG+ ++    R  S G+V L+ + I +
Sbjct:    7 EYDDLYCKYCFVYGHDWAPTSGLEE--GISQITSKGRGSTQSLVWNFPLDITF------------KSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTRTIPMFVPESTSRLQKFTSWLMGRRPEYTD---PKVVAQGEGREVT----RVRSQGFVTLQFSIITK 159          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Sea Lamprey
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 216.853 bits (551), Expect = 3.625e-66
Identity = 114/271 (42.07%), Postives = 166/271 (61.25%), Query Frame = 3
Query:  810 YARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVP--EDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRESDMLSFNL 1613
            Y R T  + SLVG  F+   P   +RL V+GEI  A DFE+ N+  + FV++P   DW  +  EQL  +T     K+     ++HF FP  F+  ++K    E+E+D S+  WP +Y+EV S+D W RYRTEGY Y+ IP  PG  + V   WRPV   +T+ELRR+F+GG  ELED T+ +IP+TF+G  LS+YGF+T +TG + +K++CIQQS AF +   +K    S++ ++ G +    +  V+ AF+RAR+R+   R  D L  NL
Sbjct:    2 YTRHTEYLTSLVGSEFEMPPPG-ILRLVVNGEIVSAKDFEYDNLSVRMFVEMPTTSDWSSNPNEQLFWVTHTCATKSKNKNNVAHFSFPFSFEAFFKK----EDESDVSLPHWPTLYMEVVSVDFWHRYRTEGYSYLLIPSMPGYSEVVCQAWRPVQPGLTSELRRFFIGGFNELEDPTYVAIPSTFQGDKLSRYGFKTETTGSITVKLHCIQQSRAFQDTNNSKQRMWSVLDQLGGYSQQSAIHNVLEAFQRARQRMQASR--DTLPTNL 265          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Nematostella
Match: EDO39397 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA52])

HSP 1 Score: 226.098 bits (575), Expect = 1.399e-67
Identity = 146/453 (32.23%), Postives = 230/453 (50.77%), Query Frame = 3
Query:  264 SVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTP----------SSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            S +E+ Y  EV+ +++  G P +RLF YV+ DAF      L    P                    W+        ++ P++  H +       +     GY   D +  S N          I +D +G I+++PDF+ G   Y +E             NI T             S +KE+E+K   ELY R    +QS +G  F++ I    +RL + GEI  A  FE+  +Y  +F++ P +W       ++G+T     K      ++HF FP E+ ++Y       +  D  +KWP++++EV S+DSW R+RTEGYGY  IP   G H+ V+  WRP+ N    ELRR+F+GGS ELED T+   P   E K LSK+ FRTA++G V +++N +QQ  AF+E K +K ++++L+ R+ G+     + +V++AF+RAR+R+I  RE+
Sbjct:   12 SGLEQHYKDEVQRLRERGGRPNRRLFCYVDEDAFVN----LDETSP--------------------WR--------VQPPHKPCHYI-------YFRDSQGYCTCDKHNLSQNAHYGRPGSGYI-IDINGQILVKPDFNGGHLGYRIETQTESRAVVDDSMNILTDCKKFDFVIYIFFSDQKEQEIKSFNELYNRHALYLQSQIGQEFESVIEPGVLRLDLFGEIVSAKGFEYDGLYVHFFLESPSEWTFEGSPIMSGVTHTCNVKAYGEDDVAHFCFPFEYSLVYDAR----HSPDAFVKWPLLFVEVMSLDSWERHRTEGYGYTVIPNKAGSHEIVINTWRPIGNGPVPELRRFFIGGSPELEDPTYPQQPVATEEKVLSKFYFRTATSGSVTIRLNVVQQCQAFMESKKSKKHARTLLDRLGGTRALDSLGQVMDAFQRARKRMISARET 420          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Nematostella
Match: EDO46834 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP12])

HSP 1 Score: 70.0922 bits (170), Expect = 4.308e-14
Identity = 52/185 (28.11%), Postives = 88/185 (47.57%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIK-WPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            L V GE+  A  F   N+Y ++ V V   W +++ L++  G TQ+   +  +    + +G PI+              A   +K WP  + +V+  D++ R    GYGY  +P +PG HK     WRP + S   +LR +FVGG+ +L+     S    + G    +Y  +T + G V L++  +
Sbjct:    4 LHVIGEVIGASGFPSHNLYCKWSVHVEGSWKLIAGLKE--GQTQVDNPQNEEE---AKWGHPIDLHF-----------ATKGLKGWPKFHFQVWHQDAYGRNEIYGYGYCHVPTSPGSHKIDCVTWRP-TGSWREQLRTFFVGGAPQLK-----SSDVIYSGS--DRYRLKTEAMGTVHLQLGIV 164          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Nematostella
Match: EDO26199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP12])

HSP 1 Score: 70.0922 bits (170), Expect = 4.308e-14
Identity = 52/185 (28.11%), Postives = 88/185 (47.57%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIK-WPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            L V GE+  A  F   N+Y ++ V V   W +++ L++  G TQ+   +  +    + +G PI+              A   +K WP  + +V+  D++ R    GYGY  +P +PG HK     WRP + S   +LR +FVGG+ +L+     S    + G    +Y  +T + G V L++  +
Sbjct:    4 LHVIGEVIGASGFPSHNLYCKWSVHVEGSWKLIAGLKE--GQTQVDNPQNEEE---AKWGHPIDLHF-----------ATKGLKGWPKFHFQVWHQDAYGRNEIYGYGYCHVPTSPGSHKIDCVTWRP-TGSWREQLRTFFVGGAPQLK-----SSDVIYSGS--DRYRLKTEAMGTVHLQLGIV 164          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Nematostella
Match: EDO27867 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T829])

HSP 1 Score: 69.3218 bits (168), Expect = 3.455e-13
Identity = 62/205 (30.24%), Postives = 95/205 (46.34%), Query Frame = 3
Query:  102 NLKIRVKISKVTST-----FQIDEN-------------------------SNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFA---QQIPILTTKDPNTLSYIGE-MVDKKKQSV-----DEIWKSGG---KYNPVLEDPNEI----RHSVRSSEQEMFIMADLGYPIN 578
            N  IRVKI K+TS      F+I                            + A + AEE  F WQQK FS RE   +S++    S +E+ Y  EV+ +++  G P +RLF YV+ DAF    ++   LT+      S++ E M++ ++++V     D   + GG     NPV    +EI     H + ++ + M IMADL   I+
Sbjct:   21 NFAIRVKIKKITSASFLPGFRIGSQHDVQEGAEMAGEAVEMPEIGRNRPETEANDEAEEMVFYWQQKAFSQREMEIYSSDSLYGSGLEQHYKDEVQRLRERGGRPNRRLFCYVDEDAFVNLDEESRTLTSSPTEVPSFLVEKMLNVRQRNVGGSKLDRRHRPGGFSHHINPVTTYTSEIAKDTAHVISTTFRRMHIMADLAQDIS 225          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Nematostella
Match: EDO44485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP3])

HSP 1 Score: 67.0106 bits (162), Expect = 1.181e-12
Identity = 53/186 (28.49%), Postives = 88/186 (47.31%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIV-SNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQ 1442
            + VSG+I  A   E  ++Y ++     +DW+V S  E+  GI+Q+++ K+     +  + FPI+        T+K         WP I I  + +D + R    GYG I +P TPG H R +P + P S+S   +L  + +G   E  D     + A  EG+ ++    R  S G V +  N + +
Sbjct:   11 VMVSGQIESASFPEFDDLYCKFGFVYGQDWVVTSGWEE--GISQVTK-KSMDKRQIVVWNFPIDI-------TFKSTSP---FGWPQIVISCYGLDMFNRDVVRGYGAIHVPTTPGSHSREIPMFVPESSSKLQKLTSWLLGRRPEFVD---PKVVAQGEGREVT----RVRSQGRVKVTFNVVTR 176          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Medaka
Match: mks1 (MKS transition zone complex subunit 1 [Source:NCBI gene;Acc:101171431])

HSP 1 Score: 278.87 bits (712), Expect = 1.476e-85
Identity = 178/548 (32.48%), Postives = 287/548 (52.37%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQIDEN----------------------SNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPI--------LTTKD--PNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNE--IRHS--VRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLY-VVENPFNKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRES 1592
            G A YR + + + NLKI+V+I +VTST  + ++                      +   +  +E    WQ+K+FS  E   F T     + ++ +Y +EVK + +     ++R+FTY +HD +   +P+        LTT    P  L+     V  ++Q    +  S  K   +  +P E  +R S  V ++ Q M IM DLG P   L +  +     E +L  I  D  G IV++PDF+KG   Y +V    N+E +  + +N+S      EK KE  + K+LY R    +  LVG +F+   P  ++R  ++GEI  A  FE+ N+Y  +F+++P +W     + L+ +TQ  R K+ +   ++ F +P  F+ LY     K+ + ++ I +WPVIY +V S+D W RYRTEGYGY+  P TPG H      WRPV     + ++R+F+GGSAELED ++   P TF+G  LS++GF T +TG V   ++CIQQ+ AF++  + K   + +   + G +    V  ++ AF+RAR+++   RES
Sbjct:   10 GEAVYRSQ-DVVKNLKIKVRIERVTSTAALSQHFQQQVLSQQEGGDIELKTLSSPAQKGDNEDEVVVGWQEKIFSQYEMELFQTEAVCQTPLDRQYHKEVKALIKAKSRRSRRIFTYTDHDRYTNCLPLHQLEHTDLLTTTKTGPTFLAERMATVKNRRQERRTMDSSIPKTRIINWEPTEEFVRTSRVVNNAMQTMHIMGDLG-PPGRLGQKEN-----ECLLITIKTDGHGTIVVKPDFNKGREPYRIVAEGENREIWRLTFENVSKSMKPEEKNKEQNMYKDLYVRHKEFLSGLVGQDFEMP-PAGTLRYLMNGEIVSAQGFEYDNLYIHFFLELPNNWSSLPSQSLSEVTQTCRTKSLEKEDVAFFSYPFTFEALY----MKQKDGEEGIPQWPVIYFKVLSLDFWQRYRTEGYGYLLFPATPGKHTMTCHTWRPVQTGTVSAMKRFFIGGSAELEDDSYVRTPGTFKGDRLSRFGFCTVTTGSVTFNLHCIQQARAFVDAAVLKRRRQKVFEHLGGFSQQGAVCNILEAFQRARKKMQEARES 545          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Medaka
Match: mks1 (MKS transition zone complex subunit 1 [Source:NCBI gene;Acc:101171431])

HSP 1 Score: 262.692 bits (670), Expect = 1.414e-79
Identity = 170/533 (31.89%), Postives = 275/533 (51.59%), Query Frame = 3
Query:   63 GVASYRIKPNALPNLKIRVKISKVTSTFQIDEN----------------------SNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPI--------LTTKD--PNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNE--IRHS--VRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLY-VVENPFNKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSI-KWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVIN 1547
            G A YR + + + NLKI+V+I +VTST  + ++                      +   +  +E    WQ+K+FS  E   F T     + ++ +Y +EVK + +     ++R+FTY +HD +   +P+        LTT    P  L+     V  ++Q    +  S  K   +  +P E  +R S  V ++ Q M IM DLG P   L +  +     E +L  I  D  G IV++PDF+KG   Y +V    N+E +  + +N+S      EK KE  + K+LY R    +  LVG +F+   P  ++R  ++GEI  A  FE+ N+Y  +F+++P +W     + L+ +TQ  R K+ +   ++ F +P  F+ LY K    + + ++ I +WPVIY +V S+D W RYRTEGYGY+  P TPG H      WRPV     + ++R+F+GGSAELED ++   P TF+G  LS++GF T +TG V   ++CIQQ+ AF++  + K   + +   + G +    V  ++ 
Sbjct:   10 GEAVYRSQ-DVVKNLKIKVRIERVTSTAALSQHFQQQVLSQQEGGDIELKTLSSPAQKGDNEDEVVVGWQEKIFSQYEMELFQTEAVCQTPLDRQYHKEVKALIKAKSRRSRRIFTYTDHDRYTNCLPLHQLEHTDLLTTTKTGPTFLAERMATVKNRRQERRTMDSSIPKTRIINWEPTEEFVRTSRVVNNAMQTMHIMGDLG-PPGRLGQKEN-----ECLLITIKTDGHGTIVVKPDFNKGREPYRIVAEGENREIWRLTFENVSKSMKPEEKNKEQNMYKDLYVRHKEFLSGLVGQDFEMP-PAGTLRYLMNGEIVSAQGFEYDNLYIHFFLELPNNWSSLPSQSLSEVTQTCRTKSLEKEDVAFFSYPFTFEALYMK----QKDGEEGIPQWPVIYFKVLSLDFWQRYRTEGYGYLLFPATPGKHTMTCHTWRPVQTGTVSAMKRFFIGGSAELEDDSYVRTPGTFKGDRLSRFGFCTVTTGSVTFNLHCIQQARAFVDAAVLKRRRQKVFEHLGGFSQQGAVCNILG 530          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Medaka
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 67.3958 bits (163), Expect = 1.951e-12
Identity = 50/189 (26.46%), Postives = 89/189 (47.09%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIK-WPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQ 1442
            L + G+I  A  F   +++ ++ V     W ++S L++  G TQ+   +T    Y SH   PI+              A   ++ WP ++++V+  DS+ R +  GYGY  +P +PG H+     WRP+  S   ++ + FVGG  +L   DL ++            +Y  +T + G V L++  I +
Sbjct:   33 LHIIGQILGARGFPQNSLFCKWGVHTGGAWRLLSGLKE--GQTQVDIPQTGNMAYWSH---PIDLQF-----------ATKGLQGWPKLHLQVWHQDSFGRCQLYGYGYCHVPCSPGTHRIECVTWRPL-GSWQEQITQMFVGGGPQLRSPDLIYSGA---------DRYRLQTEAMGTVELELGVIMR 195          
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Medaka
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:101164060])

HSP 1 Score: 52.373 bits (124), Expect = 2.206e-7
Identity = 52/205 (25.37%), Postives = 86/205 (41.95%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVG 1499
            L V+G+I  A   E+ ++Y +Y      DW I + LE+  GITQ++   +     +  + FP+E        T+K         WP I I V+  D +      GYG   IP TPG H + +P + P       +   + +G   E  D     + A  EG+ ++    R  S G+V +  +   +    +      SN ++  G
Sbjct:   11 LTVNGQIEGANFPEYDSLYCKYSYVYGHDWAITTGLEE--GITQITCKSSLSRTLV--WNFPLE-------TTFKSTNPSG---WPQIVISVYGPDVFGNDVVRGYGATHIPITPGQHTKTIPMFVPEPTWRLQKFTGWLLGRRPEYTD---PKVVAQGEGREVT----RVRSQGFVTVSFHITTKDMKKMGYDTGPSNPQTAGG 194          
BLAST of MKS transition zone complex subunit 1 vs. Planmine SMEST
Match: SMESG000058562.1 (SMESG000058562.1)

HSP 1 Score: 1061.21 bits (2743), Expect = 0.000e+0
Identity = 526/526 (100.00%), Postives = 526/526 (100.00%), Query Frame = 3
Query:   36 MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRESDMLSFNL 1613
            MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTPSSEKEKEMKLLKELYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRESDMLSFNL
Sbjct:    1 MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTPSSEKEKEMKLLKELYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRESDMLSFNL 526          
BLAST of MKS transition zone complex subunit 1 vs. Planmine SMEST
Match: SMESG000058562.1 (SMESG000058562.1)

HSP 1 Score: 1054.28 bits (2725), Expect = 0.000e+0
Identity = 531/558 (95.16%), Postives = 531/558 (95.16%), Query Frame = 3
Query:   36 MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTPSSXXXXXXXXXXXXYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVINAFRRARERLIHIRESDMLSFNL*PKRFQEAKNNIIRIREAFDDSVDERMKSLII 1709
            MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTPSSEKEKEMKLLKELYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVI  F                         QEAKNNIIRIREAFDDSVDERMKSLII
Sbjct:    1 MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNYAEEFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKRLFTYVNHDAFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYNPVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKISVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTPSSEKEKEMKLLKELYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQNIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVMEVIKRF-------------------------QEAKNNIIRIREAFDDSVDERMKSLII 533          
BLAST of MKS transition zone complex subunit 1 vs. Planmine SMEST
Match: SMESG000000764.1 (SMESG000000764.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.090e-12
Identity = 50/186 (26.88%), Postives = 83/186 (44.62%), Query Frame = 3
Query:  888 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 1436
            + + G+I  A  F   +++ ++ ++    W ++S LE+  G TQ+   +     Y  H   PI+  +                 WP ++ +V+  D   R    GYG+  +P +PG HK  V  WRP S+S   E+   FVGG  +L+  DL ++     +          +TAS G V L +N I
Sbjct:    4 IHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEE--GQTQVDIPQIDDIAYFCH---PIDLHLATMGLQ----------GWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLY---------LQTASMGTVHLAINVI 165          
BLAST of MKS transition zone complex subunit 1 vs. Planmine SMEST
Match: SMESG000058563.1 (SMESG000058563.1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.137e-10
Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = -3
Query: 1770 SFLQAFVLLCVGFWQIINLKTFFHSKKIV 1856
            SF+QAFVLLCVGFWQIINLKTFFHSKKIV
Sbjct:  148 SFMQAFVLLCVGFWQIINLKTFFHSKKIV 176          
BLAST of MKS transition zone complex subunit 1 vs. Planmine SMEST
Match: SMESG000058563.1 (SMESG000058563.1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.192e-10
Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = -3
Query: 1770 SFLQAFVLLCVGFWQIINLKTFFHSKKIV 1856
            SF+QAFVLLCVGFWQIINLKTFFHSKKIV
Sbjct:  147 SFMQAFVLLCVGFWQIINLKTFFHSKKIV 175          
The following BLAST results are available for this feature:
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MKS12.713e-8833.94MKS transition zone complex subunit 1 [Source:HGNC... [more]
MKS16.479e-8835.64MKS transition zone complex subunit 1 [Source:HGNC... [more]
MKS13.215e-4730.47MKS transition zone complex subunit 1 [Source:HGNC... [more]
MKS13.833e-3037.65MKS transition zone complex subunit 1 [Source:HGNC... [more]
MKS16.425e-2237.17MKS transition zone complex subunit 1 [Source:HGNC... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mksr-22.927e-1128.26MecKel Syndrome 1 (MKS1)-Related [Source:UniProtK... [more]
mks-11.771e-826.14MecKel-Gruber Syndrome (MKS) homolog [Source:UniP... [more]
mks-13.213e-826.14MecKel-Gruber Syndrome (MKS) homolog [Source:UniP... [more]
mksr-15.019e-825.41MecKel Syndrome 1 (MKS1)-Related [Source:UniProtK... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
B9d21.050e-1223.37gene:FBgn0261683 transcript:FBtr0303078[more]
Mks12.434e-925.00gene:FBgn0030395 transcript:FBtr0073667[more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mks11.036e-8932.54MKS transition zone complex subunit 1 [Source:ZFIN... [more]
mks15.810e-8932.54MKS transition zone complex subunit 1 [Source:ZFIN... [more]
b9d21.892e-1329.03B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
b9d21.892e-1329.03B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
b9d18.526e-1228.57B9 protein domain 1 [Source:NCBI gene;Acc:554150][more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpr1.934e-8130.08heterogeneous nuclear ribonucleoprotein R [Source:... [more]
hnrnpr4.738e-8030.21heterogeneous nuclear ribonucleoprotein R [Source:... [more]
hnrnpr4.598e-7629.46heterogeneous nuclear ribonucleoprotein R [Source:... [more]
hnrnpr4.512e-6627.51heterogeneous nuclear ribonucleoprotein R [Source:... [more]
hnrnpr7.683e-6628.68heterogeneous nuclear ribonucleoprotein R [Source:... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mks13.120e-8632.73Meckel syndrome, type 1 [Source:MGI Symbol;Acc:MGI... [more]
B9d21.191e-1226.63B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:238... [more]
B9d21.191e-1226.63B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:238... [more]
B9d11.446e-1124.88B9 protein domain 1 [Source:MGI Symbol;Acc:MGI:135... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NXB0|MKS1_HUMAN1.303e-8733.94Meckel syndrome type 1 protein OS=Homo sapiens OX=... [more]
sp|Q499Q5|MKS1_RAT1.678e-8633.09Meckel syndrome type 1 protein homolog OS=Rattus n... [more]
sp|Q5SW45|MKS1_MOUSE2.182e-8532.73Meckel syndrome type 1 protein homolog OS=Mus musc... [more]
sp|Q6DGZ1|B9D2_DANRE1.428e-1229.03B9 domain-containing protein 2 OS=Danio rerio OX=7... [more]
sp|P0C5J3|B9D2_RAT1.730e-1227.17B9 domain-containing protein 2 OS=Rattus norvegicu... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HGE11.704e-10837.79Meckel syndrome type 1 protein OS=Lingula unguis O... [more]
R7URQ42.395e-10535.64Uncharacterized protein OS=Capitella teleta OX=283... [more]
V4ASP57.623e-10336.12Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A210PUU57.146e-10238.39Meckel syndrome type 1 protein OS=Mizuhopecten yes... [more]
C3YD637.722e-10137.58Uncharacterized protein OS=Branchiostoma floridae ... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mks16.883e-8133.19MKS transition zone complex subunit 1 [Source:ZFIN... [more]
mks13.918e-7430.31MKS transition zone complex subunit 1 [Source:ZFIN... [more]
b9d18.427e-1328.65B9 domain containing 1 [Source:NCBI gene;Acc:10303... [more]
b9d21.321e-1227.96B9 domain containing 2 [Source:NCBI gene;Acc:10304... [more]
b9d13.177e-1027.01B9 domain containing 1 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mks13.625e-6642.07MKS transition zone complex subunit 1 [Source:ZFIN... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO393971.399e-6732.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468344.308e-1428.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261994.308e-1428.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278673.455e-1330.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444851.181e-1228.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mks11.476e-8532.48MKS transition zone complex subunit 1 [Source:NCBI... [more]
mks11.414e-7931.89MKS transition zone complex subunit 1 [Source:NCBI... [more]
b9d21.951e-1226.46B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
b9d12.206e-725.37B9 domain containing 1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of MKS transition zone complex subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058562.10.000e+0100.00SMESG000058562.1[more]
SMESG000058562.10.000e+095.16SMESG000058562.1[more]
SMESG000000764.11.090e-1226.88SMESG000000764.1[more]
SMESG000058563.11.137e-1096.55SMESG000058563.1[more]
SMESG000058563.11.192e-1096.55SMESG000058563.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029802 ID=SMED30029802|Name=MKS transition zone complex subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1858bp
TACAAACCTAACAATGTTACATTAGTAACACAAATATGTCTCATTTAAAA
GAATTAAGATATGGAGTTGCAAGTTATAGAATCAAGCCTAATGCTTTACC
AAATTTAAAAATTAGAGTAAAAATTTCTAAAGTTACATCAACTTTTCAAA
TTGATGAGAATTCCAACGCGTTAAATTATGCTGAAGAATTTACATTTAGC
TGGCAGCAAAAAGTCTTTAGTCCGCGGGAAAGAATACGATTTTCCACAAA
TTTAAATAATCCAAGCGTGATAGAAGAAAAATATATCCGTGAAGTGAAAA
CAATTAAACAAACCACAGGATTTCCAACAAAAAGATTGTTCACATATGTC
AATCATGATGCTTTTGCTCAACAAATACCGATTCTCACAACAAAAGATCC
AAATACTTTGTCGTATATTGGAGAAATGGTTGATAAAAAGAAACAAAGTG
TAGATGAAATATGGAAAAGCGGTGGCAAATATAATCCAGTACTTGAAGAT
CCCAATGAAATTCGCCATTCGGTACGCAGTTCAGAACAGGAGATGTTTAT
TATGGCTGATCTAGGTTATCCGATCAATGACCTAAATGAAGACAGCAGCA
ATTTTGAGTCACAGGAAATTGTTCTCTGTAAAATTAGCGTGGATAAAAGC
GGTTGTATTGTACTGCAACCTGATTTTAGTAAAGGCGACACTCTTTATGT
TGTGGAAAATCCATTCAACAAAGAGAACTTTGAATATTCAATCAAAAATA
TTTCTACTCCCACCCCTTCCTCGGAAAAAGAAAAGGAAATGAAGTTGCTA
AAAGAACTATATGCAAGATCTACTAATCGGATACAGAGCTTAGTAGGACC
TAATTTCGATAATAAAATTCCTAACGACTCAATCAGACTGTTCGTTAGTG
GAGAAATCGCTTATGCATACGATTTTGAACATCAAAATATTTACGCGCAA
TATTTTGTTGATGTTCCAGAAGACTGGATAGTATCTAATCTCGAACAACT
TACTGGTATTACACAATTATCCCGAGGAAAAACAACTAAAACAGGTTATC
TGTCTCATTTCGGCTTTCCAATTGAATTCGATATGCTATATCAGAAAAAT
ACATATAAAGAAAATGAAGCTGATGATAGTATTAAATGGCCAGTTATTTA
CATAGAAGTATTTTCCATTGACTCGTGGACTCGATATCGAACCGAAGGGT
ACGGTTACATTCAAATCCCACCTACACCAGGTGTTCATAAAAGAGTTGTA
CCATGCTGGAGACCTGTAAGTAATTCAATTACAAATGAACTAAGAAGATA
TTTTGTTGGCGGCAGTGCGGAACTTGAAGATTTAACATTTACTTCTATTC
CAGCAACATTTGAAGGTAAATATTTAAGTAAATATGGTTTTCGTACTGCT
TCAACTGGATATGTTGTTTTGAAAATGAATTGTATACAACAATCAAATGC
ATTTATTGAAGAAAAGTTAAACAAATCTAACTCAAAGTCATTGGTTGGAC
GCATAAGCGGGAGTAACATTCATTTCGGAGTAATGGAAGTCATCAATGCT
TTTAGAAGAGCTCGCGAACGCTTGATTCATATTAGAGAAAGTGACATGCT
TTCTTTTAATTTATAGCCGAAAAGATTCCAAGAAGCTAAAAATAACATTA
TAAGAATAAGAGAAGCATTTGACGATTCTGTAGACGAAAGAATGAAGTCG
TTAATTATTTGATTAATTATGTTGTTTGTTATTAAAAAATAAACATTCCA
ATCGTTTTATTTTCAATTAAACAATTTTTTTACTATGAAAAAAAGTTTTA
AGATTTATTATTTGCCAAAATCCCACGCATAATAATACGAAGGCTTGCAA
AAAACTCC
back to top

protein sequence of SMED30029802-orf-1

>SMED30029802-orf-1 ID=SMED30029802-orf-1|Name=SMED30029802-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=527bp
MSHLKELRYGVASYRIKPNALPNLKIRVKISKVTSTFQIDENSNALNYAE
EFTFSWQQKVFSPRERIRFSTNLNNPSVIEEKYIREVKTIKQTTGFPTKR
LFTYVNHDAFAQQIPILTTKDPNTLSYIGEMVDKKKQSVDEIWKSGGKYN
PVLEDPNEIRHSVRSSEQEMFIMADLGYPINDLNEDSSNFESQEIVLCKI
SVDKSGCIVLQPDFSKGDTLYVVENPFNKENFEYSIKNISTPTPSSEKEK
EMKLLKELYARSTNRIQSLVGPNFDNKIPNDSIRLFVSGEIAYAYDFEHQ
NIYAQYFVDVPEDWIVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDM
LYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGV
HKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKY
GFRTASTGYVVLKMNCIQQSNAFIEEKLNKSNSKSLVGRISGSNIHFGVM
EVINAFRRARERLIHIRESDMLSFNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR010796B9_dom
Vocabulary: biological process
TermDefinition
GO:0001843neural tube closure
GO:0007368determination of left/right symmetry
GO:0008589regulation of smoothened signaling pathway
GO:0010669epithelial structure maintenance
GO:0030030cell projection organization
GO:0042733embryonic digit morphogenesis
GO:0044458motile cilium assembly
GO:0048706embryonic skeletal system development
GO:0048754branching morphogenesis of an epithelial tube
GO:0060122inner ear receptor stereocilium organization
GO:0060271cilium morphogenesis
GO:0060322head development
GO:0060828regulation of canonical Wnt signaling pathway
GO:0061009common bile duct development
GO:0097711ciliary basal body docking
GO:1901620regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning
GO:1905515non-motile cilium assembly
GO:1990403embryonic brain development
GO:2000095regulation of Wnt signaling pathway, planar cell polarity pathway
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005929cilium
GO:0016020membrane
GO:0035869ciliary transition zone
GO:0036038MKS complex
GO:0036064ciliary basal body
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010796B9 domainPFAMPF07162B9-C2coord: 285..467
e-value: 1.2E-46
score: 159.0
IPR010796B9 domainPANTHERPTHR12968ENDOTHELIAL PROTEIN B9-RELATEDcoord: 47..519
IPR010796B9 domainPROSITEPS51381B9coord: 283..413
score: 28.01
NoneNo IPR availablePANTHERPTHR12968:SF4MECKEL SYNDROME TYPE 1 PROTEINcoord: 47..519