C-type lectin-like protein

Overview
NameC-type lectin-like protein
Smed IDSMED30029800
Length (bp)795
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029800

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029800SMESG000011239.1 Contig1115GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029800SMESG000074695.1 Contig1115GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
vitelline glandSMED30029800SMESG000074695.1 Contig50649newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029800SMESG000074695.1 Contig50649uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30029800SMESG000074695.1 Contig50649newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029800SMESG000074695.1 Contig50649uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30029800SMESG000011239.1 Contig1115GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029800SMESG000074695.1 PL05009B1A03ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029800SMESG000074695.1 Contig1115GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C-type lectin-like protein vs. TrEMBL
Match: A0A1W6I197 (C-type lectin-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 2.741e-112
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 2
Query:  251 MDHVHAYQFCKNLTNYLNITSTKVDPYLSDMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVVEGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQIIKSNMPIDAPRHEKPLKSPYDKD 715
            MDHVHAYQFCKNLTNYLNITSTKVDPYLSDMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVVEGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQIIKSNMPIDAPRHEKPLKSPYDKD
Sbjct:    1 MDHVHAYQFCKNLTNYLNITSTKVDPYLSDMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVVEGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQIIKSNMPIDAPRHEKPLKSPYDKD 155          
BLAST of C-type lectin-like protein vs. TrEMBL
Match: G7YCG5 (C-type lectin domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CLF_104854 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.090e-17
Identity = 49/167 (29.34%), Postives = 82/167 (49.10%), Query Frame = 2
Query:  179 IKLTRVNATDRLEVVLVHGSKEARMDHVHAYQFCKNLTNYLNITSTKVDP--------YLSDMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVVEGHHHRQFS--VSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQII 649
            +K++       L +  VHG ++A+M H  A +FC+NLT+ L    T  +           SD++S+HD  ++H+ +M  +L +    FWIGG+   VE     Q S  +  WTD +P   ++ H  H +       G   C+ + F SG+W    C  +++F C+ I
Sbjct:   19 LKISEKQFGPYLTLTYVHGGEDAQMSHTQAREFCQNLTSELRPEGTTSEAPENPIETRKRSDLVSIHDPTMVHQ-LMSWVLPLDKRQFWIGGLISKVEHTFQNQASHVIHTWTDGTPANFRFLHFTHAD-FQAFSSGATLCLSVDFVSGKWGAHNCKTQMYFVCETI 183          
BLAST of C-type lectin-like protein vs. TrEMBL
Match: A0A4S2M7T9 (C-type lectin domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002056 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.190e-16
Identity = 49/168 (29.17%), Postives = 84/168 (50.00%), Query Frame = 2
Query:  179 IKLTRVNATDRLEVVLVHGSKEARMDHVHAYQFCKNLTNYLNI--TSTKVDPYL-------SDMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVVEG--HHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQII 649
            +K++       L +  VHG ++A+M H  A +FC+NLT+ +    T+T   P         SD++S+HD  ++H+ +M  +L +    FWIGG+   VE    +H    +  WTD +P   ++ H  H +       G   C+ + F SG+W    C  +++F C+ I
Sbjct:   19 LKISEKQFGPYLTLTYVHGGEDAQMSHTQAREFCQNLTSEIRPEGTTTSEGPANPIETQKHSDLVSIHDPTMVHQ-LMSWVLPLDKRQFWIGGLMSKVEHTFQNHASHLIHTWTDGTPANFRFLHFTHAD-FQAFSSGATLCLSVDFVSGKWGAHNCRTEMYFVCETI 184          
BLAST of C-type lectin-like protein vs. TrEMBL
Match: A0A074Z7B7 (C-type lectin domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_08978 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.992e-15
Identity = 49/158 (31.01%), Postives = 79/158 (50.00%), Query Frame = 2
Query:  212 LEVVLVHGSKEARMDHVHAYQFCKNLTNYLNITST----KVDPYL----SDMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVVE--GHHHRQFSVSKWTDRSPFTLKYFH--QGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQII 649
            L +  VHG ++A+M H  A +FC+NLT+ +    T      +P      SD++S+HD  ++H+ +M  +L +    FWIGG+   VE     H    +  WTD +P   ++ H  Q  F        G   C+ + F SG+W    CN +++F C+ I
Sbjct:  139 LTLTYVHGGEDAQMSHTQAREFCQNLTSGIRPEGTTSKAPANPIEIRKHSDLVSIHDPTMVHQ-LMSWVLPLDKRQFWIGGLISKVEHTFQDHASHLIHTWTDGTPANFRFLHFTQADF---QAFSPGATLCLSVDFVSGKWGAHNCNTEMYFVCETI 292          
BLAST of C-type lectin-like protein vs. TrEMBL
Match: A0A0V0J2P0 (Lectin C-type domain OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS19902 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.353e-15
Identity = 53/194 (27.32%), Postives = 91/194 (46.91%), Query Frame = 2
Query:  179 IKLTRVNATDRLEVVLVHGSKEARMDHVHAYQFCKNL--------------------------TNYLNITSTKVDPYLS---------DMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVV--EGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQII 649
            ++LT     D + + LVHG ++A M H  A  FC+ L                          +  L+  +T + P +S         D+LS+HD  ++ E +M  IL +    FWIGGM K V     HH+   +  WTDR+P   ++ H  + +    ++ G+  C+ + + SG+W +  C++K++F C+ I
Sbjct:   18 LQLTEKKINDAITLTLVHGGEDAMMSHTDALAFCRTLEEQKTKQATASPAPSTPIIIQSVAGTSAPLSTEATTLAPAVSGEPGQTVFNDLLSLHDPGMVAE-LMQWILNLERRQFWIGGMVKKVVRPFEHHKDHIIHLWTDRTPTNFRFLHFPNEDLRA-LKEGEVKCLSVDYASGKWGVHDCDDKMYFVCETI 209          
BLAST of C-type lectin-like protein vs. Planmine SMEST
Match: SMESG000074695.1 (SMESG000074695.1)

HSP 1 Score: 342.428 bits (877), Expect = 1.152e-120
Identity = 167/180 (92.78%), Postives = 167/180 (92.78%), Query Frame = 2
Query:  176 EIKLTRVNATDRLEVVLVHGSKEARMDHVHAYQFCKNLTNYLNITSTKVDPYLSDMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVVEGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQIIKSNMPIDAPRHEKPLKSPYDKD 715
            EIKLTRVNATDRLEVVLVHGSKEARMDHVHAYQFCKNLTNYLNITSTKVDPYLSDMLSVHDHLLMHEVIMPGILKV             VEGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQIIKSNMPIDAPRHEKPLKSPYDKD
Sbjct:   19 EIKLTRVNATDRLEVVLVHGSKEARMDHVHAYQFCKNLTNYLNITSTKVDPYLSDMLSVHDHLLMHEVIMPGILKV-------------VEGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFACQIIKSNMPIDAPRHEKPLKSPYDKD 185          
BLAST of C-type lectin-like protein vs. Planmine SMEST
Match: SMESG000015726.1 (SMESG000015726.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.337e-8
Identity = 36/154 (23.38%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  179 IKLTRVNATDRLEVVLVHGSKEARMDHVHAYQFCKNLTNYLNITSTKVDPYLSDMLSVHDHLLMHEVIMPGILKVIDEIFWIGGMYKVVEGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFCIIIAFNSGRWDLRPCNEKLFFAC 640
            +K++  + +D++    +HG ++ARM+   A +FC N T + N +    D +L+ + ++ +  L    I   IL +  + FWIGG           +  +  W +        F   ++N  + +++ ++ C+ +    GRW +  C+EK +F C
Sbjct:   88 MKISEGHISDKM-FAFIHGGEDARMNFTDAEEFCSNFTFHRNNS----DSHLASIQNLKEVKL----IQNWILNLERKSFWIGGEIICSMNALLEKMFLLHWINNDKVEFTNFKVPNYNVKN-MKVTEKRCVSVDLQDGRWGVHHCSEKKYFLC 231          
The following BLAST results are available for this feature:
BLAST of C-type lectin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W6I1972.741e-112100.00C-type lectin-like protein OS=Schmidtea mediterran... [more]
G7YCG51.090e-1729.34C-type lectin domain-containing protein OS=Clonorc... [more]
A0A4S2M7T91.190e-1629.17C-type lectin domain-containing protein OS=Opistho... [more]
A0A074Z7B71.992e-1531.01C-type lectin domain-containing protein OS=Opistho... [more]
A0A0V0J2P03.353e-1527.32Lectin C-type domain OS=Schistocephalus solidus OX... [more]
back to top
BLAST of C-type lectin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-type lectin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000074695.11.152e-12092.78SMESG000074695.1[more]
SMESG000015726.11.337e-823.38SMESG000015726.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029800 ID=SMED30029800|Name=C-type lectin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=795bp
AGACTTTATGCGATATTTTATTTGAAGAATGCCGAAAGTTCTGATATGGA
AATCTTATCGGAAATGGCAGTATTTAAAGAAATTATAATTTGTAACGTGC
TGTGTTTAGTATATATTTTTGATGCTTGCGTTATTACTGTTTTGCTTCCT
GTTGTCATTCCAGCAGGCATTTTCGGAAATTAAATTGACAAGAGTTAATG
CAACTGATAGATTGGAAGTAGTCTTAGTTCATGGATCAAAAGAAGCACGA
ATGGATCATGTACATGCTTATCAATTCTGCAAAAATCTTACAAATTATTT
GAATATAACCAGTACAAAAGTTGATCCGTATTTGTCGGATATGTTGTCAG
TTCACGATCATCTTTTGATGCATGAAGTAATTATGCCTGGAATCTTGAAA
GTAATTGATGAGATTTTCTGGATTGGTGGCATGTATAAGGTTGTTGAAGG
ACACCACCACAGACAGTTCTCTGTTTCAAAATGGACAGACAGATCACCAT
TCACCTTGAAATATTTCCACCAGGGTCATTTTAATAGACATCATCATATT
CGACTTGGAGACAGATTCTGTATAATAATTGCTTTTAATTCCGGCCGATG
GGATTTGAGACCATGTAACGAGAAATTATTTTTCGCTTGTCAAATAATAA
AAAGTAATATGCCAATTGATGCTCCAAGACACGAAAAGCCCTTGAAATCA
CCTTATGATAAAGATTAATTTCATCCAAAGGTTTTGTGGGCATTGGTTGA
AACCAATATATTTTGAAATAATTTTAAAAAAAAAGATCGGAAGAG
back to top

protein sequence of SMED30029800-orf-1

>SMED30029800-orf-1 ID=SMED30029800-orf-1|Name=SMED30029800-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=199bp
MLALLLFCFLLSFQQAFSEIKLTRVNATDRLEVVLVHGSKEARMDHVHAY
QFCKNLTNYLNITSTKVDPYLSDMLSVHDHLLMHEVIMPGILKVIDEIFW
IGGMYKVVEGHHHRQFSVSKWTDRSPFTLKYFHQGHFNRHHHIRLGDRFC
IIIAFNSGRWDLRPCNEKLFFACQIIKSNMPIDAPRHEKPLKSPYDKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR016186C-type_lectin-like/link_sf
IPR001304C-type_lectin-like
IPR016187CTDL_fold
Vocabulary: biological process
TermDefinition
GO:0006955immune response
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 33..179
e-value: 2.5E-10
score: 42.6
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 48..174
score: 9.242
NoneNo IPR availableCDDcd00037CLECTcoord: 43..175
e-value: 1.59964E-7
score: 46.0738
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.857
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 43..174