histone lysine N methyltransferase MLL-1

Overview
Namehistone lysine N methyltransferase MLL-1 (AFJ24865.1)
Smed IDSMED30029784
Length (bp)8548
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of histone lysine N methyltransferase MLL-1 (SMED30029784) t-SNE clustered cells

Violin plots show distribution of expression levels for histone lysine N methyltransferase MLL-1 (SMED30029784) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of histone lysine N methyltransferase MLL-1 (SMED30029784) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for histone lysine N methyltransferase MLL-1 (SMED30029784) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029784

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029784SMESG000027630.1 SmedASXL_018236SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029784SMESG000027630.1 SmedASXL_018236SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30029784SMESG000027630.1 Contig48649uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029784SMESG000027630.1 Contig48649newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30029784SMESG000027630.1 KC262346smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30029784SMESG000027630.1 KC262346smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30029784SMESG000027630.1 KC262346smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Human
Match: KMT2A (lysine methyltransferase 2A [Source:HGNC Symbol;Acc:HGNC:7132])

HSP 1 Score: 236.498 bits (602), Expect = 3.771e-61
Identity = 120/292 (41.10%), Postives = 163/292 (55.82%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
             W  +  ++ + R +  L +      +G    G+ H  V++L+EQ+  A  C NY+F+FHK        +     ++PHG  R     +      A D   FL SK   PP+ +     ++              L    R  R+      + V V  S IHGRGLF +R  DA E++IEY G VIRSI +D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A RKIY+GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 3651 AWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPE------EANEPPLNPHGSARAEVHLRKS----AFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMR-FRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN 3931          

HSP 2 Score: 131.724 bits (330), Expect = 1.767e-29
Identity = 77/223 (34.53%), Postives = 121/223 (54.26%), Query Frame = 1
Query: 5221 EFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            E N     +D R CALC   GDD     GRL+Y G + W HVNCALWS +V+E +DG+L NV +A+ +G++  C  CQK GAT+ C        C +SC + YHF C+     + VF + +  YC + H + +    +      + RR+++       +S+     +G+  +NI + IG++ I+C+G +++ SD     L PIGYQ  R++WS  +     +Y
Sbjct: 1822 ELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGC--------CLTSCTSNYHFMCSRAK--NCVFLDDKKVYC-QRHRDLIKGEVVPENGFEVFRRVFV---DFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSD-CEDKLFPIGYQCSRVYWSTTDARKRCVY 2029          

HSP 3 Score: 90.5077 bits (223), Expect = 5.968e-17
Identity = 62/194 (31.96%), Postives = 87/194 (44.85%), Query Frame = 1
Query: 3694 QLIHCVSCAEPFHFFCIEYQFRPKSKEM--FVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCP---ECGRAYQAGLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            + ++C  C EPFH FC+E   RP   ++  + CR C  CH C          L+C KC+  +HP C+   YP   +  K  W C KC  C  CG+          T     +  WS D   C  CA+    G+ CP   +C        + ++C  C+R VH +C  LS++ YEI    PE    S A+ C  C
Sbjct: 1406 KFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGS---------TTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPE----SVAYTCVNC 1586          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Human
Match: KMT2A (lysine methyltransferase 2A [Source:HGNC Symbol;Acc:HGNC:7132])

HSP 1 Score: 236.113 bits (601), Expect = 5.122e-61
Identity = 120/292 (41.10%), Postives = 163/292 (55.82%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
             W  +  ++ + R +  L +      +G    G+ H  V++L+EQ+  A  C NY+F+FHK        +     ++PHG  R     +      A D   FL SK   PP+ +     ++              L    R  R+      + V V  S IHGRGLF +R  DA E++IEY G VIRSI +D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A RKIY+GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 3689 AWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPE------EANEPPLNPHGSARAEVHLRKS----AFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMR-FRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN 3969          

HSP 2 Score: 132.109 bits (331), Expect = 1.472e-29
Identity = 77/223 (34.53%), Postives = 121/223 (54.26%), Query Frame = 1
Query: 5221 EFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            E N     +D R CALC   GDD     GRL+Y G + W HVNCALWS +V+E +DG+L NV +A+ +G++  C  CQK GAT+ C        C +SC + YHF C+     + VF + +  YC + H + +    +      + RR+++       +S+     +G+  +NI + IG++ I+C+G +++ SD     L PIGYQ  R++WS  +     +Y
Sbjct: 1860 ELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGC--------CLTSCTSNYHFMCSRAK--NCVFLDDKKVYC-QRHRDLIKGEVVPENGFEVFRRVFV---DFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSD-CEDKLFPIGYQCSRVYWSTTDARKRCVY 2067          

HSP 3 Score: 105.916 bits (263), Expect = 1.229e-21
Identity = 72/221 (32.58%), Postives = 103/221 (46.61%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSKEM--FVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCP---ECGRAYQAGLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +V+C+ C S G  + ++C  C EPFH FC+E   RP   ++  + CR C  CH C          L+C KC+  +HP C+   YP   +  K  W C KC  C  CG+          T     +  WS D   C  CA+    G+ CP   +C        + ++C  C+R VH +C  LS++ YEI    PE    S A+ C  C
Sbjct: 1418 GGLGILTSVPITP-RVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGS---------TTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPE----SVAYTCVNC 1624          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Human
Match: KMT2A (lysine methyltransferase 2A [Source:HGNC Symbol;Acc:HGNC:7132])

HSP 1 Score: 236.113 bits (601), Expect = 5.433e-61
Identity = 120/292 (41.10%), Postives = 163/292 (55.82%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
             W  +  ++ + R +  L +      +G    G+ H  V++L+EQ+  A  C NY+F+FHK        +     ++PHG  R     +      A D   FL SK   PP+ +     ++              L    R  R+      + V V  S IHGRGLF +R  DA E++IEY G VIRSI +D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A RKIY+GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 3692 AWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPE------EANEPPLNPHGSARAEVHLRKS----AFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMR-FRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN 3972          

HSP 2 Score: 132.109 bits (331), Expect = 1.484e-29
Identity = 77/223 (34.53%), Postives = 121/223 (54.26%), Query Frame = 1
Query: 5221 EFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            E N     +D R CALC   GDD     GRL+Y G + W HVNCALWS +V+E +DG+L NV +A+ +G++  C  CQK GAT+ C        C +SC + YHF C+     + VF + +  YC + H + +    +      + RR+++       +S+     +G+  +NI + IG++ I+C+G +++ SD     L PIGYQ  R++WS  +     +Y
Sbjct: 1863 ELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGC--------CLTSCTSNYHFMCSRAK--NCVFLDDKKVYC-QRHRDLIKGEVVPENGFEVFRRVFV---DFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSD-CEDKLFPIGYQCSRVYWSTTDARKRCVY 2070          

HSP 3 Score: 102.449 bits (254), Expect = 1.353e-20
Identity = 75/224 (33.48%), Postives = 104/224 (46.43%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSKEM--FVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCP---ECGRAYQAGLETIECNSCNRMVHRQCCGLS--EDE-YEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +V+C+ C S G  + ++C  C EPFH FC+E   RP   ++  + CR C  CH C          L+C KC+  +HP C+   YP   +  K  W C KC  C  CG+          T     +  WS D   C  CA+    G+ CP   +C        + ++C  C+R VH +C  LS  EDE YEI    PE    S A+ C  C
Sbjct: 1418 GGLGILTSVPITP-RVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGS---------TTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPE----SVAYTCVNC 1627          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Human
Match: KMT2B (lysine methyltransferase 2B [Source:HGNC Symbol;Acc:HGNC:15840])

HSP 1 Score: 213.772 bits (543), Expect = 2.211e-54
Identity = 120/314 (38.22%), Postives = 172/314 (54.78%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    ++S +  W  +++++ + R    L         G    G+ H  VI+L EQ+  A +C +Y+F++H+    +         ++PHG  R   + +        D   FL S+    P+       +               L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNC+++V+  EG+KHI+I A R+I +GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 2392 LRFEISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPP-----LNPHGAARAEVYLRK----CTFDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN 2693          

HSP 2 Score: 124.79 bits (312), Expect = 2.359e-27
Identity = 91/298 (30.54%), Postives = 139/298 (46.64%), Query Frame = 1
Query: 4975 RAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAF----PSEFNSTICEKDIRHCALCA--GSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVD-MPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWS 5847
            RA   M+ L   + ++    FD           +L N         ++  S  H+ A  +  E +           + AF    P+ F+     +D R CALC   G  D +  GRL+Y G + W HVNCA+WS +V+E  DG+L NV  A+ +G +  C  C K GAT+ C        C SSC + +HF CA       +F + +  +C + H + +   ++   D   +LRR+Y+    + N       G+  D I V IG++RI+ +G + + SD     L PIGYQ  RL+WS
Sbjct: 1466 RAGGQMKGLLLKLLESAFGWFDAHDPKYWRRSTRLPNGVL---PNAVLPPSLDHVYAQWRQQEPETPESGQPPGDPSAAFQGKDPAAFSHL---EDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGC--------CLSSCLSNFHFMCARASY--CIFQDDKKVFC-QKHTDLLDGKEIVNPDGFDVLRRVYVDFEGI-NFKRKFLTGLEPDAINVLIGSIRIDSLGTLSDLSD-CEGRLFPIGYQCSRLYWS 1744          

HSP 3 Score: 117.472 bits (293), Expect = 3.762e-25
Identity = 73/221 (33.03%), Postives = 108/221 (48.87%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFR--PKSKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSDDK-SNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  ++C  C S G  +L+ C  C +PFH FC+E   R  P+  + + CR C  CH C   G      L+C +C+  +HP C+    PTR+  K  +W C  C  C  CGA          T   + +++WS D   C RC +    G+ CP C R Y+      + ++C  C+  VH +C GLS+++YEI    P+    S  + C  C
Sbjct: 1166 GGLSVLTSVPGGP-PMVCLLCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGA----------TPGKNWDVEWSGDYSLCPRCTQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPD----SVLYTCGPC 1371          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Human
Match: KMT2B (lysine methyltransferase 2B [Source:HGNC Symbol;Acc:HGNC:15840])

HSP 1 Score: 213.772 bits (543), Expect = 2.376e-54
Identity = 120/314 (38.22%), Postives = 172/314 (54.78%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    ++S +  W  +++++ + R    L         G    G+ H  VI+L EQ+  A +C +Y+F++H+    +         ++PHG  R   + +        D   FL S+    P+       +               L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNC+++V+  EG+KHI+I A R+I +GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 2414 LRFEISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPP-----LNPHGAARAEVYLRK----CTFDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN 2715          

HSP 2 Score: 124.79 bits (312), Expect = 2.424e-27
Identity = 91/298 (30.54%), Postives = 139/298 (46.64%), Query Frame = 1
Query: 4975 RAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAF----PSEFNSTICEKDIRHCALCA--GSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVD-MPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWS 5847
            RA   M+ L   + ++    FD           +L N         ++  S  H+ A  +  E +           + AF    P+ F+     +D R CALC   G  D +  GRL+Y G + W HVNCA+WS +V+E  DG+L NV  A+ +G +  C  C K GAT+ C        C SSC + +HF CA       +F + +  +C + H + +   ++   D   +LRR+Y+    + N       G+  D I V IG++RI+ +G + + SD     L PIGYQ  RL+WS
Sbjct: 1488 RAGGQMKGLLLKLLESAFGWFDAHDPKYWRRSTRLPNGVL---PNAVLPPSLDHVYAQWRQQEPETPESGQPPGDPSAAFQGKDPAAFSHL---EDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGC--------CLSSCLSNFHFMCARASY--CIFQDDKKVFC-QKHTDLLDGKEIVNPDGFDVLRRVYVDFEGI-NFKRKFLTGLEPDAINVLIGSIRIDSLGTLSDLSD-CEGRLFPIGYQCSRLYWS 1766          

HSP 3 Score: 117.472 bits (293), Expect = 4.031e-25
Identity = 74/221 (33.48%), Postives = 107/221 (48.42%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFR--PKSKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSDDK-SNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  V C  C S G  +L+ C  C +PFH FC+E   R  P+  + + CR C  CH C   G      L+C +C+  +HP C+    PTR+  K  +W C  C  C  CGA          T   + +++WS D   C RC +    G+ CP C R Y+      + ++C  C+  VH +C GLS+++YEI    P+    S  + C  C
Sbjct: 1188 GGLSVLTSVPGGPPMV-CLLCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGA----------TPGKNWDVEWSGDYSLCPRCTQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPD----SVLYTCGPC 1393          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 169.859 bits (429), Expect = 1.127e-42
Identity = 76/147 (51.70%), Postives = 105/147 (71.43%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            N +  R K ++   S IHG GL+A       E+I+EY+G+ IRS++++ RE  Y+R G+   Y+FR+D   ++DAT +GN ARFINHSC PNCYAKV+  EGEK I+I ++  I KGEE+TYDY+FPIEDDK+ C CG+ +C+ YLN
Sbjct:  593 NQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN 739          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 170.244 bits (430), Expect = 1.031e-41
Identity = 76/147 (51.70%), Postives = 105/147 (71.43%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            N +  R K ++   S IHG GL+A       E+I+EY+G+ IRS++++ RE  Y+R G+   Y+FR+D   ++DAT +GN ARFINHSC PNCYAKV+  EGEK I+I ++  I KGEE+TYDY+FPIEDDK+ C CG+ +C+ YLN
Sbjct: 1361 NQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN 1507          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 170.244 bits (430), Expect = 1.077e-41
Identity = 76/147 (51.70%), Postives = 105/147 (71.43%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            N +  R K ++   S IHG GL+A       E+I+EY+G+ IRS++++ RE  Y+R G+   Y+FR+D   ++DAT +GN ARFINHSC PNCYAKV+  EGEK I+I ++  I KGEE+TYDY+FPIEDDK+ C CG+ +C+ YLN
Sbjct: 1364 NQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN 1510          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Celegans
Match: set-16 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:G5EGI1])

HSP 1 Score: 130.954 bits (328), Expect = 1.293e-29
Identity = 64/137 (46.72%), Postives = 86/137 (62.77%), Query Frame = 1
Query: 7702 SNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEG---EKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            S I G GL+A+      + IIEY GE+IRS + +VRE  Y       YMFR+D++ ++DAT  G  AR+INHSC PNC  +++       EK III A R I   EELTYDY+F +E   DK+PC CG+ +C K++N
Sbjct: 2339 SRIAGLGLYAKVDISMGDFIIEYKGEIIRSEVCEVREIRYVAQNRGVYMFRIDEEWVIDATMAGGPARYINHSCDPNCSTQILDAGSGAREKKIIITANRPISANEELTYDYQFELEGTTDKIPCLCGAPNCVKWMN 2475          

HSP 2 Score: 93.2041 bits (230), Expect = 3.211e-18
Identity = 68/217 (31.34%), Postives = 100/217 (46.08%), Query Frame = 1
Query: 5248 DIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLP--QGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECS---DYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            D R C  C G GD      GRLI      WVHVNCALWS +V+E + G L NVD A+ +  +  C  C++ GA+++C   +    CG +    YH  CA  M  +  F + RTF C + H+       +  +D   LRRIY+   +  +       TDG     + + +G      +G I        + + Y+ P  Y+  RLFWS       +M+
Sbjct: 1900 DKRICVFCGGIGDGETTRCGRLISLTEFYWVHVNCALWSAEVFENQTGGLTNVDRAVLRAAQTACDHCKRPGASVKCHKMN----CGVN----YHVLCA--MQNNGFFIKDRTFICKQ-HEKVSNQAIVGRLD--ALRRIYVKRDENTMLTRLFELTDG---PTLCMRLGAFTFYKIGSITPKQLKRFHTKDYIFPNNYRITRLFWSPKSHRERMMF 2100          

HSP 3 Score: 67.781 bits (164), Expect = 1.610e-10
Identity = 52/186 (27.96%), Postives = 77/186 (41.40%), Query Frame = 1
Query: 3664 LCYSCGSGGD----QLIHCVSCAEPFHFFCIEYQFRPKSKEM---FVCRNCTKCHSCDVYGSD---LKCIKCQLGFHPTC----VDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAGLETIECNSCNRMVHRQCCGLSEDE 4179
            +C  CGS G      ++ C +CA+ +H +C+    +  S  +   + C +CT C  C   G +   L C +C + +H  C    +DK P      +  W C  C+ C  C  KA         N  + +         C  CA  R     CP C R YQ   + I C+ C++  H  C GL  DE
Sbjct:  427 MCLVCGSIGKGPEGSMVACSNCAQTYHTYCVTLHDKLNSAVVGRGWRCLDCTVCEGCGTGGDEANLLLCDECDVSYHIYCMKPLLDKIP------QGPWRCQWCSRCRRCNHKAASG------NDLTSQ-------GLCFPCASLR----KCPRCERNYQLNEKLIRCSQCSKWQHGACEGLYTDE 589          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Celegans
Match: set-12 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:Q21404])

HSP 1 Score: 90.8929 bits (224), Expect = 1.674e-18
Identity = 50/130 (38.46%), Postives = 73/130 (56.15%), Query Frame = 1
Query: 7714 GRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVD-CYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKV--VRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYL 8094
            G GL A  +    ++I+EY GE I     + R   Y++ G+   Y F + ++  VD T KGN+ARFINHSC+PN   KV  V     K + I A + I  GEE+T+DY     +D+ PC CG  +C+ ++
Sbjct:  107 GHGLRATEEIATGKLILEYRGEAITKAEHNKRVKRYKKDGIKHSYSFEVGRNYYVDPTRKGNSARFINHSCNPNALVKVWTVPDRPMKSLGIFASKVIKPGEEITFDYGTSFRNDQ-PCQCGEAACRGWI 235          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082947)

HSP 1 Score: 196.823 bits (499), Expect = 2.017e-49
Identity = 87/155 (56.13%), Postives = 114/155 (73.55%), Query Frame = 1
Query: 7633 LADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            +A ++R L+   +     V V  S+IHGRGL+  +  +A E++IEY GE+IRS L+D RE  Y   G+ CYMF++D +L+VDAT +GNAARFINH C PNCY+KVV   G KHIII A R+I +GEELTYDY+FP ED+K+PC+CGS  C+KYLN
Sbjct: 3575 MAMKYRTLK---ETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN 3726          

HSP 2 Score: 97.0561 bits (240), Expect = 2.798e-19
Identity = 73/246 (29.67%), Postives = 104/246 (42.28%), Query Frame = 1
Query: 3619 GFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCI--EYQFRPKSKE------------------------------MFVCRNCTKCHSCDVY-GSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GF +I T      + LC+ CGS G D LI C  C EP+H +C+  EY  +  S E                               ++C  CT C++C++  GS +KC KCQ  +H TC+         D+    C  C  C  C        +    +KF G +        C  C + R  G+ CP C R Y      L+ +EC  C + VH +C GLS+++Y +    PE    S  F+C KC
Sbjct: 1254 GFGLIVTETVA-QRALCFLCGSTGLDPLIFCACCCEPYHQYCVQDEYNLKHGSFEDTTLMGSLLETTVNASTGPSSSLNQLTQRLNWLCPRCTVCYTCNMSSGSKVKCQKCQKNYHSTCLGTSKRLLGADRP-LICVNCLKCKSC--------STTKVSKFVGNLPM------CTGCFKLRKKGNFCPICQRCYDDNDFDLKMMECGDCGQWVHSKCEGLSDEQYNLLSTLPE----SIEFICKKC 1479          

HSP 3 Score: 88.9669 bits (219), Expect = 9.348e-17
Identity = 68/228 (29.82%), Postives = 96/228 (42.11%), Query Frame = 1
Query: 5248 DIRHCALC--AGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDN----------CVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI-DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVT 5892
            D R C  C  +G G    E RL+Y G D WVH NCA+WS +V+E  DG+L NV  A+ +G    C  C   GAT+ C+          SC   YH+ CA ++  D  F   ++ YC     N           VT      V  P+   +   +  L          +    +   IG+L +  +G I    SD     + PI +   RL+WS  E   +V Y +  T
Sbjct: 1733 DTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNV--------RSCGEHYHYPCARSI--DCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKL----------IEPARVQFHIGSLEVRQLGAIVPRFSDSYEA-VVPINFLCSRLYWSSKEPWKIVEYTVRTT 1939          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082950)

HSP 1 Score: 196.823 bits (499), Expect = 2.017e-49
Identity = 87/155 (56.13%), Postives = 114/155 (73.55%), Query Frame = 1
Query: 7633 LADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            +A ++R L+   +     V V  S+IHGRGL+  +  +A E++IEY GE+IRS L+D RE  Y   G+ CYMF++D +L+VDAT +GNAARFINH C PNCY+KVV   G KHIII A R+I +GEELTYDY+FP ED+K+PC+CGS  C+KYLN
Sbjct: 3575 MAMKYRTLK---ETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN 3726          

HSP 2 Score: 97.0561 bits (240), Expect = 2.798e-19
Identity = 73/246 (29.67%), Postives = 104/246 (42.28%), Query Frame = 1
Query: 3619 GFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCI--EYQFRPKSKE------------------------------MFVCRNCTKCHSCDVY-GSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GF +I T      + LC+ CGS G D LI C  C EP+H +C+  EY  +  S E                               ++C  CT C++C++  GS +KC KCQ  +H TC+         D+    C  C  C  C        +    +KF G +        C  C + R  G+ CP C R Y      L+ +EC  C + VH +C GLS+++Y +    PE    S  F+C KC
Sbjct: 1254 GFGLIVTETVA-QRALCFLCGSTGLDPLIFCACCCEPYHQYCVQDEYNLKHGSFEDTTLMGSLLETTVNASTGPSSSLNQLTQRLNWLCPRCTVCYTCNMSSGSKVKCQKCQKNYHSTCLGTSKRLLGADRP-LICVNCLKCKSC--------STTKVSKFVGNLPM------CTGCFKLRKKGNFCPICQRCYDDNDFDLKMMECGDCGQWVHSKCEGLSDEQYNLLSTLPE----SIEFICKKC 1479          

HSP 3 Score: 88.9669 bits (219), Expect = 9.348e-17
Identity = 68/228 (29.82%), Postives = 96/228 (42.11%), Query Frame = 1
Query: 5248 DIRHCALC--AGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDN----------CVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI-DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVT 5892
            D R C  C  +G G    E RL+Y G D WVH NCA+WS +V+E  DG+L NV  A+ +G    C  C   GAT+ C+          SC   YH+ CA ++  D  F   ++ YC     N           VT      V  P+   +   +  L          +    +   IG+L +  +G I    SD     + PI +   RL+WS  E   +V Y +  T
Sbjct: 1733 DTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNV--------RSCGEHYHYPCARSI--DCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKL----------IEPARVQFHIGSLEVRQLGAIVPRFSDSYEA-VVPINFLCSRLYWSSKEPWKIVEYTVRTT 1939          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082948)

HSP 1 Score: 192.971 bits (489), Expect = 2.336e-48
Identity = 84/137 (61.31%), Postives = 106/137 (77.37%), Query Frame = 1
Query: 7687 VRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            V V  S+IHGRGL+  +  +A E++IEY GE+IRS L+D RE  Y   G+ CYMF++D +L+VDAT +GNAARFINH C PNCY+KVV   G KHIII A R+I +GEELTYDY+FP ED+K+PC+CGS  C+KYLN
Sbjct: 3222 VGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN 3358          

HSP 2 Score: 97.0561 bits (240), Expect = 2.668e-19
Identity = 73/246 (29.67%), Postives = 103/246 (41.87%), Query Frame = 1
Query: 3619 GFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCI--EYQFRPKSKE------------------------------MFVCRNCTKCHSCDVY-GSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GF +I T      + LC+ CGS G D LI C  C EP+H +C+  EY  +  S E                               ++C  CT C++C++  GS +KC KCQ  +H TC+         D+    C  C  C  C             +KF G +        C  C + R  G+ CP C R Y      L+ +EC  C + VH +C GLS+++Y +    PE    S  F+C KC
Sbjct:  886 GFGLIVTETVA-QRALCFLCGSTGLDPLIFCACCCEPYHQYCVQDEYNLKHGSFEDTTLMGSLLETTVNASTGPSSSLNQLTQRLNWLCPRCTVCYTCNMSSGSKVKCQKCQKNYHSTCLGTSKRLLGADRP-LICVNCLKCKSCSTT--------KVSKFVGNLPM------CTGCFKLRKKGNFCPICQRCYDDNDFDLKMMECGDCGQWVHSKCEGLSDEQYNLLSTLPE----SIEFICKKC 1111          

HSP 3 Score: 88.9669 bits (219), Expect = 9.230e-17
Identity = 68/228 (29.82%), Postives = 96/228 (42.11%), Query Frame = 1
Query: 5248 DIRHCALC--AGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDN----------CVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI-DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVT 5892
            D R C  C  +G G    E RL+Y G D WVH NCA+WS +V+E  DG+L NV  A+ +G    C  C   GAT+ C+          SC   YH+ CA ++  D  F   ++ YC     N           VT      V  P+   +   +  L          +    +   IG+L +  +G I    SD     + PI +   RL+WS  E   +V Y +  T
Sbjct: 1365 DTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNV--------RSCGEHYHYPCARSI--DCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKL----------IEPARVQFHIGSLEVRQLGAIVPRFSDSYEA-VVPINFLCSRLYWSSKEPWKIVEYTVRTT 1571          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082949)

HSP 1 Score: 192.971 bits (489), Expect = 2.336e-48
Identity = 84/137 (61.31%), Postives = 106/137 (77.37%), Query Frame = 1
Query: 7687 VRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            V V  S+IHGRGL+  +  +A E++IEY GE+IRS L+D RE  Y   G+ CYMF++D +L+VDAT +GNAARFINH C PNCY+KVV   G KHIII A R+I +GEELTYDY+FP ED+K+PC+CGS  C+KYLN
Sbjct: 3222 VGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN 3358          

HSP 2 Score: 97.0561 bits (240), Expect = 2.668e-19
Identity = 73/246 (29.67%), Postives = 103/246 (41.87%), Query Frame = 1
Query: 3619 GFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCI--EYQFRPKSKE------------------------------MFVCRNCTKCHSCDVY-GSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GF +I T      + LC+ CGS G D LI C  C EP+H +C+  EY  +  S E                               ++C  CT C++C++  GS +KC KCQ  +H TC+         D+    C  C  C  C             +KF G +        C  C + R  G+ CP C R Y      L+ +EC  C + VH +C GLS+++Y +    PE    S  F+C KC
Sbjct:  886 GFGLIVTETVA-QRALCFLCGSTGLDPLIFCACCCEPYHQYCVQDEYNLKHGSFEDTTLMGSLLETTVNASTGPSSSLNQLTQRLNWLCPRCTVCYTCNMSSGSKVKCQKCQKNYHSTCLGTSKRLLGADRP-LICVNCLKCKSCSTT--------KVSKFVGNLPM------CTGCFKLRKKGNFCPICQRCYDDNDFDLKMMECGDCGQWVHSKCEGLSDEQYNLLSTLPE----SIEFICKKC 1111          

HSP 3 Score: 88.9669 bits (219), Expect = 9.230e-17
Identity = 68/228 (29.82%), Postives = 96/228 (42.11%), Query Frame = 1
Query: 5248 DIRHCALC--AGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDN----------CVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI-DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVT 5892
            D R C  C  +G G    E RL+Y G D WVH NCA+WS +V+E  DG+L NV  A+ +G    C  C   GAT+ C+          SC   YH+ CA ++  D  F   ++ YC     N           VT      V  P+   +   +  L          +    +   IG+L +  +G I    SD     + PI +   RL+WS  E   +V Y +  T
Sbjct: 1365 DTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNV--------RSCGEHYHYPCARSI--DCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKL----------IEPARVQFHIGSLEVRQLGAIVPRFSDSYEA-VVPINFLCSRLYWSSKEPWKIVEYTVRTT 1571          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0100277)

HSP 1 Score: 192.971 bits (489), Expect = 2.336e-48
Identity = 84/137 (61.31%), Postives = 106/137 (77.37%), Query Frame = 1
Query: 7687 VRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            V V  S+IHGRGL+  +  +A E++IEY GE+IRS L+D RE  Y   G+ CYMF++D +L+VDAT +GNAARFINH C PNCY+KVV   G KHIII A R+I +GEELTYDY+FP ED+K+PC+CGS  C+KYLN
Sbjct: 3222 VGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN 3358          

HSP 2 Score: 97.0561 bits (240), Expect = 2.668e-19
Identity = 73/246 (29.67%), Postives = 103/246 (41.87%), Query Frame = 1
Query: 3619 GFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCI--EYQFRPKSKE------------------------------MFVCRNCTKCHSCDVY-GSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GF +I T      + LC+ CGS G D LI C  C EP+H +C+  EY  +  S E                               ++C  CT C++C++  GS +KC KCQ  +H TC+         D+    C  C  C  C             +KF G +        C  C + R  G+ CP C R Y      L+ +EC  C + VH +C GLS+++Y +    PE    S  F+C KC
Sbjct:  886 GFGLIVTETVA-QRALCFLCGSTGLDPLIFCACCCEPYHQYCVQDEYNLKHGSFEDTTLMGSLLETTVNASTGPSSSLNQLTQRLNWLCPRCTVCYTCNMSSGSKVKCQKCQKNYHSTCLGTSKRLLGADRP-LICVNCLKCKSCSTT--------KVSKFVGNLPM------CTGCFKLRKKGNFCPICQRCYDDNDFDLKMMECGDCGQWVHSKCEGLSDEQYNLLSTLPE----SIEFICKKC 1111          

HSP 3 Score: 88.9669 bits (219), Expect = 9.230e-17
Identity = 68/228 (29.82%), Postives = 96/228 (42.11%), Query Frame = 1
Query: 5248 DIRHCALC--AGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDN----------CVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI-DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVT 5892
            D R C  C  +G G    E RL+Y G D WVH NCA+WS +V+E  DG+L NV  A+ +G    C  C   GAT+ C+          SC   YH+ CA ++  D  F   ++ YC     N           VT      V  P+   +   +  L          +    +   IG+L +  +G I    SD     + PI +   RL+WS  E   +V Y +  T
Sbjct: 1365 DTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNV--------RSCGEHYHYPCARSI--DCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKL----------IEPARVQFHIGSLEVRQLGAIVPRFSDSYEA-VVPINFLCSRLYWSSKEPWKIVEYTVRTT 1571          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Zebrafish
Match: kmt2a (lysine (K)-specific methyltransferase 2A [Source:ZFIN;Acc:ZDB-GENE-080521-3])

HSP 1 Score: 234.187 bits (596), Expect = 1.184e-60
Identity = 132/326 (40.49%), Postives = 177/326 (54.29%), Query Frame = 1
Query: 7144 RKQRANHDYKFCLRFTI---HGFK-GSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPP--KNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            R    +H  K  L F I    GF+   +S +  W  +  ++ + R +  L        +G    G+ H  V++L+EQ+  A  C NY F+FHK   T     YL   V+PHG  R   + +        D   FL SK   PP          +    +          L ++FR L+    A    V V  S IHGRGLF R+  +  E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GN+ARFINHSC PNCY++VV  +G+KHI+I A RKIYKGEELTYDY+FPIE+  +KLPC CG+  C+K+LN
Sbjct: 3906 RDSSLDHKPKKGLIFEICSDDGFQIRCESIEEAWKSLTDKVQEARSNARLKALSFDGVNGLKMLGVVHDAVVFLLEQLYGARHCRNYRFRFHKPEET----DYLP--VNPHGSARAEVYHRKS----VLDMFNFLASKHRQPPVYNPQEEDEEEMQQKSARRATSTDLPLPEKFRQLKK---ASRDAVGVYRSAIHGRGLFCRKNIEPGEMVIEYSGNVIRSVLTDKREKYYDDKGIGCYMFRIDDYEVVDATIHGNSARFINHSCEPNCYSRVVNVDGQKHIVIFATRKIYKGEELTYDYKFPIEEPGNKLPCNCGAKKCRKFLN 4218          

HSP 2 Score: 138.658 bits (348), Expect = 1.158e-31
Identity = 80/213 (37.56%), Postives = 114/213 (53.52%), Query Frame = 1
Query: 5248 DIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLP-QGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            D R CALC   GD++    GRL+Y G + W HVNCALWS +VYE  DGAL NV +A+ +G++  C  C K GAT+ C        C +SC N YHF CA        F E +  YC + H + V    +      + RR+ +  +G    +     +G+  DNI + IG++ I+C+G + E SD  R  L P+GYQ  R++WS  +     +Y
Sbjct: 2064 DNRQCALCLNYGDEKTNDCGRLLYIGHNEWAHVNCALWSAEVYEDVDGALKNVHMAVSRGKQLQCKNCHKPGATVSC--------CMTSCTNNYHFMCARQQ--QCAFLEDKKVYC-QHHKDLVKGEVVPESSFEVTRRVLVDFEGI--RLRRKFVNGLEPDNIHMVIGSMTIDCLGMLTELSDCER-KLFPVGYQCSRVYWSTLDARKRCVY 2262          

HSP 3 Score: 116.316 bits (290), Expect = 6.121e-25
Identity = 75/225 (33.33%), Postives = 106/225 (47.11%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSK--EMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSDDKSN-WACYKCAMCLHCGA----KAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQA---GLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +V+C+ C S G+ + + C  C EPFH FC+    RP  +  E + CR C  CH C          L+C KC+  +HP C+    PTR   K   W C KC  C  CGA    KA DA              WS D   C  CA+    G++CP C + Y       + ++C  C+R VH +C  L++D  E+  + PE    +  + CT C
Sbjct: 1612 GGLSILTSVPITP-RVVCFLCASSGNVEFVFCQVCCEPFHLFCLGEAERPHDEQWENWCCRRCRFCHVCGRKYQKTKQLLECDKCRNSYHPECLGPNHPTRPTKKKRVWVCTKCVRCKSCGATKPGKAWDAQ-------------WSHDFSLCHDCAKRLTKGNLCPLCNKGYDDDDCDSKMMKCKKCDRWVHAKCESLTDDMCELMSSLPE----NVVYTCTNC 1818          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Zebrafish
Match: kmt2a (lysine (K)-specific methyltransferase 2A [Source:ZFIN;Acc:ZDB-GENE-080521-3])

HSP 1 Score: 234.187 bits (596), Expect = 1.235e-60
Identity = 132/326 (40.49%), Postives = 177/326 (54.29%), Query Frame = 1
Query: 7144 RKQRANHDYKFCLRFTI---HGFK-GSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPP--KNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            R    +H  K  L F I    GF+   +S +  W  +  ++ + R +  L        +G    G+ H  V++L+EQ+  A  C NY F+FHK   T     YL   V+PHG  R   + +        D   FL SK   PP          +    +          L ++FR L+    A    V V  S IHGRGLF R+  +  E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GN+ARFINHSC PNCY++VV  +G+KHI+I A RKIYKGEELTYDY+FPIE+  +KLPC CG+  C+K+LN
Sbjct: 3907 RDSSLDHKPKKGLIFEICSDDGFQIRCESIEEAWKSLTDKVQEARSNARLKALSFDGVNGLKMLGVVHDAVVFLLEQLYGARHCRNYRFRFHKPEET----DYLP--VNPHGSARAEVYHRKS----VLDMFNFLASKHRQPPVYNPQEEDEEEMQQKSARRATSTDLPLPEKFRQLKK---ASRDAVGVYRSAIHGRGLFCRKNIEPGEMVIEYSGNVIRSVLTDKREKYYDDKGIGCYMFRIDDYEVVDATIHGNSARFINHSCEPNCYSRVVNVDGQKHIVIFATRKIYKGEELTYDYKFPIEEPGNKLPCNCGAKKCRKFLN 4219          

HSP 2 Score: 138.658 bits (348), Expect = 1.139e-31
Identity = 80/213 (37.56%), Postives = 114/213 (53.52%), Query Frame = 1
Query: 5248 DIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLP-QGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            D R CALC   GD++    GRL+Y G + W HVNCALWS +VYE  DGAL NV +A+ +G++  C  C K GAT+ C        C +SC N YHF CA        F E +  YC + H + V    +      + RR+ +  +G    +     +G+  DNI + IG++ I+C+G + E SD  R  L P+GYQ  R++WS  +     +Y
Sbjct: 2064 DNRQCALCLNYGDEKTNDCGRLLYIGHNEWAHVNCALWSAEVYEDVDGALKNVHMAVSRGKQLQCKNCHKPGATVSC--------CMTSCTNNYHFMCARQQ--QCAFLEDKKVYC-QHHKDLVKGEVVPESSFEVTRRVLVDFEGI--RLRRKFVNGLEPDNIHMVIGSMTIDCLGMLTELSDCER-KLFPVGYQCSRVYWSTLDARKRCVY 2262          

HSP 3 Score: 116.316 bits (290), Expect = 6.070e-25
Identity = 75/225 (33.33%), Postives = 106/225 (47.11%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSK--EMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSDDKSN-WACYKCAMCLHCGA----KAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQA---GLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +V+C+ C S G+ + + C  C EPFH FC+    RP  +  E + CR C  CH C          L+C KC+  +HP C+    PTR   K   W C KC  C  CGA    KA DA              WS D   C  CA+    G++CP C + Y       + ++C  C+R VH +C  L++D  E+  + PE    +  + CT C
Sbjct: 1612 GGLSILTSVPITP-RVVCFLCASSGNVEFVFCQVCCEPFHLFCLGEAERPHDEQWENWCCRRCRFCHVCGRKYQKTKQLLECDKCRNSYHPECLGPNHPTRPTKKKRVWVCTKCVRCKSCGATKPGKAWDAQ-------------WSHDFSLCHDCAKRLTKGNLCPLCNKGYDDDDCDSKMMKCKKCDRWVHAKCESLTDDMCELMSSLPE----NVVYTCTNC 1818          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Zebrafish
Match: kmt2bb (lysine (K)-specific methyltransferase 2Bb [Source:ZFIN;Acc:ZDB-GENE-080521-1])

HSP 1 Score: 219.935 bits (559), Expect = 2.260e-56
Identity = 126/314 (40.13%), Postives = 175/314 (55.73%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKN--HAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    + S +  W  +++ + + R + GL    +    G    G+ H  V+YLVEQ+  A +C+ + F+FHK       +Q     V+P GC R   + +        D   FL S+    P    +     + L  +          +A +FR+L        + V V  S IHGRGLF +R  +A E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  EG+KHI+I A RKIY+GEELTYDY+FPIED  +KL C CG+  C+++LN
Sbjct: 3440 LRFEIASDDGFSIEADSIEVAWSAVLEGVQEARAAAGLRLLTMCGMSGARVMGMLHDAVVYLVEQLQGAKRCHRHTFRFHKQA-----SQDDDLPVNPSGCARSEVYLRKS----TFDMFNFLASQHRQLPDTDLYDEEEDEVLLKSTRRATSLELPMAMRFRHLER---TSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYSGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGQKHIVIFALRKIYRGEELTYDYKFPIEDASNKLGCNCGAKRCRRFLN 3741          

HSP 2 Score: 118.627 bits (296), Expect = 1.016e-25
Identity = 72/228 (31.58%), Postives = 118/228 (51.75%), Query Frame = 1
Query: 5218 SEFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTK 5895
            S+  +   + D R CALC   GD +    GRL+Y G + W HVNC++WS +V+E ++G+L++V  A+ +G    C  C + GAT+ C        C SSC + YHF CA     + VF + +  +C + H + ++   +T     +LRR+Y+    ++ +      G+  ++I + IG+L +  +GK+ E S      L P+GY+  R FWS         Y   VT+
Sbjct: 2036 SDLETGWSKDDERQCALCQKYGDAKASDAGRLLYLGQNEWAHVNCSMWSAEVFEEDNGSLLHVHSAVARGRLMRCERCNRTGATVGC--------CLSSCQSNYHFMCA--RFRNCVFQDDKKVFCYK-HRDLISGKMITGQGFEVLRRVYVDFEGIS-LRRKFLTGLEPESINLMIGSLLVEKLGKLSELS-ACDGKLFPVGYECSRWFWSTVNPLRRCKYTFRVTE 2250          

HSP 3 Score: 83.9593 bits (206), Expect = 3.769e-15
Identity = 61/218 (27.98%), Postives = 92/218 (42.20%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRP--KSKEMFVCRNCTKCHSCDVYGSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKCQP 4251
            GG  V+T+V   P+  +C  C S G  +++ C  C EPFH FC++   RP  ++KE + CR C  C  C                              +K +  C  C  C  CG           T   S + +W+ D   C  C R    G+ C  C + Y+      + ++C++CN  VH +C GL++D YEI  + PE+       +   CQP
Sbjct: 1639 GGLSVLTSVPLMPS-CVCLLCASKGQHEMLFCQVCCEPFHRFCLDPSERPLEENKENWCCRRCKFCRVCG---------------------------RKNKESKVCMTCIRCRSCGV----------TPGKSWDTEWNHDKGLCPDCTRLFDQGNYCTMCFKCYEDNDYDSQMMQCSTCNHWVHAKCEGLTDDLYEILSSLPES-------VVYSCQP 1811          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Zebrafish
Match: kmt2bb (lysine (K)-specific methyltransferase 2Bb [Source:ZFIN;Acc:ZDB-GENE-080521-1])

HSP 1 Score: 219.55 bits (558), Expect = 2.820e-56
Identity = 126/314 (40.13%), Postives = 175/314 (55.73%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKN--HAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    + S +  W  +++ + + R + GL    +    G    G+ H  V+YLVEQ+  A +C+ + F+FHK       +Q     V+P GC R   + +        D   FL S+    P    +     + L  +          +A +FR+L        + V V  S IHGRGLF +R  +A E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  EG+KHI+I A RKIY+GEELTYDY+FPIED  +KL C CG+  C+++LN
Sbjct: 3471 LRFEIASDDGFSIEADSIEVAWSAVLEGVQEARAAAGLRLLTMCGMSGARVMGMLHDAVVYLVEQLQGAKRCHRHTFRFHKQA-----SQDDDLPVNPSGCARSEVYLRKS----TFDMFNFLASQHRQLPDTDLYDEEEDEVLLKSTRRATSLELPMAMRFRHLER---TSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYSGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGQKHIVIFALRKIYRGEELTYDYKFPIEDASNKLGCNCGAKRCRRFLN 3772          

HSP 2 Score: 118.627 bits (296), Expect = 1.106e-25
Identity = 72/228 (31.58%), Postives = 118/228 (51.75%), Query Frame = 1
Query: 5218 SEFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTK 5895
            S+  +   + D R CALC   GD +    GRL+Y G + W HVNC++WS +V+E ++G+L++V  A+ +G    C  C + GAT+ C        C SSC + YHF CA     + VF + +  +C + H + ++   +T     +LRR+Y+    ++ +      G+  ++I + IG+L +  +GK+ E S      L P+GY+  R FWS         Y   VT+
Sbjct: 2067 SDLETGWSKDDERQCALCQKYGDAKASDAGRLLYLGQNEWAHVNCSMWSAEVFEEDNGSLLHVHSAVARGRLMRCERCNRTGATVGC--------CLSSCQSNYHFMCA--RFRNCVFQDDKKVFCYK-HRDLISGKMITGQGFEVLRRVYVDFEGIS-LRRKFLTGLEPESINLMIGSLLVEKLGKLSELS-ACDGKLFPVGYECSRWFWSTVNPLRRCKYTFRVTE 2281          

HSP 3 Score: 111.694 bits (278), Expect = 1.508e-23
Identity = 70/222 (31.53%), Postives = 105/222 (47.30%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRP--KSKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKCQP 4251
            GG  V+T+V   P+  +C  C S G  +++ C  C EPFH FC++   RP  ++KE + CR C  C  C     +    L+C +CQ  +HP C+    P  +  K  W C  C  C  CG           T   S + +W+ D   C  C R    G+ C  C + Y+      + ++C++CN  VH +C GL++D YEI  + PE+       +   CQP
Sbjct: 1639 GGLSVLTSVPLMPS-CVCLLCASKGQHEMLFCQVCCEPFHRFCLDPSERPLEENKENWCCRRCKFCRVCGRKNKESKPLLECERCQNCYHPACLGPNYPKPNKRKKPWVCMTCIRCRSCGV----------TPGKSWDTEWNHDKGLCPDCTRLFDQGNYCTMCFKCYEDNDYDSQMMQCSTCNHWVHAKCEGLTDDLYEILSSLPES-------VVYSCQP 1842          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Zebrafish
Match: kmt2ba (lysine (K)-specific methyltransferase 2Ba [Source:ZFIN;Acc:ZDB-GENE-060503-376])

HSP 1 Score: 214.927 bits (546), Expect = 7.168e-55
Identity = 114/294 (38.78%), Postives = 168/294 (57.14%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIE--DDKLPCTCGSFSCKKYLN 8097
             W  ++  + + R    + + P  + +G    G+ H  V++L+EQ+  A  C  + F+FH+  + +   + L +  +P+GC R   + +        D   FL S+    P++    + +               L  A +FR+L        + V V  S IHGRGLF +R  +A E++IEY G VIR++L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  EG+KHI+I A RKIY+GEELTYDY+FPIE  D+KL C CG+  C+++LN
Sbjct: 2664 AWKAVMDGVQEARIGCRMEQLPFNSINGARVLGVLHDAVLFLLEQLQGASLCQKHRFRFHQHEIPE---EELPE--NPNGCARAEVYVRKS----TFDMFNFLASQHRQLPESRPCDDDEDDIMLKSSRRATSTELPVAMRFRHLEK---TSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYAGNVIRAVLTDKREKYYDSKGIGCYMFRIDDFDVVDATMHGNAARFINHSCDPNCYSRVINVEGQKHIVIFALRKIYRGEELTYDYKFPIEDADNKLHCNCGARRCRRFLN 2945          

HSP 2 Score: 98.5969 bits (244), Expect = 1.344e-19
Identity = 60/202 (29.70%), Postives = 91/202 (45.05%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPK--SKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQA---GLETIECNSCNRMVHRQCCGLSEDEYEIF 4191
            GG  ++T+V   P + +C  C S G  ++++C  C EPFH FC+    RPK  +KE + CR C  CH C          L+C +C   +HP+C+    P      ++W C  C  C  CG           T   S +  W+ +   C  C +    G  C  C + Y+        ++C  C   VH +C GL++D +EI 
Sbjct: 1083 GGLSILTSVPIMP-QCVCLLCASKGQHEMVYCQMCCEPFHHFCLPPDDRPKEENKENWCCRRCKFCHVCGRKSKQTKPVLQCKRCMYCYHPSCLGPTYPKPVKMNTSWVCMLCIRCKSCGV----------TPGKSSDTSWNHELELCPDCNKLHSKGDFCTVCLKCYEEHEFDSSMMQCARCAHWVHPKCEGLTDDLHEIL 1273          

HSP 3 Score: 97.8265 bits (242), Expect = 1.945e-19
Identity = 87/307 (28.34%), Postives = 144/307 (46.91%), Query Frame = 1
Query: 4951 MVVKKYSGRAKLIMQALAENVRDNIN-REFDVFSSSITEIEEKLSNSFQRGR-EEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECS-DYLRVYLCPIGYQARRLFWSMYE 5856
            +  ++ + +AKL    L E V    N ++   +SS++ E        F RG   E II  S +H  +  + ++ Q+     S     +      NS     D R C+LC   GD +    GRL+Y G + W HVNC +WS +V E  +GAL++V  A+ +G    C  C + GAT+ C        C +SC + YHF CA     + VF   +  YC + H   +           ++RR+Y+    ++ +      G+  +++ V IG+L +  +G + E S +  ++Y  P+GYQ  R +WS  +
Sbjct: 1384 LEAQRPTSQAKLYYIKLVEQVFSWFNSQDPKTWSSNVQE--------FPRGMLPEAIIPPSNEH--SYAQWLKDQHPGSPQSKDQQKI------NSKPL--DERQCSLCQQHGDAKPNDAGRLLYIGQNEWAHVNCCIWSAEVQE-TNGALLHVHSAVARGRFMRCERCGQTGATVGC--------CLTSCQSNYHFMCA--RASNCVFQHDKKVYCYK-HRELINSKIEQGNGFEVVRRVYVDFDGIS-LRRKFLTGLEPESVNVMIGSLHVKNLGVLTELSANSGKLY--PVGYQCSRWYWSTVD 1657          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Xenopus
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:Xenbase;Acc:XB-GENE-957487])

HSP 1 Score: 236.498 bits (602), Expect = 3.736e-61
Identity = 127/313 (40.58%), Postives = 173/313 (55.27%), Query Frame = 1
Query: 7171 KFCLRFTIHGFKGSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPP--KNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            K  L F I    G +     W  + +++ + R +  L +       G    G+ H  V++LVEQ+  A +C NY+F+FH+    +         ++PHG  R     +      A D   FL SK   PP  K +     +    +          +  +FR+L+       + V V  S IHGRGLF RR  DA E++IEY G VIRSIL+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A RKIY+GEELTYDY+FPIED  +KL C CG+  C+K+LN
Sbjct: 3365 KTGLLFEISSDDGFQISAEAWKSLTEKVQEARSNARLKQLSFAGVSGLRMLGIVHDAVVFLVEQLYGANRCRNYKFRFHRPEGEE------EPPINPHGSARAEVHRRKS----AFDMFNFLASKHRQPPEYKPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKK---TSKEAVGVYRSPIHGRGLFCRRNIDAGEMVIEYSGNVIRSILTDKREKYYDGKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVIPIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDANNKLACNCGTKKCRKFLN 3664          

HSP 2 Score: 112.849 bits (281), Expect = 9.014e-24
Identity = 72/221 (32.58%), Postives = 105/221 (47.51%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSKEM--FVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++TT    P +V+C+ C S G  + ++C  C EPFH FC+E + RP   ++  + CR+C  CH C          L+C KC+  +HP C+   YP   +  K  W C KC  C  CG+          T     +  WS D   C  CA+    G+ CP C + Y       + ++C  C+R VH +C  L+++ YEI    PE    S A+ C  C
Sbjct: 1348 GGISLLTTAPVTP-RVVCFLCASSGHVEFVYCQVCCEPFHRFCLEERERPSEDQIENWCCRHCKFCHVCGRQQQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKRVWICTKCVRCKSCGS---------TTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCNKCYDDDDYESKMMQCGKCDRWVHSKCENLTDEMYEILSNLPE----SVAYTCINC 1554          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Xenopus
Match: kmt2b (lysine methyltransferase 2B [Source:NCBI gene;Acc:100144721])

HSP 1 Score: 219.55 bits (558), Expect = 3.542e-56
Identity = 124/315 (39.37%), Postives = 172/315 (54.60%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGD-GWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    + S +  W  +++++ + R    L    +     G   FG+ H  V++L+EQ+  A +C  Y+F FH   V +          +P GC R   + +        D   FL S+    P+       ++              L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  EG+KHI+I A R IY+GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 2515 LRFEITSEDGFYIQADSAEDAWKAVLEKVQETRGVGKLRHLSLSASMIGTRMFGVQHDAVLFLLEQLTGAERCRGYKFLFHPQEVEEGEIS-----TNPSGCARSEVYVRKS----TFDMFNFLASQHRTLPEIGPCEEEEEEVQLKSTRRATSLDLPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDSKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVIHVEGQKHIVIFALRSIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRRFLN 2817          

HSP 2 Score: 120.168 bits (300), Expect = 5.862e-26
Identity = 74/225 (32.89%), Postives = 116/225 (51.56%), Query Frame = 1
Query: 5248 DIRHCALCAGSGDD--RLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECS-DYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTKELNN 5907
            D R CALC   GDD  +  GRL+Y G + W H+NCA+WS +V+E  DG+L NV  A+ +G +  C  CQK GAT+ C        C S+C + +HF CA        F + +  +CS+ H   +    +      +LRR+Y+       +S       G+  D+I + IG+++I+ +G +++ S    ++Y  P+GYQ  RL+WS  +      Y   V +   N
Sbjct: 1613 DTRQCALCLKYGDDDPKDAGRLLYIGQNEWTHINCAIWSAEVFEENDGSLKNVHAAVARGRQLRCDNCQKIGATVGC--------CLSTCHSNFHFMCARAS--RCCFQDDKKMFCSK-HTKLLDGTPVEEDCFDVLRRVYVD---FEGISFRRKFLQGLEPDHIHMMIGSMKIDSLGMLNDLSVTEGKIY--PVGYQCSRLYWSTQDARRQCWYKCRVLEHCPN 1821          

HSP 3 Score: 107.457 bits (267), Expect = 3.507e-22
Identity = 68/222 (30.63%), Postives = 102/222 (45.95%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFRPKSKE--MFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCG-AKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  ++C  C S G  +L++C  C EPFH FC+E   RP   +   + CR C  C+ C   G      L+C  CQ  +H  C+   YP         W C  C  C  CG A  +D           G+++ ++D   C  C+     G+ CP C R Y+      + I+C  C++ +H +C GLS++ YE+    P+    S  + C  C
Sbjct: 1218 GGLSVLTSVPVNPT-LMCLLCASRGRHKLLYCQVCCEPFHRFCLEESERPLPNQEGTWCCRRCKFCNVCGQKGKAKKPLLECELCQTNYHVNCLGPNYPLKAPRSGKGWTCSACIRCRSCGIAPGKD-----------GDLELTEDSKLCSECSTLYDKGNFCPICIRCYEESEYESKMIQCAKCDKWIHSKCEGLSDEGYELLSNLPD----SVVYTCPPC 1423          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Xenopus
Match: kmt2b (lysine methyltransferase 2B [Source:NCBI gene;Acc:100144721])

HSP 1 Score: 219.55 bits (558), Expect = 4.007e-56
Identity = 124/315 (39.37%), Postives = 172/315 (54.60%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGD-GWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    + S +  W  +++++ + R    L    +     G   FG+ H  V++L+EQ+  A +C  Y+F FH   V +          +P GC R   + +        D   FL S+    P+       ++              L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  EG+KHI+I A R IY+GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 2385 LRFEITSEDGFYIQADSAEDAWKAVLEKVQETRGVGKLRHLSLSASMIGTRMFGVQHDAVLFLLEQLTGAERCRGYKFLFHPQEVEEGEIS-----TNPSGCARSEVYVRKS----TFDMFNFLASQHRTLPEIGPCEEEEEEVQLKSTRRATSLDLPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDSKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVIHVEGQKHIVIFALRSIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRRFLN 2687          

HSP 2 Score: 107.457 bits (267), Expect = 3.841e-22
Identity = 68/222 (30.63%), Postives = 102/222 (45.95%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFRPKSKE--MFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCG-AKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  ++C  C S G  +L++C  C EPFH FC+E   RP   +   + CR C  C+ C   G      L+C  CQ  +H  C+   YP         W C  C  C  CG A  +D           G+++ ++D   C  C+     G+ CP C R Y+      + I+C  C++ +H +C GLS++ YE+    P+    S  + C  C
Sbjct: 1186 GGLSVLTSVPVNPT-LMCLLCASRGRHKLLYCQVCCEPFHRFCLEESERPLPNQEGTWCCRRCKFCNVCGQKGKAKKPLLECELCQTNYHVNCLGPNYPLKAPRSGKGWTCSACIRCRSCGIAPGKD-----------GDLELTEDSKLCSECSTLYDKGNFCPICIRCYEESEYESKMIQCAKCDKWIHSKCEGLSDEGYELLSNLPD----SVVYTCPPC 1391          

HSP 3 Score: 106.686 bits (265), Expect = 5.894e-22
Identity = 65/206 (31.55%), Postives = 106/206 (51.46%), Query Frame = 1
Query: 5299 GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECS-DYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTKELNN 5907
            GRL+Y G + W H+NCA+WS +V+E  DG+L NV  A+ +G +  C  CQK GAT+ C        C S+C + +HF CA        F + +  +CS+ H   +    +      +LRR+Y+       +S       G+  D+I + IG+++I+ +G +++ S    ++Y  P+GYQ  RL+WS  +      Y   V +   N
Sbjct: 1502 GRLLYIGQNEWTHINCAIWSAEVFEENDGSLKNVHAAVARGRQLRCDNCQKIGATVGC--------CLSTCHSNFHFMCARAS--RCCFQDDKKMFCSK-HTKLLDGTPVEEDCFDVLRRVYVD---FEGISFRRKFLQGLEPDHIHMMIGSMKIDSLGMLNDLSVTEGKIY--PVGYQCSRLYWSTQDARRQCWYKCRVLEHCPN 1691          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 157.918 bits (398), Expect = 1.694e-40
Identity = 98/300 (32.67%), Postives = 158/300 (52.67%), Query Frame = 1
Query: 7216 SPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKS----NYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDD--KLPCTCGSFSCKKYLN 8097
            SP++ W  + + + +MR+  G++        G   FGL    V+ + E +     C NY F++ K  + +L       +++P GC R              +P    H K     N    + A  +    + N    + ++ + + Q+R L+          R   S I G GL+A +  + H ++IEY+G +IR+ +++ RE  Y+      YMFR++ + ++DAT  G  AR+INHSC PNC A+VV F+ E  IIII+ R+I KGEELTYDY+F  EDD  K+PC CG+++C+K++N
Sbjct:  129 SPQALWNRVAEPVARMRRETGMLRLFPEYLKGEEMFGLTVHAVLRIAESLPGVENCQNYLFRYGKHPLMEL-----PLMINPTGCAR-------------SEPKIMTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLKTEWKTNVYLAR---SRIQGLGLYASKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN 407          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Xenopus
Match: setd1b (SET domain containing 1B [Source:NCBI gene;Acc:780106])

HSP 1 Score: 166.777 bits (421), Expect = 3.134e-40
Identity = 77/147 (52.38%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            N +  R K +R C S+IH  GLFA     A E++IEYVG+ IR +++D+RE  Y+  G+   YMFR+D D I+DAT  GN ARFINHSC+PNCYAKV+  E +K I+I +++ I   EE+TYDY+FPIED K+PC CG+ +C+  LN
Sbjct: 1816 NQLKFRKKKLRFCKSHIHDWGLFAMEPIIADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQYINVNEEITYDYKFPIEDVKIPCLCGAENCRGTLN 1962          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Mouse
Match: Kmt2a (lysine (K)-specific methyltransferase 2A [Source:MGI Symbol;Acc:MGI:96995])

HSP 1 Score: 236.498 bits (602), Expect = 2.533e-61
Identity = 120/292 (41.10%), Postives = 163/292 (55.82%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
             W  +  ++ + R +  L +      +G    G+ H  V++L+EQ+  A  C NY+F+FHK        +     ++PHG  R     +      A D   FL SK   PP+ +     ++              L    R  R+      + V V  S IHGRGLF +R  DA E++IEY G VIRSI +D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A RKIY+GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 3686 AWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLAGAKHCRNYKFRFHKP------EEANEPPLNPHGSARAEVHLR----QSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMR-FRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN 3966          

HSP 2 Score: 130.954 bits (328), Expect = 2.241e-29
Identity = 77/223 (34.53%), Postives = 120/223 (53.81%), Query Frame = 1
Query: 5221 EFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            E N      D R CALC   GDD     GRL+Y G + W HVNCALWS +V+E +DG+L NV +A+ +G++  C  CQK GAT+ C        C +SC + YHF C+     + VF + +  YC + H + +    +      + RR+++       +S+     +G+  +NI + IG++ I+C+G +++ SD     L PIGYQ  R++WS  +     +Y
Sbjct: 1862 ELNPPPGIDDNRQCALCLMYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGC--------CLTSCTSNYHFMCSRAK--NCVFLDDKKVYC-QRHRDLIKGEVVPENGFEVFRRVFV---DFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSD-CEDKLFPIGYQCSRVYWSTTDARKRCVY 2069          

HSP 3 Score: 102.834 bits (255), Expect = 6.982e-21
Identity = 75/224 (33.48%), Postives = 104/224 (46.43%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSKEM--FVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCP---ECGRAYQAGLETIECNSCNRMVHRQCCGLS--EDE-YEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +V+C+ C S G  + ++C  C EPFH FC+E   RP   ++  + CR C  CH C          L+C KC+  +HP C+   YP   +  K  W C KC  C  CG+          T     +  WS D   C  CA+    G+ CP   +C        + ++C  C+R VH +C  LS  EDE YEI    PE    S A+ C  C
Sbjct: 1417 GGLGILTSVPITP-RVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGS---------TTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCESLSGTEDEMYEILSNLPE----SVAYTCVNC 1626          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Mouse
Match: Kmt2a (lysine (K)-specific methyltransferase 2A [Source:MGI Symbol;Acc:MGI:96995])

HSP 1 Score: 236.498 bits (602), Expect = 2.664e-61
Identity = 120/292 (41.10%), Postives = 163/292 (55.82%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
             W  +  ++ + R +  L +      +G    G+ H  V++L+EQ+  A  C NY+F+FHK        +     ++PHG  R     +      A D   FL SK   PP+ +     ++              L    R  R+      + V V  S IHGRGLF +R  DA E++IEY G VIRSI +D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A RKIY+GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 3683 AWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLAGAKHCRNYKFRFHKP------EEANEPPLNPHGSARAEVHLR----QSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMR-FRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN 3963          

HSP 2 Score: 130.954 bits (328), Expect = 2.061e-29
Identity = 77/223 (34.53%), Postives = 120/223 (53.81%), Query Frame = 1
Query: 5221 EFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            E N      D R CALC   GDD     GRL+Y G + W HVNCALWS +V+E +DG+L NV +A+ +G++  C  CQK GAT+ C        C +SC + YHF C+     + VF + +  YC + H + +    +      + RR+++       +S+     +G+  +NI + IG++ I+C+G +++ SD     L PIGYQ  R++WS  +     +Y
Sbjct: 1859 ELNPPPGIDDNRQCALCLMYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGC--------CLTSCTSNYHFMCSRAK--NCVFLDDKKVYC-QRHRDLIKGEVVPENGFEVFRRVFV---DFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSD-CEDKLFPIGYQCSRVYWSTTDARKRCVY 2066          

HSP 3 Score: 106.686 bits (265), Expect = 5.689e-22
Identity = 72/221 (32.58%), Postives = 103/221 (46.61%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSKEM--FVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCP---ECGRAYQAGLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +V+C+ C S G  + ++C  C EPFH FC+E   RP   ++  + CR C  CH C          L+C KC+  +HP C+   YP   +  K  W C KC  C  CG+          T     +  WS D   C  CA+    G+ CP   +C        + ++C  C+R VH +C  LS++ YEI    PE    S A+ C  C
Sbjct: 1417 GGLGILTSVPITP-RVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGS---------TTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCESLSDEMYEILSNLPE----SVAYTCVNC 1623          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Mouse
Match: Kmt2b (lysine (K)-specific methyltransferase 2B [Source:MGI Symbol;Acc:MGI:109565])

HSP 1 Score: 213.772 bits (543), Expect = 1.219e-54
Identity = 120/314 (38.22%), Postives = 172/314 (54.78%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    ++S +  W  +++++ + R    L         G    G+ H  VI+L EQ+  A +C +Y+F++H+    +         ++PHG  R   + +        D   FL S+    P+       +               L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNC+++V+  EG+KHI+I A R+I +GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 1713 LRFEISSDDGFSVEAESLEVAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPP-----LNPHGAARAEVYLRK----CTFDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN 2014          

HSP 2 Score: 125.946 bits (315), Expect = 6.053e-28
Identity = 83/252 (32.94%), Postives = 125/252 (49.60%), Query Frame = 1
Query: 5113 IIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICE-KDIRHCALCA--GSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVD-MPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYE 5856
            ++  S  H+ A  +  E +           + AF S+  +      D R CALC   G  D +  GRL+Y G + W HVNCA+WS +V+E  DG+L NV  A+ +G +  C  C K GAT+ C        C SSC + +HF CA       +F + +  +C + H + +   ++   D   +LRR+Y+    + N       G+  D I V IG++RIN +G + + SD     L PIGYQ  RL+WS  +
Sbjct:  829 VLPPSLDHVYAQWRQQESETPESGQPPGDPSAAFQSKDPAAFSHLDDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGC--------CLSSCLSNFHFMCARASY--CIFQDDKKVFC-QKHTDLLDGKEIVTPDGFDVLRRVYVDFEGI-NFKRKFLTGLEPDVINVLIGSIRINSLGTLSDLSD-CEGRLFPIGYQCSRLYWSTVD 1067          

HSP 3 Score: 117.857 bits (294), Expect = 2.004e-25
Identity = 73/221 (33.03%), Postives = 107/221 (48.42%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFR--PKSKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSD-DKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  V C  C S G  +L+ C  C +PFH FC+E   R  P+ ++ + CR C  CH C   G      L+C +C+  +HP C+    PTR+   + +W C  C  C  CGA          T   + +++WS D   C RC      G+ CP C R Y+      + ++C  C+  VH +C GLS+++YEI    P+    S  + C  C
Sbjct:  486 GGLSVLTSVPGGPPMV-CLLCASKGLHELVFCQVCCDPFHPFCLEEAERPSPQHRDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACVRCKSCGA----------TPGKNWDVEWSGDYSLCPRCTELYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPD----SVLYTCGPC 691          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Mouse
Match: Kmt2b (lysine (K)-specific methyltransferase 2B [Source:MGI Symbol;Acc:MGI:109565])

HSP 1 Score: 212.231 bits (539), Expect = 4.587e-54
Identity = 120/314 (38.22%), Postives = 172/314 (54.78%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    ++S +  W  +++++ + R    L         G    G+ H  VI+L EQ+  A +C +Y+F++H+    +         ++PHG  R   + +        D   FL S+    P+       +               L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNC+++V+  EG+KHI+I A R+I +GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 2412 LRFEISSDDGFSVEAESLEVAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPP-----LNPHGAARAEVYLRK----CTFDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN 2713          

HSP 2 Score: 127.102 bits (318), Expect = 3.077e-28
Identity = 83/252 (32.94%), Postives = 125/252 (49.60%), Query Frame = 1
Query: 5113 IIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICE-KDIRHCALCA--GSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVD-MPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYE 5856
            ++  S  H+ A  +  E +           + AF S+  +      D R CALC   G  D +  GRL+Y G + W HVNCA+WS +V+E  DG+L NV  A+ +G +  C  C K GAT+ C        C SSC + +HF CA       +F + +  +C + H + +   ++   D   +LRR+Y+    + N       G+  D I V IG++RIN +G + + SD     L PIGYQ  RL+WS  +
Sbjct: 1537 VLPPSLDHVYAQWRQQESETPESGQPPGDPSAAFQSKDPAAFSHLDDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGC--------CLSSCLSNFHFMCARASY--CIFQDDKKVFC-QKHTDLLDGKEIVTPDGFDVLRRVYVDFEGI-NFKRKFLTGLEPDVINVLIGSIRINSLGTLSDLSD-CEGRLFPIGYQCSRLYWSTVD 1775          

HSP 3 Score: 117.857 bits (294), Expect = 1.849e-25
Identity = 73/221 (33.03%), Postives = 107/221 (48.42%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFR--PKSKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSD-DKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  V C  C S G  +L+ C  C +PFH FC+E   R  P+ ++ + CR C  CH C   G      L+C +C+  +HP C+    PTR+   + +W C  C  C  CGA          T   + +++WS D   C RC      G+ CP C R Y+      + ++C  C+  VH +C GLS+++YEI    P+    S  + C  C
Sbjct: 1194 GGLSVLTSVPGGPPMV-CLLCASKGLHELVFCQVCCDPFHPFCLEEAERPSPQHRDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACVRCKSCGA----------TPGKNWDVEWSGDYSLCPRCTELYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPD----SVLYTCGPC 1399          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Mouse
Match: Kmt2b (lysine (K)-specific methyltransferase 2B [Source:MGI Symbol;Acc:MGI:109565])

HSP 1 Score: 212.231 bits (539), Expect = 4.595e-54
Identity = 120/314 (38.22%), Postives = 172/314 (54.78%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    ++S +  W  +++++ + R    L         G    G+ H  VI+L EQ+  A +C +Y+F++H+    +         ++PHG  R   + +        D   FL S+    P+       +               L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNC+++V+  EG+KHI+I A R+I +GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 2420 LRFEISSDDGFSVEAESLEVAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPP-----LNPHGAARAEVYLRK----CTFDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN 2721          

HSP 2 Score: 127.102 bits (318), Expect = 3.106e-28
Identity = 83/252 (32.94%), Postives = 125/252 (49.60%), Query Frame = 1
Query: 5113 IIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICE-KDIRHCALCA--GSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVD-MPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYE 5856
            ++  S  H+ A  +  E +           + AF S+  +      D R CALC   G  D +  GRL+Y G + W HVNCA+WS +V+E  DG+L NV  A+ +G +  C  C K GAT+ C        C SSC + +HF CA       +F + +  +C + H + +   ++   D   +LRR+Y+    + N       G+  D I V IG++RIN +G + + SD     L PIGYQ  RL+WS  +
Sbjct: 1537 VLPPSLDHVYAQWRQQESETPESGQPPGDPSAAFQSKDPAAFSHLDDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGC--------CLSSCLSNFHFMCARASY--CIFQDDKKVFC-QKHTDLLDGKEIVTPDGFDVLRRVYVDFEGI-NFKRKFLTGLEPDVINVLIGSIRINSLGTLSDLSD-CEGRLFPIGYQCSRLYWSTVD 1775          

HSP 3 Score: 117.857 bits (294), Expect = 2.064e-25
Identity = 73/221 (33.03%), Postives = 107/221 (48.42%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFR--PKSKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSD-DKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  V C  C S G  +L+ C  C +PFH FC+E   R  P+ ++ + CR C  CH C   G      L+C +C+  +HP C+    PTR+   + +W C  C  C  CGA          T   + +++WS D   C RC      G+ CP C R Y+      + ++C  C+  VH +C GLS+++YEI    P+    S  + C  C
Sbjct: 1194 GGLSVLTSVPGGPPMV-CLLCASKGLHELVFCQVCCDPFHPFCLEEAERPSPQHRDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACVRCKSCGA----------TPGKNWDVEWSGDYSLCPRCTELYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPD----SVLYTCGPC 1399          
BLAST of histone lysine N methyltransferase MLL-1 vs. UniProt/SwissProt
Match: sp|P55200|KMT2A_MOUSE (Histone-lysine N-methyltransferase 2A OS=Mus musculus OX=10090 GN=Kmt2a PE=1 SV=3)

HSP 1 Score: 236.498 bits (602), Expect = 1.772e-60
Identity = 120/292 (41.10%), Postives = 163/292 (55.82%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
             W  +  ++ + R +  L +      +G    G+ H  V++L+EQ+  A  C NY+F+FHK        +     ++PHG  R     +      A D   FL SK   PP+ +     ++              L    R  R+      + V V  S IHGRGLF +R  DA E++IEY G VIRSI +D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A RKIY+GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 3686 AWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLAGAKHCRNYKFRFHKP------EEANEPPLNPHGSARAEVHLR----QSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMR-FRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN 3966          

HSP 2 Score: 130.954 bits (328), Expect = 1.568e-28
Identity = 77/223 (34.53%), Postives = 120/223 (53.81%), Query Frame = 1
Query: 5221 EFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            E N      D R CALC   GDD     GRL+Y G + W HVNCALWS +V+E +DG+L NV +A+ +G++  C  CQK GAT+ C        C +SC + YHF C+     + VF + +  YC + H + +    +      + RR+++       +S+     +G+  +NI + IG++ I+C+G +++ SD     L PIGYQ  R++WS  +     +Y
Sbjct: 1862 ELNPPPGIDDNRQCALCLMYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGC--------CLTSCTSNYHFMCSRAK--NCVFLDDKKVYC-QRHRDLIKGEVVPENGFEVFRRVFV---DFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSD-CEDKLFPIGYQCSRVYWSTTDARKRCVY 2069          

HSP 3 Score: 102.834 bits (255), Expect = 4.884e-20
Identity = 75/224 (33.48%), Postives = 104/224 (46.43%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSKEM--FVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCP---ECGRAYQAGLETIECNSCNRMVHRQCCGLS--EDE-YEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +V+C+ C S G  + ++C  C EPFH FC+E   RP   ++  + CR C  CH C          L+C KC+  +HP C+   YP   +  K  W C KC  C  CG+          T     +  WS D   C  CA+    G+ CP   +C        + ++C  C+R VH +C  LS  EDE YEI    PE    S A+ C  C
Sbjct: 1417 GGLGILTSVPITP-RVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGS---------TTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCESLSGTEDEMYEILSNLPE----SVAYTCVNC 1626          
BLAST of histone lysine N methyltransferase MLL-1 vs. UniProt/SwissProt
Match: sp|Q03164|KMT2A_HUMAN (Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5)

HSP 1 Score: 236.113 bits (601), Expect = 2.460e-60
Identity = 120/292 (41.10%), Postives = 163/292 (55.82%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
             W  +  ++ + R +  L +      +G    G+ H  V++L+EQ+  A  C NY+F+FHK        +     ++PHG  R     +      A D   FL SK   PP+ +     ++              L    R  R+      + V V  S IHGRGLF +R  DA E++IEY G VIRSI +D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A RKIY+GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 3689 AWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPE------EANEPPLNPHGSARAEVHLRKS----AFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMR-FRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN 3969          

HSP 2 Score: 132.109 bits (331), Expect = 7.068e-29
Identity = 77/223 (34.53%), Postives = 121/223 (54.26%), Query Frame = 1
Query: 5221 EFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            E N     +D R CALC   GDD     GRL+Y G + W HVNCALWS +V+E +DG+L NV +A+ +G++  C  CQK GAT+ C        C +SC + YHF C+     + VF + +  YC + H + +    +      + RR+++       +S+     +G+  +NI + IG++ I+C+G +++ SD     L PIGYQ  R++WS  +     +Y
Sbjct: 1860 ELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGC--------CLTSCTSNYHFMCSRAK--NCVFLDDKKVYC-QRHRDLIKGEVVPENGFEVFRRVFV---DFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSD-CEDKLFPIGYQCSRVYWSTTDARKRCVY 2067          

HSP 3 Score: 105.916 bits (263), Expect = 5.903e-21
Identity = 72/221 (32.58%), Postives = 103/221 (46.61%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSKEM--FVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCP---ECGRAYQAGLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +V+C+ C S G  + ++C  C EPFH FC+E   RP   ++  + CR C  CH C          L+C KC+  +HP C+   YP   +  K  W C KC  C  CG+          T     +  WS D   C  CA+    G+ CP   +C        + ++C  C+R VH +C  LS++ YEI    PE    S A+ C  C
Sbjct: 1418 GGLGILTSVPITP-RVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGS---------TTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPE----SVAYTCVNC 1624          
BLAST of histone lysine N methyltransferase MLL-1 vs. UniProt/SwissProt
Match: sp|Q9UMN6|KMT2B_HUMAN (Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.141e-53
Identity = 120/314 (38.22%), Postives = 172/314 (54.78%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    ++S +  W  +++++ + R    L         G    G+ H  VI+L EQ+  A +C +Y+F++H+    +         ++PHG  R   + +        D   FL S+    P+       +               L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNC+++V+  EG+KHI+I A R+I +GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 2414 LRFEISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPP-----LNPHGAARAEVYLRK----CTFDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN 2715          

HSP 2 Score: 124.79 bits (312), Expect = 1.164e-26
Identity = 91/298 (30.54%), Postives = 139/298 (46.64%), Query Frame = 1
Query: 4975 RAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAF----PSEFNSTICEKDIRHCALCA--GSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVD-MPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWS 5847
            RA   M+ L   + ++    FD           +L N         ++  S  H+ A  +  E +           + AF    P+ F+     +D R CALC   G  D +  GRL+Y G + W HVNCA+WS +V+E  DG+L NV  A+ +G +  C  C K GAT+ C        C SSC + +HF CA       +F + +  +C + H + +   ++   D   +LRR+Y+    + N       G+  D I V IG++RI+ +G + + SD     L PIGYQ  RL+WS
Sbjct: 1488 RAGGQMKGLLLKLLESAFGWFDAHDPKYWRRSTRLPNGVL---PNAVLPPSLDHVYAQWRQQEPETPESGQPPGDPSAAFQGKDPAAFSHL---EDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGC--------CLSSCLSNFHFMCARASY--CIFQDDKKVFC-QKHTDLLDGKEIVNPDGFDVLRRVYVDFEGI-NFKRKFLTGLEPDAINVLIGSIRIDSLGTLSDLSD-CEGRLFPIGYQCSRLYWS 1766          

HSP 3 Score: 117.472 bits (293), Expect = 1.936e-24
Identity = 74/221 (33.48%), Postives = 107/221 (48.42%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFR--PKSKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSDDK-SNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  V C  C S G  +L+ C  C +PFH FC+E   R  P+  + + CR C  CH C   G      L+C +C+  +HP C+    PTR+  K  +W C  C  C  CGA          T   + +++WS D   C RC +    G+ CP C R Y+      + ++C  C+  VH +C GLS+++YEI    P+    S  + C  C
Sbjct: 1188 GGLSVLTSVPGGPPMV-CLLCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGA----------TPGKNWDVEWSGDYSLCPRCTQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPD----SVLYTCGPC 1393          
BLAST of histone lysine N methyltransferase MLL-1 vs. UniProt/SwissProt
Match: sp|O08550|KMT2B_MOUSE (Histone-lysine N-methyltransferase 2B OS=Mus musculus OX=10090 GN=Kmt2b PE=1 SV=3)

HSP 1 Score: 212.231 bits (539), Expect = 3.209e-53
Identity = 120/314 (38.22%), Postives = 172/314 (54.78%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTL--ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    ++S +  W  +++++ + R    L         G    G+ H  VI+L EQ+  A +C +Y+F++H+    +         ++PHG  R   + +        D   FL S+    P+       +               L  A +FR+L+       + V V  S IHGRGLF +R  DA E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNC+++V+  EG+KHI+I A R+I +GEELTYDY+FPIED  +KLPC CG+  C+++LN
Sbjct: 2412 LRFEISSDDGFSVEAESLEVAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPP-----LNPHGAARAEVYLRK----CTFDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKK---TSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN 2713          

HSP 2 Score: 127.102 bits (318), Expect = 2.153e-27
Identity = 83/252 (32.94%), Postives = 125/252 (49.60%), Query Frame = 1
Query: 5113 IIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICE-KDIRHCALCA--GSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVD-MPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYE 5856
            ++  S  H+ A  +  E +           + AF S+  +      D R CALC   G  D +  GRL+Y G + W HVNCA+WS +V+E  DG+L NV  A+ +G +  C  C K GAT+ C        C SSC + +HF CA       +F + +  +C + H + +   ++   D   +LRR+Y+    + N       G+  D I V IG++RIN +G + + SD     L PIGYQ  RL+WS  +
Sbjct: 1537 VLPPSLDHVYAQWRQQESETPESGQPPGDPSAAFQSKDPAAFSHLDDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGC--------CLSSCLSNFHFMCARASY--CIFQDDKKVFC-QKHTDLLDGKEIVTPDGFDVLRRVYVDFEGI-NFKRKFLTGLEPDVINVLIGSIRINSLGTLSDLSD-CEGRLFPIGYQCSRLYWSTVD 1775          

HSP 3 Score: 117.857 bits (294), Expect = 1.293e-24
Identity = 73/221 (33.03%), Postives = 107/221 (48.42%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFR--PKSKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSD-DKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  V+T+V   P  V C  C S G  +L+ C  C +PFH FC+E   R  P+ ++ + CR C  CH C   G      L+C +C+  +HP C+    PTR+   + +W C  C  C  CGA          T   + +++WS D   C RC      G+ CP C R Y+      + ++C  C+  VH +C GLS+++YEI    P+    S  + C  C
Sbjct: 1194 GGLSVLTSVPGGPPMV-CLLCASKGLHELVFCQVCCDPFHPFCLEEAERPSPQHRDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACVRCKSCGA----------TPGKNWDVEWSGDYSLCPRCTELYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPD----SVLYTCGPC 1399          
BLAST of histone lysine N methyltransferase MLL-1 vs. UniProt/SwissProt
Match: sp|Q24742|TRX_DROVI (Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis OX=7244 GN=trx PE=3 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 5.740e-49
Identity = 88/155 (56.77%), Postives = 115/155 (74.19%), Query Frame = 1
Query: 7633 LADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            +A ++R L+   +     V V  S+IHGRGL+  +  +A E++IEY GE+IRS L+D RE  Y   G+ CYMF++D +L+VDAT +GNAARFINHSC PNCY+KVV   G KHIII A R+I +GEELTYDY+FP ED+K+PC+CGS  C+KYLN
Sbjct: 3677 MAMKYRTLK---ETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHSCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN 3828          

HSP 2 Score: 99.7525 bits (247), Expect = 4.797e-19
Identity = 73/250 (29.20%), Postives = 105/250 (42.00%), Query Frame = 1
Query: 3613 EGGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCI--EYQFRPKSKE--------------------------------MFVCRNCTKCHSCDVY-GSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            + GF +I T      + LC+ CGS G D LI C  C EP+H +C+  EY  +  S E                                 ++C  CT C++C++  GS +KC KCQ  +H TC+         D+    C  C  C  C             +KF G +        C  C + R  G+ CP C + Y      L+ +EC  CN+ VH +C GLS+++Y +    PE    S  F+C KC
Sbjct: 1237 QTGFGLIVTETVA-QRALCFLCGSTGLDPLIFCACCCEPYHQYCVLDEYNLKHSSFEDTLMTSLLETSNNACAISAATNTALNQLTQRLNWLCPRCTVCYTCNMSSGSKVKCQKCQKNYHSTCLGTSKRLLGADRP-LICVNCLKCKSCATT--------KVSKFVGNLPM------CTACFKLRKKGNFCPICQKCYDDNDFDLKMMECGDCNQWVHSKCEGLSDEQYNLLSTLPE----SIEFICKKC 1466          

HSP 3 Score: 92.4337 bits (228), Expect = 8.401e-17
Identity = 65/222 (29.28%), Postives = 97/222 (43.69%), Query Frame = 1
Query: 5248 DIRHCALC--AGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLV----DMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI-DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVT 5892
            D R C  C  +G G    E RL+Y G D WVH+NCA+WS +V+E  DG+L NV  A+ +G    C  C   GAT+ C+          SC   YH+ CA  +  D  F   ++ YC     N +       V    +  + R +Y+       +       +    +   IG++ +  +G I    SD     + PI +   RL+WS  E   +V Y +  T
Sbjct: 1707 DTRVCLFCRKSGEGLSGEEARLLYCGHDCWVHINCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNV--------KSCGEHYHYPCARTI--DCAFLTDKSMYCPAHARNALKANGSPSVTYESNFEVSRPVYV------ELERKRKKLIVPAKVQFHIGSVAVRQLGSIVPRFSDSFEA-IVPINFLCSRLYWSSKEPWKIVEYTVRTT 1911          
BLAST of histone lysine N methyltransferase MLL-1 vs. TrEMBL
Match: I1ZIL1 (Histone lysine N methyltransferase MLL-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 995.727 bits (2573), Expect = 0.000e+0
Identity = 485/488 (99.39%), Postives = 488/488 (100.00%), Query Frame = 1
Query: 4168 SEDEYEIFKADPEAHCSSNAFLCTKCQPPDVAEETEQKKRVRLKRQCKDSGLKQYCERSVQRKTNEFIQKGEAAEEMLLEQHNVSDSAATGYNKGSMSLSQYDGHXXXXXXXKIGGNRGLMSVKDYEGLAMNSPSADMNQTSSTMFCSSESTGECDMDPLNLMDLEHQSVKVDIDVELENIEFESSRATKIGIFSRLNAPDFLSPKHLLMEALARICVKLSRYPSHSQLHKVYERFIGRIEDLTQEIFPWIDFNITMATVQMVVKKYSGRAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICEKDIRHCALCAGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLT 5631
            +EDEYEIFKADPEAHCSSNAFLCTKCQPPDVAEETEQKKRVRLKRQCKDSGLKQYCERSVQRKTNEFIQKGEAAEEMLLEQHNVSDSAATGYNKGSMSLSQYDGHDDEDDEDKIGGNRGLMSVKDYEGLAMNSPSADMNQTSSTMFCSSESTGECDMDPLNLMDLEHQSVKVDIDVELENIEFESSRATKIGIFSRLNAPDFLSPKHLLMEALARICVKLSRYPSHSQLHKVYERFIGRIEDLTQEIFPWIDFNITMATVQMVVKKYSGRAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICEKDIRHCALCAGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQ++
Sbjct:   17 AEDEYEIFKADPEAHCSSNAFLCTKCQPPDVAEETEQKKRVRLKRQCKDSGLKQYCERSVQRKTNEFIQKGEAAEEMLLEQHNVSDSAATGYNKGSMSLSQYDGHDDEDDEDKIGGNRGLMSVKDYEGLAMNSPSADMNQTSSTMFCSSESTGECDMDPLNLMDLEHQSVKVDIDVELENIEFESSRATKIGIFSRLNAPDFLSPKHLLMEALARICVKLSRYPSHSQLHKVYERFIGRIEDLTQEIFPWIDFNITMATVQMVVKKYSGRAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICEKDIRHCALCAGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQVS 504          
BLAST of histone lysine N methyltransferase MLL-1 vs. TrEMBL
Match: L0H974 (Mll1/2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 383/385 (99.48%), Postives = 383/385 (99.48%), Query Frame = 1
Query: 6514 DPPVMLRLNKIQPQRLPPSIVKQLNINQNQSKPLTFIHLGQPINRISVKNPPMNNKIFKVMKVATSSSLSPATVGVGNXXXXXXXXXXXXXXKHPSLRIVTSRPPLSSSVLRTVLTDNSHSRRVVVHQQTQPALTIGTSKSSAYHISSCGSIITPSLAQFDGEGDDSSAVTFDEFRSILAAHPAHNVGSDQENASVITMATTTTVAGVKTRKQRANHDYKFCLRFTIHGFKGSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGM 7668
            DPPVMLRLNKIQPQRLPPSIVKQLNINQNQSKPLTFIHLGQPINRISVKNPPMNNKIFKVMKVATSSSLSPATVGVGNSSTSIPISPLTTATKHPSLRIVTSRPPLSSSVLRTVLTDNSHSRRVVVHQQTQPALTIGTSKSSAYHISSCGSIITPSLAQFDGEGDDSSAVTFDEFRSILAAHPAHNVGSDQENASVITMATTT VAGVKTRKQRANHDYKFCLRFTIHGFKGSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSP GCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAPLNADQLDDNPDPDEDYLRTLADQFRNLRNGM
Sbjct:    3 DPPVMLRLNKIQPQRLPPSIVKQLNINQNQSKPLTFIHLGQPINRISVKNPPMNNKIFKVMKVATSSSLSPATVGVGNSSTSIPISPLTTATKHPSLRIVTSRPPLSSSVLRTVLTDNSHSRRVVVHQQTQPALTIGTSKSSAYHISSCGSIITPSLAQFDGEGDDSSAVTFDEFRSILAAHPAHNVGSDQENASVITMATTTAVAGVKTRKQRANHDYKFCLRFTIHGFKGSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPRGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAPLNADQLDDNPDPDEDYLRTLADQFRNLRNGM 387          
BLAST of histone lysine N methyltransferase MLL-1 vs. TrEMBL
Match: A0A2T7P2D2 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12741 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 5.962e-66
Identity = 125/293 (42.66%), Postives = 176/293 (60.07%), Query Frame = 1
Query: 7222 KSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSK-SNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            +  W  + +R+   R +  + +      +G   FG+ H  V+YLVEQ+  A  C +Y F+ H+       ++ L  +++P GC R   +T  KP  I     +FL+S+   +P K H+    +    +          +A +FR L+   +   + V V  S IHGRGLF +R  DA E++IEY GE+IRS+L+D RE  Y+  G+ CYMFR+D   +VDAT  G+AARFINHSC PNCY+KV++ +G KHI+I A R I KGEELTYDY+FPIED K+PCTCGS  C+KYLN
Sbjct:  285 EEAWRQVTERVQDARAASRMKQLSYAGLNGVQMFGIGHEAVVYLVEQLQGARHCRHYTFR-HQQYEPPEEDEEL--IINPSGCARCEPFTTRKPYDI----FSFLNSRYRRHPSKVHSNREEEMEPKSSRRATSMELPMAMRFRKLQ---EHAKEAVGVYRSKIHGRGLFCKRNIDAGEMVIEYAGEIIRSLLTDKREKYYESKGIGCYMFRIDDCEVVDATMHGSAARFINHSCEPNCYSKVIQVDGRKHIVIFAMRPIKKGEELTYDYKFPIEDVKIPCTCGSKRCRKYLN 567          
BLAST of histone lysine N methyltransferase MLL-1 vs. TrEMBL
Match: A0A1E1XAP5 (Putative histone H3 lys4 methyltransferase complex subunit set1 (Fragment) OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 2.680e-65
Identity = 128/291 (43.99%), Postives = 172/291 (59.11%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLH-SKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
             W  + +++   R    +      + DG+A  GL H+ V+YL EQ+  A  C NY F++HK   TKL         +P GC R   + +++  H     LA  H S  +Y P N      + L  +          +A +FR+L+N      + V V  SNIHGRGL+ RR  D  E+IIEY GEVIR++L+D RE  Y+  G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY+KV+  + +KHI+I A R I KGEELTYDY+FPIED K+PC+CGS  C+K+LN
Sbjct:  453 AWRYLFEKLQDARAGANMPPLTNDDVDGFAMMGLTHKAVVYLTEQLRGADNCENYNFQYHKRNSTKLPE-------NPSGCARLEGF-RSRGHHDMFKFLASAHRSPPSYDPSNDNGDEVEVLHKSSRRLTSLDLPMAMRFRHLKN---TAKEAVGVYRSNIHGRGLYCRRNIDGGEMIIEYAGEVIRAVLTDKREKYYESKGIGCYMFRIDDHEVVDATMHGNAARFINHSCEPNCYSKVITVDNKKHIVIFALRSILKGEELTYDYKFPIEDVKIPCSCGSRRCRKFLN 732          
BLAST of histone lysine N methyltransferase MLL-1 vs. TrEMBL
Match: A0A2R5LN23 (Putative histone-lysine n-methyltransferase mll isoform x17 OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 6.690e-65
Identity = 129/296 (43.58%), Postives = 172/296 (58.11%), Query Frame = 1
Query: 7228 GWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRT------LADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
             W  + +++   R +  L    V + DG+A  GL H  V+YL+EQ+     C NY FKFHK    KL            GC R   +     DH   D   FL S+   PP+     ++   ++     +   R       +A +FR+L+       + V V  S+IHGRGL+ RR  DA E+IIEY GEVIR+ L+D RE  Y+  G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY+KV+  + +KHI+I AQR+I KGEELTYDY+FPIED K+PC+CGS  C+K+LN
Sbjct:  784 AWRYVFEKLQDSRAAANLQPLTVDDVDGYAMIGLVHNTVVYLIEQLPGTDNCINYTFKFHKKECVKLPENA-------SGCARLEWYRGRGEDH---DMFKFLASRHRLPPQYDPLASSQTTEEVEVVHKSSRRVTSLDLPMAMRFRHLKT---TAKEAVGVYRSSIHGRGLYCRRNIDAGEMIIEYAGEVIRAALTDKREKYYESKGIGCYMFRIDDTDVVDATMHGNAARFINHSCDPNCYSKVITVDNKKHIVIFAQRRILKGEELTYDYKFPIEDVKIPCSCGSRRCRKFLN 1066          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Cavefish
Match: kmt2bb (lysine (K)-specific methyltransferase 2Bb [Source:ZFIN;Acc:ZDB-GENE-080521-1])

HSP 1 Score: 219.55 bits (558), Expect = 2.676e-56
Identity = 126/314 (40.13%), Postives = 173/314 (55.10%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKN--HAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    + S +  W  ++  + + R +  L +      +G    GL H  V+YLVEQ+  A  C+ + F+FHK       +Q     ++P GC R   + +        D   FL S+    P    +     D L  +          +A +FR+L        + V V  S IHGRGLF +R  +A E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  EG+KHI+I A RKIY+GEELTYDY+FPIED  +KL C CG+  C+++LN
Sbjct: 3696 LRFKITSDDGFSVEADSIEVAWRAVLDGVQEARAAAKLRQLSFTGMNGARMMGLLHDAVVYLVEQLQGASSCHRHPFRFHKQA-----SQEEDLPINPSGCARSEVYLRKS----TFDMFNFLASQHRQLPDTDLYDEEEDDVLLKSSRRATSLELPMAMRFRHLER---TSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYSGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGQKHIVIFALRKIYRGEELTYDYKFPIEDASNKLGCNCGARRCRRFLN 3997          

HSP 2 Score: 116.316 bits (290), Expect = 4.539e-25
Identity = 75/227 (33.04%), Postives = 108/227 (47.58%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPK--SKEMFVCRNCTKCHSCDVYGSDLK----CIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKCQPPDVAE 4266
            GG  ++T+V   P  V C  C S G  ++++C  C EPFH FC++   RP+  +KE + CR C  C  C      LK    C +CQ  +HP C+    P  +  K +W C  C  C  CG           T   S + +W +D   C  C R    G+ C  C + Y+      + ++C+SCN  VH +C GL++D YEI  + PE+   S    C + QP  V E
Sbjct: 1716 GGMSILTSVPLMPQSV-CLLCASRGQHEMLYCQVCCEPFHPFCLDPSERPQEENKENWCCRRCKFCRVCGRKNKPLKPLLECERCQNCYHPACLGPNYPKPNRRKRSWVCMTCIRCKSCGV----------TPGKSWDTEWDQDKGLCPDCTRLYEQGNYCTMCFKCYEDNDYESQMMQCSSCNHWVHAKCEGLTDDLYEILSSLPESVVYS-CQPCIEAQPAGVQE 1930          

HSP 3 Score: 116.316 bits (290), Expect = 5.019e-25
Identity = 68/214 (31.78%), Postives = 118/214 (55.14%), Query Frame = 1
Query: 5218 SEFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWS 5847
            S+ ++   + D R C LC   GD +    GRL+Y G + W HVNC++WS +V+E ++G L++V  A+ +G    C  C + GAT+ C        C +SC + YHF CA +   + VF + +T +C + H + ++   +T     +LRR+Y+       +S+      G+  ++I + IG+L ++ +GK++E S   +  L P+GY+  R +WS
Sbjct: 2152 SDLDTGWSKDDERQCVLCQKYGDAKSADAGRLLYLGQNEWAHVNCSMWSAEVFEEDNGCLMHVHSAVARGRLMRCERCNQTGATVGC--------CLTSCQSNYHFMCARSR--NCVFQDDKTVFCYK-HRDLISGQIITGQGFEVLRRVYV---DFEGISLRRKFLTGLEPESINMKIGSLLVSKLGKLNELSAS-QGKLVPVGYECSRWYWS 2350          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Cavefish
Match: ENSAMXT00000056389.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:23791729:23793332:-1 gene:ENSAMXG00000030713.1 transcript:ENSAMXT00000056389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 1.795e-45
Identity = 73/116 (62.93%), Postives = 92/116 (79.31%), Query Frame = 1
Query: 7756 IIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            ++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++VV  +G+KHI+I A RKIY+GEELTYDY+FPIE+  +KLPC CG+  C+K+LN
Sbjct:    1 MVIEYSGNVIRSVLTDKREKYYDGKGIGCYMFRIDDYEVVDATMHGNAARFINHSCEPNCYSRVVNIDGQKHIVIFAMRKIYRGEELTYDYKFPIEEPGNKLPCNCGAKKCRKFLN 116          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Cavefish
Match: ENSAMXT00000040628.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000250.1:95310:97223:1 gene:ENSAMXG00000030555.1 transcript:ENSAMXT00000040628.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 1.585e-43
Identity = 71/116 (61.21%), Postives = 89/116 (76.72%), Query Frame = 1
Query: 7756 IIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            ++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  EG KHI+I A RKIY+GEELTYDY+FPIED  +KL C C +  C+++LN
Sbjct:    1 MVIEYAGNVIRSVLTDKREKYYDSKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGRKHIVIFALRKIYRGEELTYDYKFPIEDASNKLHCNCSARRCRRFLN 116          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Cavefish
Match: setd1ba (SET domain containing 1B, histone lysine methyltransferase [Source:NCBI gene;Acc:103032383])

HSP 1 Score: 173.326 bits (438), Expect = 1.891e-42
Identity = 77/147 (52.38%), Postives = 105/147 (71.43%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            N +  R K +R C S+IH  GLFA     A E++IEYVG+ IR +++D+RE  Y+  G+   YMFR+D D I+DAT  GN ARFINHSC+PNCYAKV+  E +K I+I +++ I   EE+TYDY+FPIED+K+PC CG+ +C+  LN
Sbjct: 1703 NQLKFRKKKIRFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEEEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN 1849          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Cavefish
Match: ENSAMXT00000041567.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001314.1:1300751:1307385:-1 gene:ENSAMXG00000036494.1 transcript:ENSAMXT00000041567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 1.222e-41
Identity = 98/321 (30.53%), Postives = 164/321 (51.09%), Query Frame = 1
Query: 7171 KFCLRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLME-YPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKT-----VRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDD--KLPCTCGSFSCKKYLN 8097
            +F +R    G++       SPK  W  +++ +   R   G+++ +PV    G   FGL    V  +VE +     C+ Y F++ +  + +L        ++P GC R              +P A  H K  +   + + +   Q +     +   +   + QF + ++    R K      V +  S I G GL+A R  +   ++IEY+G +IR+ +++ +E  Y+      YMFR+D + ++DAT  G  AR+INHSC PNC A+VV FE +  I+I + R+I +GEEL YDY+F +EDD  K+PC CG+ +C+K++N
Sbjct:   45 EFSIRVIEQGYEDLLLTGSSPKGVWDKVLEPVADRRNETGILKLFPVYL-KGEDLFGLTVPAVTRIVESLPGVEACSRYTFRYGRNPLMEL-----PLAINPSGCAR-------------SEPKALTHVKRPHTLTSGSTIKTLQTNGGSPAELTGV-PYSKQFVHSKSSQYRRMKAEWKSNVYLARSRIQGLGLYAARDIEKDTLVIEYIGTIIRNEVANRKEKMYESQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCIAEVVTFEKDHKIMITSNRRIQRGEELCYDYKFDLEDDQHKIPCHCGAVNCRKWMN 345          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Sea Lamprey
Match: setd1a (SET domain containing 1A, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-080521-4])

HSP 1 Score: 162.54 bits (410), Expect = 8.505e-40
Identity = 74/147 (50.34%), Postives = 102/147 (69.39%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            N +  R K +R   S IH  GLFA     A E++IEYVG+ IR +++D+RE  Y+  G+   Y+FR+D D I+DAT  GN ARFINHSC+PNCYAKV+  E +K I+I +++ I   EE+TYDY+FPIE++K+PC CG+  C+  LN
Sbjct: 1708 NQLKFRKKKLRFTKSRIHEWGLFALEPIAAEEMVIEYVGQGIRQLVADMREKRYEVEGIGSSYLFRVDHDTIIDATKVGNLARFINHSCNPNCYAKVITVESQKRIVIYSKQAINVNEEITYDYKFPIEENKIPCLCGAEHCRGTLN 1854          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010827.1 (pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 gene:ENSPMAG00000009809.1 transcript:ENSPMAT00000010827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 2.467e-39
Identity = 66/132 (50.00%), Postives = 94/132 (71.21%), Query Frame = 1
Query: 7711 HGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKH-IIIIAQRKIYKGEELTYDYRFPIEDD--KLPCTCGSFSCKKYLN 8097
             G GL+A R  + H ++IEY+G +IR+ +++ RE  Y+      YMFR+D D ++DAT  G  AR+INHSC PNC A+VV F+ E+  IIII+ R++ KGEELTYDY+F  EDD  K+PC CG+ +C+K++N
Sbjct:    5 QGLGLYAARDIEKHTMVIEYIGTIIRNEVANRREALYKAQNRGVYMFRIDGDHVIDATLTGGPARYINHSCSPNCVAEVVNFDKERSKIIIISSRRLQKGEELTYDYKFDFEDDQHKIPCHCGAPNCRKWMN 136          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002322.1 (pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 gene:ENSPMAG00000002099.1 transcript:ENSPMAT00000002322.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.614 bits (405), Expect = 4.480e-39
Identity = 101/320 (31.56%), Postives = 163/320 (50.94%), Query Frame = 1
Query: 7171 KFCLRFTIHGFK----GSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKT-----VRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDD--KLPCTCGSFSCKKYLN 8097
            +F +R    G +     + +P+  W  I++ + ++RK   ++        G   FGL  + V+ + E +     C NY F++ +  + +L        V+P GC R      T+P             +S++   +    +++          +     + QF   ++    R KT     V +  S I G GL+A R  + H ++IEY+GE+IR+ +++  E  Y+ T    YMFRLD + ++DAT  G  AR+INHSC PNC A++V F+ E  III + R+I KGEELTYDY F  EDD  K+PC CG+ +C+K++N
Sbjct: 3625 QFTVRIVEQGHEDLVHAASTPQGVWDKILEPVVRLRKGAEMLRLFPDYMRGEEMFGLTVQAVLRITESLPGVECCQNYMFRYGRHPLMEL-----PLAVNPSGCAR------TEP-----------RLRSHFKRPHTLNSSSNSKSFQSTMSGELSAPYSKQFVYSKSSQYRRMKTEWKINVYLARSRIQGLGLYASRDIEKHTMVIEYIGEIIRNEVANRHEKLYESTNRGVYMFRLDSEHVIDATITGGPARYINHSCAPNCVAELVTFDRENKIIISSCRRIQKGEELTYDYLFDFEDDQNKIPCHCGAINCRKWMN 3922          

HSP 2 Score: 127.872 bits (320), Expect = 2.901e-29
Identity = 80/223 (35.87%), Postives = 114/223 (51.12%), Query Frame = 1
Query: 5248 DIRHCALCAGSGDDRLEG--RLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI---DECSDYL--RVYLCPIGYQARRLFWSMYELDSLVMYYMNVTK 5895
            D+R C+ C   GD   +G  RL+   LD+WVH+NCALWS +VYE + GAL+NV+ A R+G    C AC + GAT  C+ P         CPNVYHFACA  M    +F + +T  C        T  +L      +LRR+Y+ +  +  ++     G         +G+L  + +G+I      S Y   R  L PIGYQA RL+WS    +    Y  +V++
Sbjct: 3410 DMRSCSFCHLQGDGATDGPARLLNLDLDIWVHLNCALWSSEVYETQAGALINVEGARRRGLGTKCGACLRMGATTSCNRP--------RCPNVYHFACALRM--RCMFFKDKTVLCPAHRPRSSTGQELGC--FAVLRRVYVQRDEVRQLASLVRRGPMGGG-TFRVGSLLFHALGQILPGQASSPYFHSRTALYPIGYQATRLYWSTRYTNKRCRYLCSVSE 3619          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002229.1 (pep scaffold:Pmarinus_7.0:GL477110:4214:18323:-1 gene:ENSPMAG00000002027.1 transcript:ENSPMAT00000002229.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 4.586e-23
Identity = 64/197 (32.49%), Postives = 101/197 (51.27%), Query Frame = 1
Query: 5299 GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNV 5889
            GRL+  G D W H NCA+WS +V+E +DG+L NV  A+ +G++  C  C + GAT+ C  P        +C   +HF CA       VF + +  YC + H + +    +      +LRR+++    +  +      G+  D I + IG+L I C+G +++ S Y    L PIGYQ  R++WS  +   L +Y   V
Sbjct:  350 GRLLGIGQDEWTHSNCAVWSAEVFEDDDGSLKNVHAAVWRGKQLRCEHCGRMGATVGCCLP--------ACQANFHFMCA--RARSCVFQDDKKLYC-QRHKDLIRGEVVAEDGFEVLRRVFVDFEGIG-LRRKFLSGLEPDKIQMMIGSLTIECLGVLNDLSLY-EGKLFPIGYQCTRVYWSTADARRLCVYTCKV 533          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004922.1 (pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 gene:ENSPMAG00000004401.1 transcript:ENSPMAT00000004922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 7.031e-20
Identity = 50/115 (43.48%), Postives = 67/115 (58.26%), Query Frame = 1
Query: 7702 SNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED 8046
            S++ G G+F +     +E I EY GE+I    +D R   Y +     ++F L+ D +VDAT KGN  RF NHS  PNCYAKV+   G+  I I A+R I  GEEL +DYR+   D
Sbjct:  656 SDVAGWGIFIKVPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCS-FLFNLNNDFVVDATRKGNKIRFANHSVSPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQAD 769          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Yeast
Match: SET1 (Histone methyltransferase, subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3K4; Set1p-dependent H3K4 trimethylation recruits Nrd1p, allowing efficient termination of snoRNAs and cryptic unstable transcripts (CUTs) by Nrd1p-Nab3p-Sen1p pathway; modulates histone acetylation levels in promoter proximal regions to ensure efficient Nrd1p-dependent termination; required in transcriptional silencing near telomeres and at silent mating type loci; has a SET domain [Source:SGD;Acc:S000001161])

HSP 1 Score: 145.976 bits (367), Expect = 3.373e-35
Identity = 71/150 (47.33%), Postives = 97/150 (64.67%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDD---KLPCTCGSFSCKKYLN 8097
            N ++ R K V    S IH  GL+A     A E+IIEYVGE IR  ++++RE  Y + G+   Y+FR+D++ ++DAT KG  ARFINH C PNC AK+++  G + I+I A R I   EELTYDY+F  E D   +LPC CG+ +CK +LN
Sbjct:  931 NQLNKRKKPVMFARSAIHNWGLYALDSIAAKEMIIEYVGERIRQPVAEMREKRYLKNGIGSSYLFRVDENTVIDATKKGGIARFINHCCDPNCTAKIIKVGGRRRIVIYALRDIAASEELTYDYKFEREKDDEERLPCLCGAPNCKGFLN 1080          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Yeast
Match: SET2 (Histone methyltransferase with a role in transcriptional elongation; methylates H3 lysine 36 (H3K36), which suppresses incorporation of acetylated histones and signals for the deacetylation of these histones within transcribed genes; associates with the C-terminal domain(CTD) of Rpo21p; H3K36me3 (trimethylation) requires Spt6p, proline 38 on H3, CTD of Rpo21p, Ctk1p, and C-terminal SRI domain of Ste2p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003704])

HSP 1 Score: 78.5666 bits (192), Expect = 1.011e-14
Identity = 51/131 (38.93%), Postives = 69/131 (52.67%), Query Frame = 1
Query: 7714 GRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEY-QRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDY---RFPIEDDKLPCTCGSFSCKKYL 8094
            G G+ A +  +A++ I EY GEVI  +    R  +Y QR     Y   L     +DAT KG+ ARF NHSC PN Y      + +  + I AQRKI KGEE+T+DY   R+  +  K  C C   +C  +L
Sbjct:  131 GYGVRAEQDIEANQFIYEYKGEVIEEMEFRDRLIDYDQRHFKHFYFMMLQNGEFIDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQRKILKGEEITFDYNVDRYGAQAQK--CYCEEPNCIGFL 259          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Nematostella
Match: EDO30858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK6])

HSP 1 Score: 206.453 bits (524), Expect = 6.298e-59
Identity = 126/319 (39.50%), Postives = 171/319 (53.61%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDH--IARDPLAFLHSKSNYPPK---NHAXXXXXXXXXXXXXXXXXXRTL----ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            +RF I    G    + S K  W +I   +   R S  L + P          G+    V Y++EQ+  A    NY F+++    T   +  L    +P GC R      T+P H  +  D  AFL S+   PP+   N+  L A +             TL    A ++R+L+   +    T+ V  S IHGRGL+  R   A E++IEY G +IRS L+D RE  Y+  G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++VV  +G K I+I A + I +GEELTYDY+FP+ED+KLPC C S  C+KYLN
Sbjct:    4 IRFVITNDDGLRIEADSHKVAWRMIFDLVRDSRSSHLLKDLPFIGVSDRCMIGVTDEPVTYILEQLADAHLLRNYRFQYNPPFGTNGEDG-LELKENPTGCCR------TEPHHRRLMYDMFAFLASEYRTPPQLDDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQN-NYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLPCHCKSKRCRKYLN 314          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Nematostella
Match: EDO30857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK5])

HSP 1 Score: 199.519 bits (506), Expect = 7.425e-57
Identity = 119/296 (40.20%), Postives = 162/296 (54.73%), Query Frame = 1
Query: 7237 LIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDH--IARDPLAFLHSKSNYPPK---NHAXXXXXXXXXXXXXXXXXXRTL----ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            +I   +   R S  L + P          G+    V Y++EQ+  A    NY F+++    T   +  L    +P GC R      T+P H  +  D  AFL S+   PP+   N+  L A +             TL    A ++R+L+   +    T+ V  S IHGRGL+  R   A E++IEY G +IRS L+D RE  Y+  G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++VV  +G K I+I A + I +GEELTYDY+FP+ED+KLPC C S  C+KYLN
Sbjct:    1 MIFDLVRDSRSSHLLKDLPFIGVSDRCMIGVTDEPVTYILEQLADAHLLRNYRFQYNPPFGTNGEDG-LELKENPTGCCR------TEPHHRRLMYDMFAFLASEYRTPPQLDDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQN-NYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLPCHCKSKRCRKYLN 288          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Nematostella
Match: EDO31259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYF5])

HSP 1 Score: 196.823 bits (499), Expect = 1.257e-55
Identity = 124/319 (38.87%), Postives = 168/319 (52.66%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHG-CVR-FNQWTKTKPDHIARDPLAFLHSKSNYPPK---NHAXXXXXXXXXXXXXXXXXXRTL----ADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            +RF I    G    + S K  W +I   +   R S  L + P          G+    V Y++EQ+  A    NY F+++    T        D ++P   CV  F  + K        D  AFL S+   PP+   N+  L A +             TL    A ++R+L+   +    T+ V  S IHGRGL+  R   A E++IEY G +IRS L+D RE  Y+  G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++VV  +G K I+I A + I +GEELTYDY+FP+ED+KLPC C S  C+KYLN
Sbjct:    4 IRFVITNDDGLRIEADSHKVAWRMIFDLVRDSRSSHLLKDLPFIGVSDRCMIGVTDEPVTYILEQLADAHLLRNYRFQYNPPFGTNGE-----DGLTPETYCVNAFCGYRKK-----MYDMFAFLASEYRTPPQLDDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQN-NYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLPCHCKSKRCRKYLN 311          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Nematostella
Match: EDO44546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVC2])

HSP 1 Score: 159.458 bits (402), Expect = 5.733e-44
Identity = 77/147 (52.38%), Postives = 99/147 (67.35%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            N +  R K ++   S+IH  GLFA     A E++IEYVGEVIR  ++D RE  Y+  G+   YMFRLD+  I+DAT  GN ARFINH C PNCYAKV+  E  K I+I ++R I   EE+TYDY+FPIED+K+PC CG+  C+  LN
Sbjct:   67 NKLRVRKKQLKFAKSSIHDWGLFALEPIAADEMVIEYVGEVIRQAIADYRERCYEERGIGSSYMFRLDETTIIDATTMGNFARFINHCCDPNCYAKVIAVENMKKIVIYSKRDIQVDEEITYDYKFPIEDEKIPCLCGAPQCRGTLN 213          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Nematostella
Match: EDO37589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA7])

HSP 1 Score: 152.91 bits (385), Expect = 5.711e-39
Identity = 107/315 (33.97%), Postives = 164/315 (52.06%), Query Frame = 1
Query: 7174 FCLRFTIHG-----FKGSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDD--KLPCTCGSFSCKKYLN 8097
            F LR    G     FKG KSP+  W  +++ I ++RK   L+        G   FGL  + V+ ++E M        Y  ++  + + ++        ++P GC R     KT   H        + S S          + +  +      + ++ + A Q+R L+       + V +  SNI G GLFA R  +   ++IEY+G +IR+ +++ +E+ Y+      YMFR+D D ++DAT  G  AR+INHSC PNC A+VV FE E+ IIII+ RKI KGEELTYDY+F  EDD  K+ C CG+ +C+K++N
Sbjct:  163 FTLRVNEQGHEDTVFKG-KSPRDVWKQVLEPIHKLRKEAVLVNLWPAYITGEDLFGLTEQFVLRIIESMPGVDYMQGYNMRYGPSSIMEM-----PLAINPTGCARAEALIKT---HFR--STRSVSSISTAGSNAAGNSSREAEESTSLYMKQFVYSKASQYRKLKTEW---RQNVFLGRSNIQGLGLFANRDMEPGCMVIEYIGSIIRNEVANKKESIYESQNRGIYMFRIDSDSVIDATIAGGPARYINHSCMPNCVAEVVTFEKEQKIIIISSRKIEKGEELTYDYKFDFEDDEHKISCLCGAPNCRKWMN 463          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Medaka
Match: KMT2A (lysine methyltransferase 2A [Source:NCBI gene;Acc:101171020])

HSP 1 Score: 219.55 bits (558), Expect = 2.788e-56
Identity = 119/302 (39.40%), Postives = 168/302 (55.63%), Query Frame = 1
Query: 7210 SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIAR---DPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXR-TLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            S+S +  W  +  ++ + R    L +      +G    G+ H  V++L+EQ+  +  C +Y F+FHK   ++         ++PHG  R          H  R   D   FL SK   PP+       +            +   LA +F+ L+       +TV V  S IHGRGLF ++  +A E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A R+I  GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 3881 SESIEDAWKCLTDKVKEARSHARLSDLSFDGVNGLRMLGIVHEAVVFLLEQLCGSKHCRSYSFRFHKPEESE------DPPLNPHGSARAEI-------HHRRSVFDMFNFLASKHRQPPEYRPQEEEEDEGQLRIIRRASMELPLAVRFKQLKA---MSKETVGVYRSPIHGRGLFCKKTIEAGEMVIEYSGNVIRSVLTDKREKYYDAKGIGCYMFRIDDYEVVDATVHGNAARFINHSCEPNCYSRVLTVDGQKHIVIFASRRICCGEELTYDYKFPIEDASNKLPCNCGTKKCRKFLN 4166          

HSP 2 Score: 129.028 bits (323), Expect = 6.310e-29
Identity = 77/215 (35.81%), Postives = 115/215 (53.49%), Query Frame = 1
Query: 5248 DIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLT---LVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            D R C  C   GD+++   GRL+Y G + W HVNCALWS +V+E +D +L NV +A+ +G+K  C  CQK GAT+ C        C +SC   YHF CA        F E +  YC + H + V+  ++T   LVDM         +G   N       G+  +++ + IG+++I+C+G + E SD  R  L P+GYQ  R++WS  +     +Y
Sbjct: 2048 DNRKCVFCFKYGDEKINECGRLLYIGQNEWTHVNCALWSAEVFEDDDASLKNVHMAVLRGKKMCCERCQKTGATVSC--------CFTSCTRNYHFMCARQC--QCTFLEDKKIYCPK-HRDVVSGFEVTRRILVDM---------EGI--NFKRKFLAGLEPESVHMMIGSMKIDCLGILTELSDCKR-KLFPLGYQCSRVYWSTLDARKRCVY 2239          

HSP 3 Score: 97.0561 bits (240), Expect = 3.336e-19
Identity = 67/224 (29.91%), Postives = 101/224 (45.09%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSK--EMFVCRNCTKCHSCDVYGSDLK-----CIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQ-----AGLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +VLC+ C S G+ + ++C  C EPFH FC+    RP  +  E + CR C  C +C       K     C KC+  +HP C+   YP   +  K  W C KC  C  CGA              S +  WS D   C  CA+    G+ CP C ++Y      + +      + + + +  C  LS++ +E+    PE    + A+ C KC
Sbjct: 1589 GGLSLLTSVPITP-RVLCFLCASSGNVEFVYCRVCCEPFHLFCLGESERPLQEQFENWCCRLCRFCQACGRQHQKAKQQLVECDKCRNSYHPECLGPNYPTKPTKKKRIWICTKCVRCKSCGATKPGK---------SWDAQWSHDFSMCHDCAKLFAKGNFCPLCDKSYSDDYYDSKMMEFYSITWHMVANLSCYCLSDEMFELLSKLPE----NIAYTCMKC 1798          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Medaka
Match: KMT2A (lysine methyltransferase 2A [Source:NCBI gene;Acc:101171020])

HSP 1 Score: 219.55 bits (558), Expect = 3.087e-56
Identity = 119/302 (39.40%), Postives = 168/302 (55.63%), Query Frame = 1
Query: 7210 SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIAR---DPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXR-TLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            S+S +  W  +  ++ + R    L +      +G    G+ H  V++L+EQ+  +  C +Y F+FHK   ++         ++PHG  R          H  R   D   FL SK   PP+       +            +   LA +F+ L+       +TV V  S IHGRGLF ++  +A E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  +G+KHI+I A R+I  GEELTYDY+FPIED  +KLPC CG+  C+K+LN
Sbjct: 4254 SESIEDAWKCLTDKVKEARSHARLSDLSFDGVNGLRMLGIVHEAVVFLLEQLCGSKHCRSYSFRFHKPEESE------DPPLNPHGSARAEI-------HHRRSVFDMFNFLASKHRQPPEYRPQEEEEDEGQLRIIRRASMELPLAVRFKQLKA---MSKETVGVYRSPIHGRGLFCKKTIEAGEMVIEYSGNVIRSVLTDKREKYYDAKGIGCYMFRIDDYEVVDATVHGNAARFINHSCEPNCYSRVLTVDGQKHIVIFASRRICCGEELTYDYKFPIEDASNKLPCNCGTKKCRKFLN 4539          

HSP 2 Score: 128.257 bits (321), Expect = 1.315e-28
Identity = 74/212 (34.91%), Postives = 112/212 (52.83%), Query Frame = 1
Query: 5248 DIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            D R C  C   GD+++   GRL+Y G + W HVNCALWS +V+E +D +L NV +A+ +G+K  C  CQK GAT+ C        C +SC   YHF CA        F E +  YC +  D    +V   +    + RRI +    + N       G+  +++ + IG+++I+C+G + E SD  R  L P+GYQ  R++WS  +     +Y
Sbjct: 2118 DNRKCVFCFKYGDEKINECGRLLYIGQNEWTHVNCALWSAEVFEDDDASLKNVHMAVLRGKKMCCERCQKTGATVSC--------CFTSCTRNYHFMCARQC--QCTFLEDKKIYCPKHRDVIRGEV---VSGFEVTRRILVDMEGI-NFKRKFLAGLEPESVHMMIGSMKIDCLGILTELSDCKR-KLFPLGYQCSRVYWSTLDARKRCVY 2314          

HSP 3 Score: 110.923 bits (276), Expect = 1.964e-23
Identity = 70/222 (31.53%), Postives = 104/222 (46.85%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRPKSK--EMFVCRNCTKCHSCDVYGSDLK-----CIKCQLGFHPTCV-DKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAGL---ETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKC 4245
            GG  ++T+V   P +VLC+ C S G+ + ++C  C EPFH FC+    RP  +  E + CR C  C +C       K     C KC+  +HP C+   YP   +  K  W C KC  C  CGA              S +  WS D   C  CA+    G+ CP C ++Y       + +EC  C + VH +C  ++++ +E+    PE    + A+ C KC
Sbjct: 1661 GGLSLLTSVPITP-RVLCFLCASSGNVEFVYCRVCCEPFHLFCLGESERPLQEQFENWCCRLCRFCQACGRQHQKAKQQLVECDKCRNSYHPECLGPNYPTKPTKKKRIWICTKCVRCKSCGATKPGK---------SWDAQWSHDFSMCHDCAKLFAKGNFCPLCDKSYSDDYYDSKMMECARCKQWVHAKCENITDEMFELLSKLPE----NIAYTCMKC 1868          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Medaka
Match: kmt2ba (histone-lysine N-methyltransferase 2B [Source:NCBI gene;Acc:101157226])

HSP 1 Score: 213.001 bits (541), Expect = 2.358e-54
Identity = 129/329 (39.21%), Postives = 180/329 (54.71%), Query Frame = 1
Query: 7138 KTRKQRANHDYKFCLRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRT---LADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDD--KLPCTCGSFSCKKYLN 8097
            K RK   N  +   LRF I    G    + S +  W  ++  + + R +  L + P+    G    G+ H  VI+L+EQ+  A  C  + F+FH  R   L  +     ++  GC R   +T+        D   FL S+    P    P + D+ +           T   +A +FR+L        + V V  S IHGRGLF +R  +A E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT +GNAARFINHSC PNCY++V+  +G KHI+I A RKIY+GEELTYDY+FPIED+  KL C CG+  C+++LN
Sbjct: 2454 KHRKTYMNQPH---LRFEITSEDGFSVKANSIEVAWRAVIDGVFEARAAFHLKQLPLGVMSGPRVLGVVHDAVIFLLEQLQGAADCKRHRFRFH--RCDALEEE---PPLNASGCARAEVYTR----KATFDMFNFLASQHRQLPDLVGPFDEDEDEFPLKASRRATSTELPMAMRFRHLEK---TSKEAVGVYRSLIHGRGLFCKRNIEAGEMVIEYAGTVIRSVLTDKREKFYDGKGIGCYMFRIDDFDVVDATMQGNAARFINHSCEPNCYSRVINVDGRKHIVIFALRKIYRGEELTYDYKFPIEDEDNKLHCNCGTRRCRRFLN 2767          

HSP 2 Score: 117.472 bits (293), Expect = 2.243e-25
Identity = 97/330 (29.39%), Postives = 149/330 (45.15%), Query Frame = 1
Query: 4981 KLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGR-EEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVA------------FPSEFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTKELNNKANGDD 5925
            KL  QA A  V+  + R F  F +   +     S  F  G   + ++  S++H  A  + +E  Y A        +               P   + +   +D+R C LC   GD      GRL+Y G + W HVNC LWS +VYE ++GAL+ V  A+ +G    C  C + GAT+ C        C ++C + +HF CA       VF   R  YC    D   T V ++     + RR+Y+    + N+      G+  + I +TIG+L+I  +G + E S   R+ L P+GYQ  RL+WS  +      Y   VT E++    G++
Sbjct: 1252 KLTTQARAHYVQ-VMKRVFSWFPACYFKKWSSFSEEFPTGMLPDAVLPPSQEHSYA--QWLERTYQAKEPRAPQSDGGPPPGRARSSPHVLPLHQHESTKTRDVRQCVLCQQYGDSPTSDAGRLLYLGQNEWAHVNCCLWSAEVYE-QNGALLQVHSAVSRGRHLRCDRCGQSGATVGC--------CLATCQSNFHFMCA--RAESCVFQADRKVYCCMHRDLVSTKV-VSGAAFEVHRRMYVDFDGI-NLRRKFLTGLEPETITMTIGSLQIQKLGVLSELSSNGRM-LYPVGYQCSRLYWSTVDPRRRCKYTCKVT-EVSTPLPGEE 1563          

HSP 3 Score: 105.145 bits (261), Expect = 1.235e-21
Identity = 68/221 (30.77%), Postives = 100/221 (45.25%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGG-DQLIHCVSCAEPFHFFCIEYQFRPK--SKEMFVCRNCTKCHSCDVYGSD----LKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKCQ 4248
            GG  ++T++   P  V C  C S G  ++I C  C EPFH FC+  +  P+  SKE + CR C  CH C          L+C +CQ  +HP+C+    P   +    W C  C  C  CG           T   + ++ W+ +   C  C      GH C  C + Y+ G   L+ I+C+ C   +H +C GLSE+   +    P+    S  F CT C+
Sbjct:  950 GGLSILTSIPTTPLPV-CLLCASKGRHEMIFCQICCEPFHSFCLTPEECPQEDSKENWCCRRCKFCHVCGRRSKSAKPVLQCRRCQTCYHPSCLGPTYPKPVNCSLPWVCMTCIRCKSCGV----------TPGKTWDLAWNHEQDLCPECTILNKKGHFCTVCQKCYEDGSRPLQMIQCSECRHWIHPKCEGLSEELCGLMSTLPD----SGGFTCTPCR 1155          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Medaka
Match: kmt2bb (lysine methyltransferase 2B [Source:NCBI gene;Acc:101174945])

HSP 1 Score: 207.223 bits (526), Expect = 1.592e-52
Identity = 124/316 (39.24%), Postives = 170/316 (53.80%), Query Frame = 1
Query: 7180 LRFTIHGFKG----SKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLAD--VVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPK--NHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED--DKLPCTCGSFSCKKYLN 8097
            LRF I    G    + S +  W  ++  + + R    L     +   G    GL H  V++L+EQ+  A +C  + F+F K        Q   D   V+P+GC R   + +        D   FL S+    P    +     + L  +          +A +FR+L        + V V  S IHGRGLF +R  +A E++IEY G VIRS+L+D RE  Y   G+ CYMFR+D   +VDAT  GNAARFINHSC PNCY++V+  EG KHI+I A RKIY+GEELTYDY+FPIED  +KL C CG+  C+++LN
Sbjct: 3497 LRFEITSEDGFSVEADSIEVAWKAVIDGVQEARAIAKLRPLTFQRVTGAGMLGLVHDTVVFLLEQLEGAHRCQKHTFRFFK-------QQSPDDDLPVNPNGCARSELYLRKS----TFDMFNFLASQHRQLPDIGPYDDEEDEVLLKSTRRATSLELPMAMRFRHLER---TSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYAGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGRKHIVIFALRKIYRGEELTYDYKFPIEDASNKLNCNCGARRCRRFLN 3798          

HSP 2 Score: 117.857 bits (294), Expect = 1.479e-25
Identity = 67/208 (32.21%), Postives = 104/208 (50.00%), Query Frame = 1
Query: 3616 GGFPVITTVNAQPNKVLCYSCGSGGD-QLIHCVSCAEPFHFFCIEYQFRP--KSKEMFVCRNCTKCHSC----DVYGSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAG---LETIECNSCNRMVHRQCCGLSEDEYEIFKADPEA 4209
            GG  ++++    P  V C+ C S G  +++HC  C EPFH FC+E   RP  ++KE + CR C  CH C     +    L+C +CQ  +H +C+    P  +  +  W C +C  C  CG           T   S EIDW+ D   C  C++    G+ CP C + Y+      + ++C +CN  VH +C  L+++ YEI  + PE+
Sbjct: 1724 GGLSILSSAPVMPPYV-CFLCASKGQHEMLHCQVCCEPFHRFCLEPAERPSEENKENWCCRRCKFCHVCGKKNQLTKPLLECERCQNCYHASCLGPNYPKLNKKRKAWVCMRCIRCKSCGV----------TPGKSWEIDWNHDKGLCPDCSKLYEQGNYCPICFKCYEDNDYDSQMMQCGTCNHWVHAKCEDLTDELYEILSSLPES 1920          

HSP 3 Score: 115.546 bits (288), Expect = 9.362e-25
Identity = 70/214 (32.71%), Postives = 117/214 (54.67%), Query Frame = 1
Query: 5218 SEFNSTICEKDIRHCALCAGSGDDRLE--GRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSM--ACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWS 5847
            ++F++   + D R C+LC   GD + +  GRL+Y G + W HVNC LWS +V+E ++G+L++V  A+ +G    C  C K GAT+ C        C +SC + YHF CA +     VF + +  YC + H + ++   +T  +  + RR+Y+       +S+      G+  + I V IG+L+I+ +G + E S   +  L P+G+Q  R +WS
Sbjct: 2147 ADFDTGWSKDDERQCSLCQKYGDLKPDEAGRLLYLGQNEWAHVNCCLWSAEVFEEDNGSLLHVHSAVTRGRLMRCERCNKTGATVGC--------CLTSCQSNYHFMCARSR--QCVFQDDKKVYCYK-HRHLISGRMITGQEFEVNRRVYV---DFEGISLRRKFLTGLEPEFINVMIGSLQIDKLGVLSELSAS-KGKLFPVGFQCFRWYWS 2345          
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Medaka
Match: setd1ba (SET domain containing 1B, histone lysine methyltransferase [Source:NCBI gene;Acc:101162384])

HSP 1 Score: 174.481 bits (441), Expect = 8.763e-43
Identity = 78/147 (53.06%), Postives = 105/147 (71.43%), Query Frame = 1
Query: 7660 NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            N +  R K +R C SNIH  GLFA     A E++IEYVG+ IR +++D+RE  Y+  G+   YMFR+D D I+DAT  GN ARFINHSC+PNCYAKV+  E +K I+I +++ I   EE+TYDY+FPIED+K+PC CG+ +C+  LN
Sbjct: 1599 NQLKFRKKKIRFCKSNIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEEEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN 1745          
BLAST of histone lysine N methyltransferase MLL-1 vs. Planmine SMEST
Match: SMESG000027630.1 (SMESG000027630.1)

HSP 1 Score: 5103.88 bits (13238), Expect = 0.000e+0
Identity = 2667/2674 (99.74%), Postives = 2669/2674 (99.81%), Query Frame = 1
Query:   79 MGRNKNRNKLQLKSPSQLXXXXXXXXXXXXXXXMYDNENNFESSEXXXXXXXXXXXXXEIQNINESVLIWSNEDVIDENRSKSFHXXXXXXXXXXXXXXXXXXXYLKSQLKDINTIHLSAISGVLMKNEMESDKSSVILNEIPNNNYLKIETKKQSVDNKNSFELPEEIENVDANRRQVSLQETCASPNEPVVRRSGRSAKINYKDMLNIHIYEPVRLTDDWHSPKRKHKVKREPSRPSIRQSTSDNSEVDNRSPERKLIEQKVEFTESEEEKHEGKCTIEYEAQTGYEIKEKEEDKPSQFEIEEERQKHQGVDSDNSHKPNHYQVEENKSNIKRKAFRKPTKDLSRNCIMCSKAVMGSRKFDNLCYNCVVAATKIITRLKLCNNDTRPIVCLGDCGCWERMTDFAERTDILPCDACKIQQLMASGLQWGEQLQWMRTVTLDELRSHEAVQRSRQLQVDQGQAWLNQLTGIEHFGSCLLPDTDLTHAYKWDIRYLVPLGPDGKARCQFCALSHDSDVERSPILEQLYTILPLKETTICQHCLMMAHNAIRNSGLPADGLLQQIRSICPLEPLRYRYFDGAANPDGLCEICMRKDNSVMSRLRSGNLVCLICIWRIKRVHFRSASGDTGADDGKDRIDNHESSCYQQKDQWVLCPINQCDCCLKQLAIRVIELHQIITHYHNPTQLSVHRKPSNIGTSESNRKPKKRTIEHCEESKPKRQCTMTTNPLSIDANWTPIQATSDGQRPRRVIKSTRYNDFIVDDKCLLKSTNERSVKRKSGHIPAQISPTKSYDSKSLLSTGENEQHRILSPDESTHDDMVQKEEEKPIVDDVLVSTSCENVGIADQIVAXXXXXXXXXXHGNQEIKCDNALNIANTSQEELIEHTPTINTDDCTPRRPPQFRRIKQAISTQASKPTELATEEEEIMNQHEESATFVDKEQPVIIAHQTARATSGPRVKQVSRQNLNVDTNIDSTTRQKCVVKRTNRIVKKPETLTNYIIDDHSITXXXXXXXXXXXXXXXSTGRCDSIPLERQSVTGWDGGRCGICAGCNRNRSCGKCDPCLLNKSQRRKTELCVKMICTARXXXXXXXXXXGTKRDKISDIRNTTEVNTLNEASTTDKSVDEITPGTDVSTVCQQLCNGIDVYRXXXXXXXXXXXXXXXXXXXXIHTVKGDLITTGLAHEGGFPVITTVNAQPNKVLCYSCGSGGDQLIHCVSCAEPFHFFCIEYQFRPKSKEMFVCRNCTKCHSCDVYGSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAGLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKCQPPDVAEETEQKKRVRLKRQCKDSGLKQYCERSVQRKTNEFIQKGEAAEEMLLEQHNVSDSAATGYNKGSMSLSQYDGHXXXXXXXKIGGNRGLMSVKDYEGLAMNSPSADMNQTSSTMFCSSESTGECDMDPLNLMDLEHQSVKVDIDVELENIEFESSRATKIGIFSRLNAPDFLSPKHLLMEALARICVKLSRYPSHSQLHKVYERFIGRIEDLTQEIFPWIDFNITMATVQMVVKKYSGRAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICEKDIRHCALCAGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDV-QLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTKELNNKANGDDLSVSASGVVNQNPATLVATAAIPHRRRMIEMPEQRTTKRSKPMQCKQDIIYEMDEAGNLQPISGFFRSRQPAVATTVFNKVSNNEIAAKKVNRRFPISIASSRVGIVQQSSLNSLSGTEENHRIVPLRRPEXXXXXXXXXXXXXXXXXXXXXXHPASHASQQPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPPVMLRLNKIQPQRLPPSIVKQLNINQNQSKPLTFIHLGQPINRISVKNPPMNNKIFKVMKVATSSSLSPATVGVGNXXXXXXXXXXXXXXKHPSLRIVTSRPPLSSSVLRTVLTDNSHSRRVVVHQQTQPALTIGTSKSSAYHISSCGSIITPSLAQFDGEGDDSSAVTFDEFRSILAAHPAHNVGSDQENASVITMATTTTVAGVKTRKQRANHDYKFCLRFTIHGFKGSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            MGRNKNRNKLQLKSPSQLRNESFSRNNSFNESEMYDNENNFESSENILNNPILLNHINEIQNINESVLIWSNEDVIDENRSKSFHSIVKQEIIKKSIKKSAFSKYLKSQLKDINTIHLSAISGVLMKNEMESDKSSVILNEIPNNNYLKIETKKQSVDNKNSFELPEEIENVDANRRQVSLQETCASPNEPVVRRSGRSAKINYKDMLNIHIYEPVRLTDDWHSPKRKHKVKREPSRPSIRQSTSDNSEVDNRSPERKLIEQKVEFTESEEEKHEGKCTIE+EAQTGYEIKEKEEDKPSQFEIEEERQKHQGVDSDNSHKPNHYQVEENKSNIKRKAFRKPTKDLSRNCIMCSKAVMGSRKFDNLCYNCVVAATKIITRLKLCNNDTRPIVCLGDCGCWERMTDFAERTDILPCDACKIQQLMASGLQWGEQLQWMRTVTLDELRSHEAVQRSRQLQ+DQGQAWLNQLTGIEHFGSCLLPDTDLTHAYKWDIRYLVPLGPDGKARCQFCALSHDSDVERSPILEQLYTILPLKETTICQHCLMMAHNAIRNSGLPADGLLQQIRSICPLEPLRYRYFDGAANPDGLCEICMRKDNSVMSRLRSGNLVCLICIWRIKRVHFRSASGDTGADDGKDRIDNHESSCYQQKDQWVLCPINQCDCCLKQLAIRVIELHQIITHYHNPTQLSVHRKPSNIGTSESNRKPKKRTIEHCEESKPKRQCTMTTNPLSIDANWTPIQATSDGQRPRRVIKSTRYNDFIVDDKCLLKSTNERSVKRKS HIPAQISPTKSYDSKSLLST ENEQHRILSPDESTHDDMVQKEEEKPIVDDVLVSTSCENVGIADQIVAGESDSEGDSSHGNQEIKCDNALNIANTSQEELIEHTPTINTDDCTPRRPPQFRRIKQAISTQASKPTELATEEEEIMNQHEESATFVDKEQPVIIAHQTARATSGPRVKQVSRQNLNVDTNIDSTTRQKCVVKRTNRIVKKPETLTNYIIDDHSITDQMEDDDEDHHLDQLSTGRCDSIPLERQSVTGWDGGRCGICAGCNRNRSCGKCDPCLLNKSQRRKTELCVKMICTARTQTTNQINQIGTKRDKISDIRNTTEVNTLNEASTTDKSVDEITPGTDVSTVCQQLCNGIDVYRDSDSDDLSSEEEQLDPELDSIHTVKGDLITTGLAHEGGFPVITTVNAQPNKVLCYSCGSGGDQLIHCVSCAEPFHFFCIEYQFRPKSKEMFVCRNCTKCHSCDVYGSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAGLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKCQPPDVAEETEQKKRVRLKRQCKDSGLKQYCERSVQRKTNEFIQKGEAAEEMLLEQHNVSDSAATGYNKGSMSLSQYDGHDDEDDEDKIGGN GLMSVKDYEGLAMNSPSADMNQTSSTMFCSSESTGECDMDPLNLMDLEHQSVKVDIDVELENIEFESSRATKIGIFSRLNAPDFLSPKHLLMEALARICVKLSRYPSHSQLHKVYERFIGRIEDLTQEIFPWIDFNITMATVQMVVKKYSGRAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICEKDIRHCALCAGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDV QLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTKELNNKANGDDLSVSASGVVNQNPATLVATAAIPHRRRMIEMPEQRTTKRSKPMQCKQDIIYEMDEAGNLQPISGFFRSRQPAVATTVFNKVSNNEIAAKKVNRRFPISIASSRVGIVQQSSLNSLSGTEENHRIVPLRRPENINQNTNNIINNCSSSSIIIKSHPASHASQQPYQPQPLSVPRVQQQQQQQQSISQSQMPIIMKQQDPPVMLRLNKIQPQRLPPSIVKQLNINQNQSKPLTFIHLGQPINRISVKNPPMNNKIFKVMKVATSSSLSPATVGVGNSSTSIPISPLTTATKHPSLRIVTSRPPLSSSVLRTVLTDNSHSRRVVVHQQTQPALTIGTSKSSAYHISSCGSIITPSLAQFDGEGDDSSAVTFDEFRSILAAHPAHNVGSDQENASVITMATTTTVAGVKTRKQRANHDYKFCLRFTIHGFKGSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSP GCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAPLNADQLDDNPDPDEDYLRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN
Sbjct:    1 MGRNKNRNKLQLKSPSQLRNESFSRNNSFNESEMYDNENNFESSENILNNPILLNHINEIQNINESVLIWSNEDVIDENRSKSFHSIVKQEIIKKSIKKSAFSKYLKSQLKDINTIHLSAISGVLMKNEMESDKSSVILNEIPNNNYLKIETKKQSVDNKNSFELPEEIENVDANRRQVSLQETCASPNEPVVRRSGRSAKINYKDMLNIHIYEPVRLTDDWHSPKRKHKVKREPSRPSIRQSTSDNSEVDNRSPERKLIEQKVEFTESEEEKHEGKCTIEHEAQTGYEIKEKEEDKPSQFEIEEERQKHQGVDSDNSHKPNHYQVEENKSNIKRKAFRKPTKDLSRNCIMCSKAVMGSRKFDNLCYNCVVAATKIITRLKLCNNDTRPIVCLGDCGCWERMTDFAERTDILPCDACKIQQLMASGLQWGEQLQWMRTVTLDELRSHEAVQRSRQLQLDQGQAWLNQLTGIEHFGSCLLPDTDLTHAYKWDIRYLVPLGPDGKARCQFCALSHDSDVERSPILEQLYTILPLKETTICQHCLMMAHNAIRNSGLPADGLLQQIRSICPLEPLRYRYFDGAANPDGLCEICMRKDNSVMSRLRSGNLVCLICIWRIKRVHFRSASGDTGADDGKDRIDNHESSCYQQKDQWVLCPINQCDCCLKQLAIRVIELHQIITHYHNPTQLSVHRKPSNIGTSESNRKPKKRTIEHCEESKPKRQCTMTTNPLSIDANWTPIQATSDGQRPRRVIKSTRYNDFIVDDKCLLKSTNERSVKRKSDHIPAQISPTKSYDSKSLLSTCENEQHRILSPDESTHDDMVQKEEEKPIVDDVLVSTSCENVGIADQIVAGESDSEGDSSHGNQEIKCDNALNIANTSQEELIEHTPTINTDDCTPRRPPQFRRIKQAISTQASKPTELATEEEEIMNQHEESATFVDKEQPVIIAHQTARATSGPRVKQVSRQNLNVDTNIDSTTRQKCVVKRTNRIVKKPETLTNYIIDDHSITDQMEDDDEDHHLDQLSTGRCDSIPLERQSVTGWDGGRCGICAGCNRNRSCGKCDPCLLNKSQRRKTELCVKMICTARTQTTNQINQIGTKRDKISDIRNTTEVNTLNEASTTDKSVDEITPGTDVSTVCQQLCNGIDVYRDSDSDDLSSEEEQLDPELDSIHTVKGDLITTGLAHEGGFPVITTVNAQPNKVLCYSCGSGGDQLIHCVSCAEPFHFFCIEYQFRPKSKEMFVCRNCTKCHSCDVYGSDLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMTHHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAGLETIECNSCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKCQPPDVAEETEQKKRVRLKRQCKDSGLKQYCERSVQRKTNEFIQKGEAAEEMLLEQHNVSDSAATGYNKGSMSLSQYDGHDDEDDEDKIGGNGGLMSVKDYEGLAMNSPSADMNQTSSTMFCSSESTGECDMDPLNLMDLEHQSVKVDIDVELENIEFESSRATKIGIFSRLNAPDFLSPKHLLMEALARICVKLSRYPSHSQLHKVYERFIGRIEDLTQEIFPWIDFNITMATVQMVVKKYSGRAKLIMQALAENVRDNINREFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDADSTSTATYNVAFPSEFNSTICEKDIRHCALCAGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTKELNNKANGDDLSVSASGVVNQNPATLVATAAIPHRRRMIEMPEQRTTKRSKPMQCKQDIIYEMDEAGNLQPISGFFRSRQPAVATTVFNKVSNNEIAAKKVNRRFPISIASSRVGIVQQSSLNSLSGTEENHRIVPLRRPENINQNTNNIINNCSSSSIIIKSHPASHASQQPYQPQPLSVPRVQQQQQQQQSISQSQMPIIMKQQDPPVMLRLNKIQPQRLPPSIVKQLNINQNQSKPLTFIHLGQPINRISVKNPPMNNKIFKVMKVATSSSLSPATVGVGNSSTSIPISPLTTATKHPSLRIVTSRPPLSSSVLRTVLTDNSHSRRVVVHQQTQPALTIGTSKSSAYHISSCGSIITPSLAQFDGEGDDSSAVTFDEFRSILAAHPAHNVGSDQENASVITMATTTTVAGVKTRKQRANHDYKFCLRFTIHGFKGSKSPKSGWGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPRGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAPLNADQLDDNPDPDEDYLRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 2674          
BLAST of histone lysine N methyltransferase MLL-1 vs. Planmine SMEST
Match: SMESG000071222.1 (SMESG000071222.1)

HSP 1 Score: 162.54 bits (410), Expect = 1.825e-39
Identity = 110/326 (33.74%), Postives = 171/326 (52.45%), Query Frame = 1
Query: 7174 FCLRFTIHGFKGSKSPKSG---WGLIVKRITQMRKSQGLME-YPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPHGCVRFNQWTKTKPDHIAR---------DPLAFLHSK--SNYPPKNHAXXXXXXXXXXXXXXXXXXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED---DKLPCTCGSFSCKKYLN 8097
            F ++F  +G +   + KS    W  I+ +I ++R+  GL   +PV    G   +GL    +I ++E +       NY FKF K ++       +   ++P G  R     +T   ++ R         +    L +K  +NY P  +   N ++        + Y R L  ++RN  N + +R+K        I G GLFA + F+   +IIEY+GE+IR+ + + RE  YQ      YMFRL++DLI+DAT  G  AR+INHSC+PNC A+ +  +    III  ++ I +GEELTYDY+F  ED   DK+PC CGS +C+K++N
Sbjct: 1028 FKVKFIDNGCENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVY-LSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLI----TEMPLAINPTGSARTEPKLRT---YVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKR-LKYEWRN--NVILSRSK--------IQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 1334          

HSP 2 Score: 105.531 bits (262), Expect = 4.344e-22
Identity = 69/225 (30.67%), Postives = 109/225 (48.44%), Query Frame = 1
Query: 5248 DIRHCALC--AGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASD---NIVVTIGNLRINCMGKI----------DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            D+R C LC   G GD+ + GRLI    D WVH+NCALW  +V+E   G+L+ VD ++RK  K +C  C + GA ++C          S C NVYH  CA+ +    +F   R  YC    ++ V +  + L  + + RR+ +    L + S      V  D    I    G+L +N +G++          + CS      + P+GY + R++WS  +++    Y
Sbjct:  813 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTICTCCNETGAGIQCYR--------SKCTNVYHVPCAYKV--GCIFYTDRGMYCP---NHVVLNHPMHLPSLRVERRVNI----LRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCS-----IIYPVGYHSTRIYWSSTQINKRCKY 1015          
BLAST of histone lysine N methyltransferase MLL-1 vs. Planmine SMEST
Match: SMESG000064115.1 (SMESG000064115.1)

HSP 1 Score: 161.77 bits (408), Expect = 4.382e-39
Identity = 98/299 (32.78%), Postives = 160/299 (53.51%), Query Frame = 1
Query: 7231 WGLIVKRITQMRKSQGLMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSP---HGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAXXXXXXXXXXXXXXXX----XXRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIE---DDKLPCTCGSFSCKKYLN 8097
            W  I+ +I+ +RKS  ++++   +      +GL   HV+  +E +      N+Y FKF K        Q + ++  P    G +R   + K    HI +     +H   N+    H    A     +    ++       TL+ +++  R         V +  S I G GL+A +  +   +IIEYVGE+IR+ ++++RE +Y+      YMFRLD   ++DAT  G+ AR+INH C PNC+ +++ FE E HI+II+ RKI KGEELTYDY+F ++   DDK+PC CG+ +C++++N
Sbjct: 1179 WKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKM-------QLIVEMPLPINMSGSIRTEPFVKLY-RHIHK---PAIHQSPNF--LRHLLAAAAATATSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYDYKFDLDDGKDDKIPCLCGARNCRRWMN 1464          

HSP 2 Score: 89.7373 bits (221), Expect = 2.975e-17
Identity = 62/217 (28.57%), Postives = 104/217 (47.93%), Query Frame = 1
Query: 5248 DIRHCALCAGSGD--DRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMG-----KIDECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 5877
            D R C+LC  +GD  +   GRL+   +D W+H+NCALW ++V+E + GAL NV  +     K++C++C K GA + C  P         C   YH  CA       +F   R  YC         D+   L  + + RR+Y+ +   + V  A T      N  + IG+L +  +G     +I   + +   ++ P G+++ R+ WS   +++  +Y
Sbjct:  940 DKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYP--------RCTLKYHVPCA--QEKGCLFFADRAMYCQLHQ---TKDLGPHLTTLNVDRRVYISRDEYSQV--AGTINNEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVY 1141          
BLAST of histone lysine N methyltransferase MLL-1 vs. Planmine SMEST
Match: SMESG000062296.1 (SMESG000062296.1)

HSP 1 Score: 159.844 bits (403), Expect = 1.570e-38
Identity = 76/166 (45.78%), Postives = 106/166 (63.86%), Query Frame = 1
Query: 7627 RTLADQFRNLR--------NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            R L   F+NL         N + AR K +    S IH  GL A       E++IEYVG+V+R  L++ RE +Y+  G+   Y+FR+D DL++DAT  G+ ARFINHSC PNC A+V+  +G+K I+I ++R+I   EE+TYDY+FP E+DK+PC CGS  C+  LN
Sbjct: 1230 RRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 1395          
BLAST of histone lysine N methyltransferase MLL-1 vs. Planmine SMEST
Match: SMESG000062296.1 (SMESG000062296.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.704e-38
Identity = 76/166 (45.78%), Postives = 106/166 (63.86%), Query Frame = 1
Query: 7627 RTLADQFRNLR--------NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 8097
            R L   F+NL         N + AR K +    S IH  GL A       E++IEYVG+V+R  L++ RE +Y+  G+   Y+FR+D DL++DAT  G+ ARFINHSC PNC A+V+  +G+K I+I ++R+I   EE+TYDY+FP E+DK+PC CGS  C+  LN
Sbjct: 1248 RRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 1413          
The following BLAST results are available for this feature:
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT2A3.771e-6141.10lysine methyltransferase 2A [Source:HGNC Symbol;Ac... [more]
KMT2A5.122e-6141.10lysine methyltransferase 2A [Source:HGNC Symbol;Ac... [more]
KMT2A5.433e-6141.10lysine methyltransferase 2A [Source:HGNC Symbol;Ac... [more]
KMT2B2.211e-5438.22lysine methyltransferase 2B [Source:HGNC Symbol;Ac... [more]
KMT2B2.376e-5438.22lysine methyltransferase 2B [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
set-21.127e-4251.70Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-21.031e-4151.70Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-21.077e-4151.70Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-161.293e-2946.72Histone-lysine N-methyltransferase [Source:UniPro... [more]
set-121.674e-1838.46Histone-lysine N-methyltransferase [Source:UniPro... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trx2.017e-4956.13gene:FBgn0003862 transcript:FBtr0082947[more]
trx2.017e-4956.13gene:FBgn0003862 transcript:FBtr0082950[more]
trx2.336e-4861.31gene:FBgn0003862 transcript:FBtr0082948[more]
trx2.336e-4861.31gene:FBgn0003862 transcript:FBtr0082949[more]
trx2.336e-4861.31gene:FBgn0003862 transcript:FBtr0100277[more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2a1.184e-6040.49lysine (K)-specific methyltransferase 2A [Source:Z... [more]
kmt2a1.235e-6040.49lysine (K)-specific methyltransferase 2A [Source:Z... [more]
kmt2bb2.260e-5640.13lysine (K)-specific methyltransferase 2Bb [Source:... [more]
kmt2bb2.820e-5640.13lysine (K)-specific methyltransferase 2Bb [Source:... [more]
kmt2ba7.168e-5538.78lysine (K)-specific methyltransferase 2Ba [Source:... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralgapa23.736e-6140.58Ral GTPase activating protein, alpha subunit 2 (ca... [more]
kmt2b3.542e-5639.37lysine methyltransferase 2B [Source:NCBI gene;Acc:... [more]
kmt2b4.007e-5639.37lysine methyltransferase 2B [Source:NCBI gene;Acc:... [more]
c1orf501.694e-4032.67chromosome 1 open reading frame 50 [Source:Xenbase... [more]
setd1b3.134e-4052.38SET domain containing 1B [Source:NCBI gene;Acc:780... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kmt2a2.533e-6141.10lysine (K)-specific methyltransferase 2A [Source:M... [more]
Kmt2a2.664e-6141.10lysine (K)-specific methyltransferase 2A [Source:M... [more]
Kmt2b1.219e-5438.22lysine (K)-specific methyltransferase 2B [Source:M... [more]
Kmt2b4.587e-5438.22lysine (K)-specific methyltransferase 2B [Source:M... [more]
Kmt2b4.595e-5438.22lysine (K)-specific methyltransferase 2B [Source:M... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55200|KMT2A_MOUSE1.772e-6041.10Histone-lysine N-methyltransferase 2A OS=Mus muscu... [more]
sp|Q03164|KMT2A_HUMAN2.460e-6041.10Histone-lysine N-methyltransferase 2A OS=Homo sapi... [more]
sp|Q9UMN6|KMT2B_HUMAN1.141e-5338.22Histone-lysine N-methyltransferase 2B OS=Homo sapi... [more]
sp|O08550|KMT2B_MOUSE3.209e-5338.22Histone-lysine N-methyltransferase 2B OS=Mus muscu... [more]
sp|Q24742|TRX_DROVI5.740e-4956.77Histone-lysine N-methyltransferase trithorax OS=Dr... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIL10.000e+099.39Histone lysine N methyltransferase MLL-1 OS=Schmid... [more]
L0H9740.000e+099.48Mll1/2 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A2T7P2D25.962e-6642.66Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1E1XAP52.680e-6543.99Putative histone H3 lys4 methyltransferase complex... [more]
A0A2R5LN236.690e-6543.58Putative histone-lysine n-methyltransferase mll is... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2bb2.676e-5640.13lysine (K)-specific methyltransferase 2Bb [Source:... [more]
ENSAMXT00000056389.11.795e-4562.93pep primary_assembly:Astyanax_mexicanus-2.0:2:2379... [more]
ENSAMXT00000040628.11.585e-4361.21pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
setd1ba1.891e-4252.38SET domain containing 1B, histone lysine methyltra... [more]
ENSAMXT00000041567.11.222e-4130.53pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd1a8.505e-4050.34SET domain containing 1A, histone lysine methyltra... [more]
ENSPMAT00000010827.12.467e-3950.00pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 ge... [more]
ENSPMAT00000002322.14.480e-3931.56pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 ge... [more]
ENSPMAT00000002229.14.586e-2332.49pep scaffold:Pmarinus_7.0:GL477110:4214:18323:-1 g... [more]
ENSPMAT00000004922.17.031e-2043.48pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 ... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SET13.373e-3547.33Histone methyltransferase, subunit of the COMPASS ... [more]
SET21.011e-1438.93Histone methyltransferase with a role in transcrip... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO308586.298e-5939.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308577.425e-5740.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312591.257e-5538.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445465.733e-4452.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375895.711e-3933.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT2A2.788e-5639.40lysine methyltransferase 2A [Source:NCBI gene;Acc:... [more]
KMT2A3.087e-5639.40lysine methyltransferase 2A [Source:NCBI gene;Acc:... [more]
kmt2ba2.358e-5439.21histone-lysine N-methyltransferase 2B [Source:NCBI... [more]
kmt2bb1.592e-5239.24lysine methyltransferase 2B [Source:NCBI gene;Acc:... [more]
setd1ba8.763e-4353.06SET domain containing 1B, histone lysine methyltra... [more]
back to top
BLAST of histone lysine N methyltransferase MLL-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027630.10.000e+099.74SMESG000027630.1[more]
SMESG000071222.11.825e-3933.74SMESG000071222.1[more]
SMESG000064115.14.382e-3932.78SMESG000064115.1[more]
SMESG000062296.11.570e-3845.78SMESG000062296.1[more]
SMESG000062296.11.704e-3845.78SMESG000062296.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029784
GenBankAFJ24865.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029784 ID=SMED30029784|Name=histone lysine N methyltransferase MLL-1|organism=Schmidtea mediterranea sexual|type=transcript|length=8548bp
AAATCTTTTTAAAAACAAATTATCTTTTCGGTTTGTTTAAACGTTTCTTC
GGTCTTTTATTTCATAAATGTTTTTAAAATGGGGAGAAATAAGAATAGAA
ATAAACTGCAATTAAAAAGCCCAAGCCAACTTAGAAATGAAAGTTTTTCC
AGAAATAATTCATTTAATGAATCAGAGATGTATGACAATGAAAATAATTT
TGAAAGTTCCGAGAACATATTAAATAATCCAATATTGTTGAATCACATTA
ATGAAATTCAAAATATTAATGAAAGTGTTTTGATATGGAGTAATGAAGAT
GTCATTGATGAGAATAGAAGCAAATCATTCCATTCAATTGTAAAACAAGA
AATTATCAAAAAGTCAATTAAAAAGAGCGCATTTTCGAAATATTTAAAAT
CTCAACTAAAAGATATTAATACCATTCACTTATCAGCCATAAGCGGAGTA
TTGATGAAAAATGAAATGGAATCTGACAAAAGCAGTGTTATATTAAATGA
AATTCCCAATAATAATTATTTAAAAATTGAAACCAAGAAGCAATCCGTCG
ATAATAAAAATTCTTTCGAATTACCGGAAGAAATTGAAAATGTTGATGCG
AATCGGCGACAAGTGAGTCTGCAAGAGACTTGTGCTAGCCCGAATGAGCC
AGTAGTCCGACGGTCAGGTAGGTCAGCCAAGATTAATTATAAGGATATGC
TCAATATACACATATACGAACCAGTCCGGCTCACAGATGATTGGCATTCC
CCTAAACGTAAACATAAAGTTAAACGCGAACCTTCAAGGCCGTCAATACG
ACAATCGACCAGTGACAATAGCGAGGTAGACAATCGGTCACCGGAACGCA
AATTAATTGAGCAAAAAGTTGAATTCACAGAATCGGAAGAGGAAAAACAT
GAAGGGAAATGCACAATTGAGTACGAGGCGCAAACAGGATATGAAATAAA
GGAAAAGGAAGAAGATAAACCTAGTCAGTTTGAAATAGAGGAAGAAAGAC
AGAAACATCAAGGAGTAGACAGTGACAACTCTCACAAACCCAATCACTAT
CAAGTAGAAGAAAACAAATCTAACATAAAACGGAAAGCGTTCCGGAAACC
GACGAAGGATCTGTCGAGGAATTGCATTATGTGCAGCAAGGCGGTGATGG
GCAGTCGGAAATTCGACAATTTATGCTACAATTGTGTCGTGGCCGCAACG
AAAATCATCACAAGACTGAAATTGTGCAACAATGATACTCGTCCAATAGT
TTGTCTCGGTGACTGTGGTTGCTGGGAACGCATGACGGATTTTGCAGAGA
GGACTGACATACTGCCTTGTGATGCGTGTAAGATACAACAGCTAATGGCA
TCTGGATTGCAATGGGGTGAACAGCTGCAATGGATGCGCACTGTCACGCT
CGATGAACTCAGAAGTCACGAGGCTGTTCAGCGGTCAAGACAGCTTCAGG
TGGACCAAGGTCAAGCTTGGCTGAACCAATTAACAGGGATAGAGCACTTC
GGCAGTTGCCTACTCCCCGATACAGATTTGACACATGCATACAAATGGGA
TATTCGCTACCTCGTGCCATTGGGCCCCGATGGTAAGGCCCGATGCCAAT
TCTGTGCTTTATCTCACGATTCCGATGTTGAGCGATCGCCCATATTGGAA
CAACTGTACACGATCCTGCCACTCAAAGAGACCACTATATGCCAGCATTG
CTTGATGATGGCCCATAATGCCATCCGAAATTCAGGACTACCTGCTGACG
GTTTACTGCAACAGATTAGATCGATTTGCCCACTTGAACCACTTAGATAC
CGATATTTTGACGGAGCCGCAAATCCAGATGGTCTTTGTGAGATCTGCAT
GCGTAAAGACAACTCAGTGATGTCCCGGTTGCGTTCAGGTAATCTAGTCT
GTCTCATTTGCATTTGGCGCATCAAGCGAGTGCATTTCCGTTCGGCCAGT
GGGGATACTGGTGCTGATGATGGCAAGGATCGCATTGACAATCACGAATC
ATCATGCTATCAACAGAAGGACCAATGGGTATTGTGCCCCATCAATCAAT
GTGATTGCTGTCTCAAGCAATTGGCCATTCGAGTCATAGAACTACACCAG
ATCATAACACACTACCACAACCCGACCCAACTATCAGTACACAGAAAACC
ATCAAACATCGGGACATCAGAGAGCAATCGGAAACCAAAAAAACGCACAA
TCGAGCACTGTGAAGAATCCAAACCGAAACGGCAGTGTACAATGACAACG
AATCCGTTGTCAATCGATGCAAATTGGACGCCGATACAAGCAACATCAGA
TGGACAGCGGCCCCGCCGAGTTATCAAATCAACCCGATACAATGATTTCA
TTGTCGATGACAAATGCCTTTTAAAGTCGACAAATGAGCGTTCGGTGAAG
AGAAAGTCTGGCCACATTCCAGCACAAATTTCCCCAACGAAATCATACGA
CAGCAAGTCATTGCTGTCAACAGGCGAAAATGAGCAGCACAGAATTCTTT
CCCCAGATGAATCGACCCATGACGATATGGTACAGAAAGAGGAGGAGAAA
CCTATAGTTGATGATGTGTTAGTATCGACTTCTTGTGAAAATGTTGGGAT
TGCTGATCAGATTGTTGCTGGTGAAAGTGATAGTGAAGGTGACAGTAGCC
ACGGCAACCAAGAGATAAAGTGTGATAATGCACTTAATATTGCCAATACG
TCCCAAGAAGAACTAATTGAACATACGCCTACAATAAACACCGACGATTG
TACACCTCGAAGGCCACCACAGTTCAGGCGGATCAAACAAGCAATTTCCA
CTCAAGCTTCCAAACCTACGGAATTGGCCACTGAAGAAGAGGAAATAATG
AATCAGCATGAAGAAAGTGCAACGTTCGTTGATAAGGAGCAACCAGTAAT
AATTGCACATCAGACAGCAAGAGCAACAAGCGGACCGAGGGTAAAGCAAG
TGAGTCGGCAAAATTTAAATGTTGACACTAACATCGATTCGACGACCCGG
CAAAAATGCGTTGTGAAGCGCACCAATCGAATCGTCAAAAAGCCGGAAAC
CCTGACCAATTACATTATTGATGATCACTCCATCACCGATCAAATGGAGG
ACGATGATGAAGATCACCATTTAGATCAGTTGTCGACGGGTCGATGTGAC
TCAATCCCTCTTGAGAGGCAATCTGTGACTGGCTGGGATGGCGGCAGATG
CGGAATCTGTGCTGGCTGCAATCGAAATCGGAGCTGTGGCAAATGCGATC
CTTGTCTACTGAACAAGTCCCAGCGTCGCAAGACTGAGCTTTGCGTCAAG
ATGATCTGTACTGCCAGAACGCAAACAACTAATCAAATAAATCAGATAGG
AACAAAACGGGACAAAATCTCTGATATTCGGAACACCACTGAAGTGAACA
CACTGAATGAAGCGAGCACCACGGACAAAAGTGTGGACGAAATCACCCCT
GGAACCGATGTGTCCACGGTGTGCCAGCAACTGTGTAATGGTATTGATGT
GTACCGGGATTCCGACAGCGACGATCTGAGTAGTGAGGAGGAACAATTAG
ATCCCGAATTGGACAGCATTCACACAGTAAAGGGTGATCTGATCACGACC
GGATTGGCACATGAAGGGGGGTTCCCAGTTATCACCACGGTGAATGCACA
ACCGAACAAAGTGCTGTGTTACAGTTGTGGTAGCGGTGGAGACCAACTGA
TTCATTGCGTGTCGTGCGCTGAACCGTTTCATTTCTTTTGCATCGAGTAT
CAGTTCCGGCCGAAATCCAAGGAGATGTTCGTTTGCCGCAACTGCACCAA
ATGCCACAGTTGCGATGTATACGGTAGTGACCTCAAATGCATCAAATGTC
AACTAGGATTCCACCCAACCTGTGTAGACAAATACCCACCAACCAGATCT
GACGACAAAAGCAATTGGGCGTGTTACAAGTGTGCCATGTGCCTTCATTG
TGGTGCCAAAGCTGAGGACGCCATGACTCATCACAATACAAATAAGTTTA
GTGGGGAAATCGATTGGAGTAAGGATCCTTGGCAATGTGGTCGCTGTGCC
AGGGCGAGGATCAATGGACACGTCTGTCCTGAATGCGGTCGCGCGTATCA
GGCCGGTTTGGAGACAATTGAGTGCAATTCGTGCAATCGCATGGTTCACA
GACAGTGTTGTGGCCTCTCGGAGGACGAATATGAAATATTCAAGGCAGAT
CCAGAAGCCCATTGCTCATCTAATGCATTCTTATGCACGAAATGTCAACC
ACCAGATGTGGCCGAAGAGACGGAACAGAAAAAACGGGTCCGGTTAAAGA
GACAATGCAAAGATTCCGGTTTGAAGCAATATTGTGAACGGAGCGTGCAA
AGGAAAACGAATGAATTCATCCAGAAAGGAGAAGCGGCTGAGGAAATGTT
ACTGGAACAGCACAATGTATCTGACAGTGCTGCTACTGGATACAACAAGG
GTTCCATGTCTCTAAGTCAGTACGATGGCCATGATGATGAGGACGACGAG
GACAAAATCGGGGGCAACCGCGGGTTGATGTCAGTAAAGGATTATGAAGG
GCTGGCAATGAACTCTCCATCTGCTGACATGAATCAGACCAGTAGCACCA
TGTTCTGTTCCAGTGAGTCGACCGGTGAGTGCGACATGGATCCACTGAAC
CTTATGGATCTGGAACATCAGAGCGTTAAAGTCGATATCGATGTCGAGTT
GGAGAATATAGAATTCGAGTCGTCTAGGGCAACCAAAATCGGAATTTTCA
GTCGATTAAATGCTCCTGATTTCCTGTCACCAAAACACCTATTGATGGAG
GCACTAGCAAGGATCTGCGTGAAACTGAGCAGGTACCCGTCACACAGCCA
GCTACACAAGGTCTACGAGCGATTTATCGGCCGCATAGAGGACTTGACGC
AGGAAATATTTCCCTGGATCGATTTCAACATCACCATGGCAACGGTTCAG
ATGGTTGTCAAAAAGTATTCTGGCCGAGCGAAATTGATCATGCAAGCGCT
AGCAGAAAATGTTCGTGACAACATCAATCGTGAATTCGACGTTTTCTCGT
CGTCTATCACTGAGATCGAGGAGAAGCTTAGCAACAGTTTCCAACGTGGT
CGCGAGGAATTCATTATTTTCCATAGTGAGCAGCACTTATCAGCCCTGAT
GAAATCGATTGAGTTCCAGTACGATGCCGACAGCACAAGTACCGCAACAT
ACAACGTGGCATTTCCATCAGAATTTAACAGCACCATCTGTGAGAAGGAT
ATAAGGCACTGTGCACTTTGTGCTGGTTCTGGTGACGATCGATTAGAGGG
CAGATTGATCTATGGTGGCCTTGACGTTTGGGTCCATGTAAACTGTGCCC
TGTGGAGTGACGATGTCTATGAGCGGGAAGACGGGGCACTTGTCAATGTC
GATATCGCCATTAGGAAGGGCGAGAAGGCCCTGTGTGCCGCTTGCCAGAA
ATATGGTGCCACGCTTCGGTGCTCTGCGCCGGACTCGCTAGATGGCTGTG
GCAGTAGTTGCCCCAACGTCTATCATTTCGCATGTGCCTTCAATATGTTG
CCGGATCCAGTTTTCACCGAGCTGCGAACTTTCTATTGCTCAGAATCTCA
CGATAACTGTGTGACCGATGTGCAGTTAACCCTTGTCGACATGCCAATAC
TCAGAAGGATATATCTGCCCCAGGGATGCCTTGCAAATGTGTCTATGGCA
TGCACTGATGGGGTTGCATCGGATAATATAGTAGTGACGATCGGCAATTT
GCGCATAAATTGTATGGGCAAGATCGATGAGTGCTCAGACTATCTTAGAG
TATATCTGTGCCCGATTGGATATCAGGCCCGTAGATTGTTCTGGAGCATG
TATGAGTTGGATTCACTGGTCATGTACTATATGAACGTAACGAAGGAGTT
GAACAACAAGGCAAACGGAGATGATTTATCAGTCAGTGCATCAGGCGTTG
TCAATCAGAATCCTGCAACCCTTGTTGCCACTGCTGCCATTCCCCACAGG
CGCAGGATGATAGAGATGCCGGAACAGAGAACAACGAAGAGGTCAAAACC
TATGCAATGCAAACAGGATATAATTTATGAAATGGACGAGGCTGGGAACT
TGCAGCCAATCTCCGGATTCTTCCGCTCGCGGCAGCCAGCCGTTGCTACT
ACTGTATTCAATAAAGTATCCAACAATGAAATCGCAGCCAAGAAGGTGAA
TCGAAGGTTCCCTATCAGTATAGCTAGTTCACGTGTTGGAATAGTACAAC
AATCTAGCCTGAATTCGCTATCTGGAACCGAGGAAAATCATCGTATTGTA
CCATTAAGAAGGCCAGAGAATATCAACCAGAACACCAACAACATAATCAA
CAACTGTAGCAGCAGCAGCATCATAATCAAATCCCATCCAGCATCGCATG
CGTCACAGCAGCCCTATCAGCCACAGCCACTGTCAGTGCCACGTGTACAG
CAACAGCAACAGCAACAACAATCGATATCGCAATCGCAGATGCCTATTAT
AATGAAACAACAGGATCCTCCTGTAATGCTACGACTCAATAAGATCCAGC
CTCAACGGTTACCTCCATCGATCGTCAAGCAATTGAACATCAATCAGAAC
CAATCGAAACCGCTCACATTTATCCACCTTGGCCAACCTATCAATCGGAT
ATCCGTCAAGAACCCGCCAATGAATAACAAAATATTCAAAGTCATGAAGG
TAGCAACATCCTCAAGTCTTTCCCCAGCAACAGTAGGTGTTGGTAACAGC
TCCACTAGCATTCCGATATCACCATTGACAACGGCTACTAAACACCCTTC
ACTAAGGATTGTAACTAGCAGGCCACCGTTATCATCATCAGTATTGCGGA
CGGTACTCACTGACAACAGTCATTCTCGCCGAGTAGTGGTGCACCAACAG
ACCCAACCTGCGCTAACTATAGGCACTTCAAAGTCATCGGCGTATCACAT
TTCTTCGTGTGGCTCTATTATCACCCCGTCACTAGCTCAATTTGATGGTG
AGGGGGACGACAGCTCGGCAGTAACATTCGATGAATTTCGGTCAATACTA
GCAGCACACCCGGCGCACAATGTGGGTTCCGATCAGGAAAACGCATCTGT
GATCACCATGGCAACTACGACAACTGTCGCGGGCGTCAAAACCAGGAAAC
AACGAGCCAATCACGACTATAAGTTCTGCCTGCGGTTCACAATTCATGGA
TTTAAGGGCAGCAAATCACCAAAGTCCGGTTGGGGCTTGATCGTGAAGCG
GATCACCCAAATGCGGAAGTCACAAGGCCTTATGGAGTACCCGGTGAGAA
ATGGAGACGGATGGGCCAAGTTCGGGCTGGATCATCGACACGTGATTTAC
CTTGTCGAGCAAATGGTCAGTGCATTCCAGTGCAACAATTACGAGTTCAA
ATTCCACAAGACGCGTGTGACCAAGCTCCGTAATCAATATTTGGCCGACG
TTGTAAGTCCGCACGGCTGCGTTAGGTTCAACCAGTGGACCAAAACCAAA
CCCGATCATATCGCCAGAGATCCCCTTGCGTTCCTCCATTCAAAATCAAA
TTACCCACCGAAGAATCACGCGCCTCTCAATGCTGATCAATTGGATGATA
ATCCGGATCCTGACGAGGACTACCTGAGAACGCTGGCTGACCAGTTTCGG
AATCTACGCAACGGTATGGATGCACGAGCCAAAACCGTGCGGGTCTGCGT
ATCGAATATCCACGGCAGAGGTCTGTTTGCTCGCCGCCAGTTCGATGCGC
ATGAGATCATTATCGAATATGTCGGAGAGGTAATCCGGTCGATCCTGTCC
GATGTCAGGGAAACCGAATATCAGAGGACTGGTGTCGATTGCTACATGTT
CCGGTTGGACCAGGACCTAATTGTTGATGCCACATTCAAGGGCAACGCAG
CCCGATTCATTAACCATTCCTGTCACCCCAACTGTTATGCCAAAGTTGTC
AGATTCGAGGGCGAAAAGCATATCATTATTATAGCTCAGAGAAAGATCTA
CAAAGGGGAAGAGCTTACCTACGATTACAGATTCCCGATAGAGGACGATA
AATTGCCGTGCACCTGCGGCAGTTTCAGCTGCAAGAAATACCTCAATTAA
TTTTCGGAAAAGCCGTTTTCTGTGAACGGCCAATCCAAACGATGCGCGCC
TTGACGATTGACTAGTATTGGCCAATTTGCATTTGTGTATACGCATCTGA
CCAAATCATGATGCGGATGATGCCTATGAATAATTGTATTGCAATATATC
CATGTAAATATCTGTCTGTGTATATCTGTATATATGTATGTTCCCGATAT
CGTCATCTATTCTCTTCCGACTTCCGATTTTGTACAAATTTTGACTGACT
CGAAACGTAAAACTTTTGTACAGATTCCCTAATGATGGGTTTTGTATTGC
ATTTTATGTGATGTTGCAACGGTAACCTGTCTGATGTGCCCCAGATCTGA
CATGGCAACCCGATGGAGTCACACAATATATATTGATATTTATAATGCCA
CGCTGTGCTTTTAATAAATATTTTATCGATTTATTAAAAAAAAAGATC
back to top

protein sequence of SMED30029784-orf-1

>SMED30029784-orf-1 ID=SMED30029784-orf-1|Name=SMED30029784-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MRSLPSSAPVSPLAERKCTRLMRQMQMRQTRLPERNRDITELSLRMQISQ
RPSGFAAPSKYRYLSGSSGQIDLICCSKPSAGSPEFRMALWAIIKQCWHI
VVSLSGRIVYSCSNMGDRSTSES*
back to top

protein sequence of SMED30029784-orf-2

>SMED30029784-orf-2 ID=SMED30029784-orf-2|Name=SMED30029784-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MRIHKCKLANTSQSSRRASFGLAVHRKRLFRKLIEVFLAAETAAGARQFI
VLYRESVIVGKLFPFVDLSLSYNNDMLFALESDNFGITVGVTGMVNESGC
VALECGINN*
back to top

protein sequence of SMED30029784-orf-3

>SMED30029784-orf-3 ID=SMED30029784-orf-3|Name=SMED30029784-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2674bp
MGRNKNRNKLQLKSPSQLRNESFSRNNSFNESEMYDNENNFESSENILNN
PILLNHINEIQNINESVLIWSNEDVIDENRSKSFHSIVKQEIIKKSIKKS
AFSKYLKSQLKDINTIHLSAISGVLMKNEMESDKSSVILNEIPNNNYLKI
ETKKQSVDNKNSFELPEEIENVDANRRQVSLQETCASPNEPVVRRSGRSA
KINYKDMLNIHIYEPVRLTDDWHSPKRKHKVKREPSRPSIRQSTSDNSEV
DNRSPERKLIEQKVEFTESEEEKHEGKCTIEYEAQTGYEIKEKEEDKPSQ
FEIEEERQKHQGVDSDNSHKPNHYQVEENKSNIKRKAFRKPTKDLSRNCI
MCSKAVMGSRKFDNLCYNCVVAATKIITRLKLCNNDTRPIVCLGDCGCWE
RMTDFAERTDILPCDACKIQQLMASGLQWGEQLQWMRTVTLDELRSHEAV
QRSRQLQVDQGQAWLNQLTGIEHFGSCLLPDTDLTHAYKWDIRYLVPLGP
DGKARCQFCALSHDSDVERSPILEQLYTILPLKETTICQHCLMMAHNAIR
NSGLPADGLLQQIRSICPLEPLRYRYFDGAANPDGLCEICMRKDNSVMSR
LRSGNLVCLICIWRIKRVHFRSASGDTGADDGKDRIDNHESSCYQQKDQW
VLCPINQCDCCLKQLAIRVIELHQIITHYHNPTQLSVHRKPSNIGTSESN
RKPKKRTIEHCEESKPKRQCTMTTNPLSIDANWTPIQATSDGQRPRRVIK
STRYNDFIVDDKCLLKSTNERSVKRKSGHIPAQISPTKSYDSKSLLSTGE
NEQHRILSPDESTHDDMVQKEEEKPIVDDVLVSTSCENVGIADQIVAGES
DSEGDSSHGNQEIKCDNALNIANTSQEELIEHTPTINTDDCTPRRPPQFR
RIKQAISTQASKPTELATEEEEIMNQHEESATFVDKEQPVIIAHQTARAT
SGPRVKQVSRQNLNVDTNIDSTTRQKCVVKRTNRIVKKPETLTNYIIDDH
SITDQMEDDDEDHHLDQLSTGRCDSIPLERQSVTGWDGGRCGICAGCNRN
RSCGKCDPCLLNKSQRRKTELCVKMICTARTQTTNQINQIGTKRDKISDI
RNTTEVNTLNEASTTDKSVDEITPGTDVSTVCQQLCNGIDVYRDSDSDDL
SSEEEQLDPELDSIHTVKGDLITTGLAHEGGFPVITTVNAQPNKVLCYSC
GSGGDQLIHCVSCAEPFHFFCIEYQFRPKSKEMFVCRNCTKCHSCDVYGS
DLKCIKCQLGFHPTCVDKYPPTRSDDKSNWACYKCAMCLHCGAKAEDAMT
HHNTNKFSGEIDWSKDPWQCGRCARARINGHVCPECGRAYQAGLETIECN
SCNRMVHRQCCGLSEDEYEIFKADPEAHCSSNAFLCTKCQPPDVAEETEQ
KKRVRLKRQCKDSGLKQYCERSVQRKTNEFIQKGEAAEEMLLEQHNVSDS
AATGYNKGSMSLSQYDGHDDEDDEDKIGGNRGLMSVKDYEGLAMNSPSAD
MNQTSSTMFCSSESTGECDMDPLNLMDLEHQSVKVDIDVELENIEFESSR
ATKIGIFSRLNAPDFLSPKHLLMEALARICVKLSRYPSHSQLHKVYERFI
GRIEDLTQEIFPWIDFNITMATVQMVVKKYSGRAKLIMQALAENVRDNIN
REFDVFSSSITEIEEKLSNSFQRGREEFIIFHSEQHLSALMKSIEFQYDA
DSTSTATYNVAFPSEFNSTICEKDIRHCALCAGSGDDRLEGRLIYGGLDV
WVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSA
PDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQL
TLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKID
ECSDYLRVYLCPIGYQARRLFWSMYELDSLVMYYMNVTKELNNKANGDDL
SVSASGVVNQNPATLVATAAIPHRRRMIEMPEQRTTKRSKPMQCKQDIIY
EMDEAGNLQPISGFFRSRQPAVATTVFNKVSNNEIAAKKVNRRFPISIAS
SRVGIVQQSSLNSLSGTEENHRIVPLRRPENINQNTNNIINNCSSSSIII
KSHPASHASQQPYQPQPLSVPRVQQQQQQQQSISQSQMPIIMKQQDPPVM
LRLNKIQPQRLPPSIVKQLNINQNQSKPLTFIHLGQPINRISVKNPPMNN
KIFKVMKVATSSSLSPATVGVGNSSTSIPISPLTTATKHPSLRIVTSRPP
LSSSVLRTVLTDNSHSRRVVVHQQTQPALTIGTSKSSAYHISSCGSIITP
SLAQFDGEGDDSSAVTFDEFRSILAAHPAHNVGSDQENASVITMATTTTV
AGVKTRKQRANHDYKFCLRFTIHGFKGSKSPKSGWGLIVKRITQMRKSQG
LMEYPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKL
RNQYLADVVSPHGCVRFNQWTKTKPDHIARDPLAFLHSKSNYPPKNHAPL
NADQLDDNPDPDEDYLRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLF
ARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVD
ATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDY
RFPIEDDKLPCTCGSFSCKKYLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0018024histone-lysine N-methyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0032259methylation
GO:0051568histone H3-K4 methylation
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR034732EPHD
IPR001214SET_dom
IPR001965Znf_PHD
IPR003889FYrich_C
IPR013083Znf_RING/FYVE/PHD
IPR003888FYrich_N
IPR019786Zinc_finger_PHD-type_CS
IPR003616Post-SET_dom
IPR019787Znf_PHD-finger
IPR002857Znf_CXXC
IPR011011Znf_FYVE_PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001214SET domainSMARTSM00317set_7coord: 2535..2657
e-value: 1.8E-36
score: 137.1
IPR001214SET domainPFAMPF00856SETcoord: 2546..2650
e-value: 3.1E-20
score: 73.2
IPR001214SET domainPROSITEPS50280SETcoord: 2535..2651
score: 17.483
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 1196..1240
e-value: 0.007
score: 25.6
coord: 1785..1841
e-value: 15.0
score: 4.1
coord: 1241..1286
e-value: 0.06
score: 22.5
coord: 1332..1390
e-value: 0.054
score: 22.6
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1331..1378
e-value: 2.0E-7
score: 32.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1722..1843
e-value: 1.9E-19
score: 71.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1188..1295
e-value: 9.0E-8
score: 34.2
IPR003889FY-rich, C-terminalPFAMPF05965FYRCcoord: 2378..2443
e-value: 1.1E-10
score: 41.5
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 2520..2673
e-value: 1.5E-49
score: 170.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 687..719
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 223..320
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 699..717
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2104..2137
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..320
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 7..31
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..31
NoneNo IPR availablePANTHERPTHR45838:SF3HISTONE-LYSINE N-METHYLTRANSFERASE 2Bcoord: 1718..1938
coord: 2083..2673
coord: 1180..1390
NoneNo IPR availablePANTHERPTHR45838FAMILY NOT NAMEDcoord: 1718..1938
coord: 1180..1390
NoneNo IPR availablePANTHERPTHR45838FAMILY NOT NAMEDcoord: 2083..2673
NoneNo IPR availableCDDcd15506PHD1_KMT2A_likecoord: 1196..1239
e-value: 7.80995E-14
score: 65.8437
NoneNo IPR availableSUPERFAMILYSSF81995beta-sandwich domain of Sec23/24coord: 2106..2216
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 2533..2669
IPR003888FY-rich, N-terminalPFAMPF05964FYRNcoord: 1889..1937
e-value: 2.6E-7
score: 30.4
IPR003888FY-rich, N-terminalPROSITEPS51542FYRNcoord: 1883..1940
score: 15.751
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 1197..1257
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1194..1242
score: 8.796
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1330..1392
score: 8.733
IPR034732Extended PHD (ePHD) domainPROSITEPS51805EPHDcoord: 1725..1841
score: 14.696
IPR002857Zinc finger, CXXC-typePROSITEPS51058ZF_CXXCcoord: 1027..1078
score: 9.248
IPR003616Post-SET domainPROSITEPS50868POST_SETcoord: 2657..2673
score: 9.347
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1189..1240
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1330..1392