EGR-like protein 1

Overview
NameEGR-like protein 1 (AEI69697.1)
Smed IDSMED30029780
Length (bp)718
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EGR-like protein 1 (SMED30029780) t-SNE clustered cells

Violin plots show distribution of expression levels for EGR-like protein 1 (SMED30029780) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EGR-like protein 1 (SMED30029780) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EGR-like protein 1 (SMED30029780) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029780

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029780SMESG000000960.1 SmedASXL_019323SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029780SMESG000000960.1 SmedASXL_019323SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30029780SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029780SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029780SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029780SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029780SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029780SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029780SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029780SMESG000000960.1 SMED_23310_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029780SMESG000000960.1 SMED_23310_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR4 (early growth response 4 [Source:HGNC Symbol;Acc:HGNC:3241])

HSP 1 Score: 103.99 bits (258), Expect = 4.269e-25
Identity = 51/106 (48.11%), Postives = 65/106 (61.32%), Query Frame = 3
Query:  345 KQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENVF*RFSDIFYYFMYI 656
            K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+THVR HTGEKP+ C  C R F+RSDE+ RH  + HL + K     R   + +Y + +
Sbjct:  378 KAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH-SKVHL-KQKARAEERLKGLGFYSLGL 481          
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR4 (early growth response 4 [Source:HGNC Symbol;Acc:HGNC:3241])

HSP 1 Score: 103.99 bits (258), Expect = 5.983e-25
Identity = 51/107 (47.66%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  342 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENVF*RFSDIFYYFMYI 656
             K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+THVR HTGEKP+ C  C R F+RSDE+ RH  + HL + K     R   + +Y + +
Sbjct:  480 AKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH-SKVHL-KQKARAEERLKGLGFYSLGL 584          
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR1 (early growth response 1 [Source:HGNC Symbol;Acc:HGNC:3238])

HSP 1 Score: 101.679 bits (252), Expect = 3.894e-24
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  344 SCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTK 416          

HSP 2 Score: 61.6178 bits (148), Expect = 2.142e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:  366 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 422          
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 99.7525 bits (247), Expect = 6.743e-24
Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +
Sbjct:  282 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAK 353          

HSP 2 Score: 65.4698 bits (158), Expect = 7.729e-12
Identity = 28/57 (49.12%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P AC FC ++F RSD    H +IH  +K
Sbjct:  303 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 359          
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR2 (early growth response 2 [Source:HGNC Symbol;Acc:HGNC:3239])

HSP 1 Score: 100.523 bits (249), Expect = 8.216e-24
Identity = 48/81 (59.26%), Postives = 56/81 (69.14%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKE 608
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C YC R F+RSDER RH +  HL R KE
Sbjct:  347 CDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTK-IHL-RQKE 425          

HSP 2 Score: 65.855 bits (159), Expect = 8.257e-12
Identity = 32/54 (59.26%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  426 ERPLAC--HFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ERP  C    CD+RF RSD L+ H+RIHTG KP+QC  C R FSRSD    HIR
Sbjct:  337 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 390          

HSP 3 Score: 60.8474 bits (146), Expect = 3.323e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC +C ++F RSD    H +IH  +K
Sbjct:  368 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 424          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 102.064 bits (253), Expect = 8.853e-26
Identity = 60/138 (43.48%), Postives = 76/138 (55.07%), Query Frame = 3
Query:  174 LKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            LKT  PMD  +  F     S++D N F     P   K++          S K   + + + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+THVR HTGEKPY C  C + F+R DER RH +
Sbjct:  129 LKT-EPMDDYSYNF-----SDNDFNSFKFSSTPEEPKNIGCQKMK----SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTK 256          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 97.4413 bits (241), Expect = 1.077e-25
Identity = 47/89 (52.81%), Postives = 58/89 (65.17%), Query Frame = 3
Query:  321 SEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            S K   + + + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+THVR HTGEKPY C  C + F+R DER RH +
Sbjct:    3 SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTK 91          

HSP 2 Score: 53.5286 bits (127), Expect = 3.793e-9
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C  C + F R D L  H R HTGE+P +C  C K+F R D  + H +IH
Sbjct:   41 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIH 93          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 101.679 bits (252), Expect = 1.272e-25
Identity = 63/152 (41.45%), Postives = 80/152 (52.63%), Query Frame = 3
Query:  132 HESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            H SF    +     LKT  PMD  +  F     S++D N F     P   K++          S K   + + + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+THVR HTGEKPY C  C + F+R DER RH +
Sbjct:  115 HTSFSDSASLAHFELKT-EPMDDYSYNF-----SDNDFNSFKFSSTPEEPKNIGC----QKMKSSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTK 256          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 97.0561 bits (240), Expect = 1.753e-25
Identity = 47/89 (52.81%), Postives = 58/89 (65.17%), Query Frame = 3
Query:  321 SEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            S K   + + + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+THVR HTGEKPY C  C + F+R DER RH +
Sbjct:    3 SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTK 91          

HSP 2 Score: 54.6842 bits (130), Expect = 1.543e-9
Identity = 25/58 (43.10%), Postives = 31/58 (53.45%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKP 518
            K F C  C + F R D L  H R HTGE+P +C  C K+F R D  + H +IH    P
Sbjct:   41 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSGP 98          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-1 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:Q18250])

HSP 1 Score: 100.908 bits (250), Expect = 2.225e-24
Identity = 46/89 (51.69%), Postives = 58/89 (65.17%), Query Frame = 3
Query:  321 SEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            S K   + + + C  + C + F R DEL RH RIHTG++P  C  C + F RSDHL+THVR HTGEKP+ C  C R F+RSDER RH +
Sbjct:  364 SSKMPLQDRPYKCPRDGCDRRFSRSDELTRHIRIHTGQKPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTK 452          

HSP 2 Score: 58.5362 bits (140), Expect = 7.965e-10
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C  C ++F R D L  H R HTGE+P +C  C ++F RSD    H ++H
Sbjct:  402 KPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTKVH 454          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083542)

HSP 1 Score: 100.908 bits (250), Expect = 4.839e-24
Identity = 41/72 (56.94%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDE+ RH +
Sbjct: 1043 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAK 1114          

HSP 2 Score: 62.003 bits (149), Expect = 8.224e-11
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P +C  C ++F RSD    H ++H  ++
Sbjct: 1064 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 1120          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0330050)

HSP 1 Score: 100.908 bits (250), Expect = 5.132e-24
Identity = 41/72 (56.94%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDE+ RH +
Sbjct: 1043 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAK 1114          

HSP 2 Score: 62.003 bits (149), Expect = 8.620e-11
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P +C  C ++F RSD    H ++H  ++
Sbjct: 1064 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 1120          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0301615)

HSP 1 Score: 99.7525 bits (247), Expect = 1.111e-23
Identity = 41/72 (56.94%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDE+ RH +
Sbjct:  574 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAK 645          

HSP 2 Score: 61.2326 bits (147), Expect = 1.326e-10
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P +C  C ++F RSD    H ++H  ++
Sbjct:  595 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 651          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0344633)

HSP 1 Score: 99.3673 bits (246), Expect = 1.431e-23
Identity = 41/72 (56.94%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDE+ RH +
Sbjct:  763 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAK 834          

HSP 2 Score: 61.2326 bits (147), Expect = 1.536e-10
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P +C  C ++F RSD    H ++H  ++
Sbjct:  784 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 840          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083543)

HSP 1 Score: 99.3673 bits (246), Expect = 1.431e-23
Identity = 41/72 (56.94%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDE+ RH +
Sbjct:  763 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAK 834          

HSP 2 Score: 61.2326 bits (147), Expect = 1.536e-10
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P +C  C ++F RSD    H ++H  ++
Sbjct:  784 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 840          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 102.064 bits (253), Expect = 4.522e-25
Identity = 48/89 (53.93%), Postives = 60/89 (67.42%), Query Frame = 3
Query:  321 SEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            + K   R K F+C   +C++ F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH+R
Sbjct:  240 ARKGAAREKPFSCPVESCERRFSRSDELNRHVRIHTGHKPFQCRVCLRCFSRSDHLTTHMRTHTGEKPFSCDVCARRFARSDERKRHMR 328          

HSP 2 Score: 59.3066 bits (142), Expect = 5.686e-10
Identity = 25/57 (43.86%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C + F R D L  H R HTGE+P +C  C +RF RSD    H+R+H  ++
Sbjct:  278 KPFQCRVCLRCFSRSDHLTTHMRTHTGEKPFSCDVCARRFARSDERKRHMRVHLKQR 334          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 102.834 bits (255), Expect = 8.952e-25
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  317 TCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 389          

HSP 2 Score: 62.003 bits (149), Expect = 8.821e-11
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:  339 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQK 395          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 102.834 bits (255), Expect = 8.952e-25
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  317 TCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 389          

HSP 2 Score: 62.003 bits (149), Expect = 8.821e-11
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:  339 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQK 395          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 96.6709 bits (239), Expect = 8.803e-24
Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +
Sbjct:  155 CDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTK 226          

HSP 2 Score: 65.0846 bits (157), Expect = 2.844e-12
Identity = 33/54 (61.11%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  426 ERPLAC--HFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ERP  C    CD+RF RSD L+ HVRIHTG KP+QC  C R FSRSD    HIR
Sbjct:  145 ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIR 198          

HSP 3 Score: 60.077 bits (144), Expect = 2.154e-10
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C  C +SF R D L  H R HTGE+P +C FC ++F RSD    H +IH
Sbjct:  176 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIH 228          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 96.6709 bits (239), Expect = 8.803e-24
Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +
Sbjct:  155 CDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTK 226          

HSP 2 Score: 65.0846 bits (157), Expect = 2.844e-12
Identity = 33/54 (61.11%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  426 ERPLAC--HFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ERP  C    CD+RF RSD L+ HVRIHTG KP+QC  C R FSRSD    HIR
Sbjct:  145 ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIR 198          

HSP 3 Score: 60.077 bits (144), Expect = 2.154e-10
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C  C +SF R D L  H R HTGE+P +C FC ++F RSD    H +IH
Sbjct:  176 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIH 228          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 101.679 bits (252), Expect = 2.767e-24
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  313 SCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTK 385          

HSP 2 Score: 62.003 bits (149), Expect = 1.527e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:  335 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 391          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 101.293 bits (251), Expect = 3.329e-24
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  286 SCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTK 358          

HSP 2 Score: 61.6178 bits (148), Expect = 1.665e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:  308 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 364          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: tbl1x (transducin beta like 1 X-linked [Source:Xenbase;Acc:XB-GENE-982285])

HSP 1 Score: 100.138 bits (248), Expect = 5.933e-24
Identity = 48/81 (59.26%), Postives = 56/81 (69.14%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKE 608
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C YC R F+RSDER RH +  HL R KE
Sbjct:  268 CDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTK-IHL-RQKE 346          

HSP 2 Score: 65.4698 bits (158), Expect = 7.681e-12
Identity = 33/62 (53.23%), Postives = 38/62 (61.29%), Query Frame = 3
Query:  402 RHERIHTGERPLAC--HFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            R  +    ERP  C    CD+RF RSD L+ H+RIHTG KP+QC  C R FSRSD    HIR
Sbjct:  250 RPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 311          

HSP 3 Score: 61.2326 bits (147), Expect = 2.328e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC +C ++F RSD    H +IH  +K
Sbjct:  289 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 345          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: serpinb4 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:Xenbase;Acc:XB-GENE-5787878])

HSP 1 Score: 98.9821 bits (245), Expect = 1.125e-23
Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +
Sbjct:  279 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAK 350          

HSP 2 Score: 63.5438 bits (153), Expect = 3.726e-11
Identity = 27/53 (50.94%), Postives = 32/53 (60.38%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C  C +SF R D L  H R HTGE+P AC FC ++F RSD    H +IH
Sbjct:  300 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAKIH 352          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: usp31 (ubiquitin specific peptidase 31 [Source:Xenbase;Acc:XB-GENE-920956])

HSP 1 Score: 99.3673 bits (246), Expect = 2.587e-23
Identity = 45/79 (56.96%), Postives = 54/79 (68.35%), Query Frame = 3
Query:  345 KQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRH 575
            K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDE+ RH
Sbjct:  438 KAFACPVESCIRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRH 516          

HSP 2 Score: 59.3066 bits (142), Expect = 1.220e-9
Identity = 28/78 (35.90%), Postives = 42/78 (53.85%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHI 578
            K F C  C ++F R D L  H R HTGE+P +C  C +RF RSD    H ++H  +K           +R++E+L+ +
Sbjct:  468 KPFQCRICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRHGKVHMKQK-----------ARTEEKLKGL 534          

HSP 3 Score: 56.9954 bits (136), Expect = 5.863e-9
Identity = 29/54 (53.70%), Postives = 34/54 (62.96%), Query Frame = 3
Query:  426 ERPLACHF--CDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            E+  AC    C + F RSD L+ H+RIHTG KP+QC  C R FSRSD    HIR
Sbjct:  437 EKAFACPVESCIRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHIR 490          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr4 (early growth response 4 [Source:MGI Symbol;Acc:MGI:99252])

HSP 1 Score: 106.301 bits (264), Expect = 5.050e-26
Identity = 51/107 (47.66%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  342 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENVF*RFSDIFYYFMYI 656
            +K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+THVR HTGEKP+ C  C R F+RSDE+ RH  + HL + K     R   + +Y + +
Sbjct:  369 VKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH-SKVHL-KQKARAEERLKGLGFYSLGL 473          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 101.679 bits (252), Expect = 2.423e-24
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  342 SCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTK 414          

HSP 2 Score: 61.6178 bits (148), Expect = 1.488e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:  364 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 420          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 101.679 bits (252), Expect = 2.423e-24
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  342 SCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTK 414          

HSP 2 Score: 61.6178 bits (148), Expect = 1.488e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:  364 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 420          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr3 (early growth response 3 [Source:MGI Symbol;Acc:MGI:1306780])

HSP 1 Score: 99.7525 bits (247), Expect = 4.358e-24
Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +
Sbjct:  282 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAK 353          

HSP 2 Score: 65.4698 bits (158), Expect = 5.207e-12
Identity = 28/57 (49.12%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P AC FC ++F RSD    H +IH  +K
Sbjct:  303 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 359          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr2 (early growth response 2 [Source:MGI Symbol;Acc:MGI:95296])

HSP 1 Score: 100.523 bits (249), Expect = 5.405e-24
Identity = 48/81 (59.26%), Postives = 56/81 (69.14%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKE 608
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C YC R F+RSDER RH +  HL R KE
Sbjct:  344 CDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTK-IHL-RQKE 422          

HSP 2 Score: 65.855 bits (159), Expect = 5.425e-12
Identity = 32/54 (59.26%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  426 ERPLAC--HFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ERP  C    CD+RF RSD L+ H+RIHTG KP+QC  C R FSRSD    HIR
Sbjct:  334 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 387          

HSP 3 Score: 60.8474 bits (146), Expect = 2.164e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC +C ++F RSD    H +IH  +K
Sbjct:  365 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 421          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9WUF2|EGR4_MOUSE (Early growth response protein 4 OS=Mus musculus OX=10090 GN=Egr4 PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 3.533e-25
Identity = 51/107 (47.66%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  342 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENVF*RFSDIFYYFMYI 656
            +K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+THVR HTGEKP+ C  C R F+RSDE+ RH  + HL + K     R   + +Y + +
Sbjct:  369 VKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH-SKVHL-KQKARAEERLKGLGFYSLGL 473          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|Q00911|EGR4_RAT (Early growth response protein 4 OS=Rattus norvegicus OX=10116 GN=Egr4 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 9.698e-25
Identity = 50/107 (46.73%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  342 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENVF*RFSDIFYYFMYI 656
            +K F C   +C ++F R DEL RH RIHTG +P  C  C + F RSDHL+THVR HTGEKP+ C  C R F+RSDE+ RH  + HL + K     R   + +Y + +
Sbjct:  369 VKAFACPVESCVRTFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH-SKVHL-KQKARAEERLKGLGFYSLGL 473          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9GL32|EGR4_BOVIN (Early growth response protein 4 OS=Bos taurus OX=9913 GN=EGR4 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.255e-24
Identity = 51/107 (47.66%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  342 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENVF*RFSDIFYYFMYI 656
             K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+THVR HTGEKP+ C  C R F+RSDE+ RH  + HL + K     R   + +Y + +
Sbjct:  373 AKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH-SKVHL-KQKARAEERLKGLGFYSLGL 477          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|O73693|EGR1_TAEGU (Early growth response protein 1 (Fragment) OS=Taeniopygia guttata OX=59729 GN=EGR1 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.342e-24
Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTK 72          

HSP 2 Score: 59.6918 bits (143), Expect = 1.022e-9
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:   22 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 78          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|Q05215|EGR4_HUMAN (Early growth response protein 4 OS=Homo sapiens OX=9606 GN=EGR4 PE=1 SV=3)

HSP 1 Score: 103.99 bits (258), Expect = 2.873e-24
Identity = 51/107 (47.66%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  342 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENVF*RFSDIFYYFMYI 656
             K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+THVR HTGEKP+ C  C R F+RSDE+ RH  + HL + K     R   + +Y + +
Sbjct:  480 AKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH-SKVHL-KQKARAEERLKGLGFYSLGL 584          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: G1CSV5 (EGR-like protein 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 7.929e-135
Identity = 186/186 (100.00%), Postives = 186/186 (100.00%), Query Frame = 3
Query:   36 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 593
            MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL
Sbjct:    1 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 186          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: I1ZI70 (Early growth response-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 5.259e-99
Identity = 144/197 (73.10%), Postives = 164/197 (83.25%), Query Frame = 3
Query:   36 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKL-------NPNTKKSLRII----SSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 593
            MV+NIQKLTL VKIDK EF+EIQTGYTPLPGIHESFYL+NTENW+NLKTPSPMDC ++EF+ IY S++D+  +ST +         N+ KSL +I    SSPLSE S KSQ R++QF CNTCKK+FYRRDELKRHERIHTGERPLAC+FCDKRFMRSDHLSTH RIHTGEKPY+C+ C RLF RSDERLRH RQ HL
Sbjct:    1 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCSSPLSENSSKSQNRVRQFMCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 197          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: T1DF98 (Egrl-3 (Fragment) OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.187e-75
Identity = 112/187 (59.89%), Postives = 143/187 (76.47%), Query Frame = 3
Query:   42 KNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRII----SSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            KN++KL L VKIDK EF  I TGYTPLPG+H+SFY ++T NW+N+KTPSPMDC+++EF+  Y S +++N  ST +  +++ +L        SP SE S KSQ + K+F C+TC KSF RRDELKRHERIH+GERPL+C +C+KRFMRSDH +TH+RIHTGEKPY C +C   F RSDERLRH+R  H
Sbjct:    1 KNLRKLKLSVKIDKTEFENIHTGYTPLPGVHQSFYCNDTINWNNIKTPSPMDCDDIEFILFYNSNEENNVISTVVPVSSENTLTYTFSQCGSPKSETSSKSQLKRKEFPCSTCTKSFSRRDELKRHERIHSGERPLSCDYCNKRFMRSDHRATHLRIHTGEKPYHCHFCPISFGRSDERLRHMRLNH 187          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: T1E116 (Egrl-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 4.475e-63
Identity = 98/185 (52.97%), Postives = 130/185 (70.27%), Query Frame = 3
Query:   36 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            MV+N+  + L VKID  EF+   TGYTP PG+H+SFY ++T    N+KTPSP+DC ++EF+ +Y S ++     +K++     +  +I  P ++    SQ   K+F C+TC K F+RRDEL+RH RIH+GERPLAC FCDKRFMRSDH +TH RIHTGEKPY+C +C   F RSDERLRH+R  H
Sbjct:    1 MVRNV--IQLSVKIDLSEFDNFHTGYTPFPGVHQSFYGNDTTQIDNIKTPSPIDCKDIEFILVYSSTEEK----SKMSSEEHFTFSMIPKPKTD----SQTMKKKFICSTCMKPFFRRDELRRHGRIHSGERPLACDFCDKRFMRSDHRTTHRRIHTGEKPYKCHFCASSFGRSDERLRHMRVNH 175          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: I1ZI72 (Early growth response-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.371e-27
Identity = 52/90 (57.78%), Postives = 67/90 (74.44%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENV 614
            + F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH+R HTGEKPY C  C + F+RSDE+LRH R     ++K+N+
Sbjct:  197 RNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKKNI 286          

HSP 2 Score: 63.929 bits (154), Expect = 3.385e-8
Identity = 28/52 (53.85%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  426 ERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ER   C FC  +F R D L  H +IH+GEKP  C YCD+ F RSD R  HIR
Sbjct:  196 ERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIR 247          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 103.605 bits (257), Expect = 9.666e-26
Identity = 48/83 (57.83%), Postives = 56/83 (67.47%), Query Frame = 3
Query:  339 RIKQFTCNT--CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            R K F C    C++ F R DEL RH R+HTG RP  C  C +RF RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH R
Sbjct:  233 REKPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHAR 315          

HSP 2 Score: 58.9214 bits (141), Expect = 7.563e-10
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            + F C  C + F R D L  H R HTGE+P +C  C +RF RSD    H R+H  ++
Sbjct:  265 RPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIKQR 321          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 103.605 bits (257), Expect = 1.406e-25
Identity = 48/83 (57.83%), Postives = 56/83 (67.47%), Query Frame = 3
Query:  339 RIKQFTCNT--CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            R K F C    C++ F R DEL RH R+HTG RP  C  C +RF RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH R
Sbjct:  272 REKPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHAR 354          

HSP 2 Score: 58.9214 bits (141), Expect = 7.918e-10
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            + F C  C + F R D L  H R HTGE+P +C  C +RF RSD    H R+H  ++
Sbjct:  304 RPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIKQR 360          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:103036296])

HSP 1 Score: 101.679 bits (252), Expect = 1.752e-24
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  324 TCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 396          

HSP 2 Score: 60.8474 bits (146), Expect = 1.955e-10
Identity = 25/53 (47.17%), Postives = 31/53 (58.49%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH
Sbjct:  346 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIH 398          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:103035480])

HSP 1 Score: 99.3673 bits (246), Expect = 7.111e-24
Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +
Sbjct:  309 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAK 380          

HSP 2 Score: 67.0106 bits (162), Expect = 1.485e-12
Identity = 33/54 (61.11%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  426 ERPLACHF--CDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ERP AC    CD+RF RSD L+ H+RIHTG KP+QC  C R FSRSD    HIR
Sbjct:  299 ERPHACPAENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 352          

HSP 3 Score: 62.7734 bits (151), Expect = 3.687e-11
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P +C FC ++F RSD    H ++H  +K
Sbjct:  330 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQK 386          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:103046494])

HSP 1 Score: 98.5969 bits (244), Expect = 1.221e-23
Identity = 47/81 (58.02%), Postives = 56/81 (69.14%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKE 608
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +  HL R KE
Sbjct:  303 CDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTK-IHL-RQKE 381          

HSP 2 Score: 65.4698 bits (158), Expect = 4.288e-12
Identity = 32/54 (59.26%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  426 ERPLAC--HFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ERP  C    CD+RF RSD L+ H+RIHTG KP+QC  C R FSRSD    HIR
Sbjct:  293 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 346          

HSP 3 Score: 62.3882 bits (150), Expect = 5.467e-11
Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC FC ++F RSD    H +IH  +K
Sbjct:  324 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQK 380          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 100.523 bits (249), Expect = 8.048e-26
Identity = 47/87 (54.02%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  327 KSQFRIKQFTCNT--CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K+    + F C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+THVR HTGEKP+ C +C R F+RSDER RH R
Sbjct:  164 KTPPHARPFPCPAEGCDRRFSRTDELTRHIRIHTGHKPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGR 250          

HSP 2 Score: 67.0106 bits (162), Expect = 1.701e-13
Identity = 30/53 (56.60%), Postives = 33/53 (62.26%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K FTC  C +SF R D L  H R HTGE+P AC FC +RF RSD    H RIH
Sbjct:  200 KPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGRIH 252          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005225.1 (pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1 gene:ENSPMAG00000004710.1 transcript:ENSPMAT00000005225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 4.822e-22
Identity = 41/90 (45.56%), Postives = 58/90 (64.44%), Query Frame = 3
Query:  321 SEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            S  S+ + + + C+ C KSF +  +L+RH RIHTGERP  C  CDK F +++ L  H++ HTGEKPY+C YCD  FS+      HI++ H
Sbjct: 1681 SSASRQKPRLYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 2 Score: 74.7146 bits (182), Expect = 9.966e-16
Identity = 32/78 (41.03%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHI 578
            + + C  C K F +   LK+H R HTGE+P  C  C + F+ S  L  H+R HTGEK Y+C  CD  F+ +    RH+
Sbjct:  953 RSYRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHM 1030          

HSP 3 Score: 73.9442 bits (180), Expect = 1.874e-15
Identity = 33/78 (42.31%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  357 CNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            C  C K+F +  +L RH RIHTGERP  C  C + F +   L  H   HTGE+PY+C++C   FS+      HI++ H
Sbjct:  165 CEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVH 242          

HSP 4 Score: 68.9366 bits (167), Expect = 9.188e-14
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHI 578
            + C  C K+F +   LK+H R HTGE+P  C  C + F+ S  L  H+R H G K Y+C  CD  F+ +    RH+
Sbjct:  635 YRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHM 710          

HSP 5 Score: 67.781 bits (164), Expect = 2.239e-13
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHI 578
            K + C  C ++F  +  L  H + HTG +   C  CDK F     L  H+R+HTG KP+ C +C++ F  S  R  HI
Sbjct:  482 KPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHI 559          

HSP 6 Score: 62.003 bits (149), Expect = 2.042e-11
Identity = 31/80 (38.75%), Postives = 41/80 (51.25%), Query Frame = 3
Query:  342 IKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ++   C  C K F +  +L RH RIHT E+P  C  C + F     L+ H + HTG K + C  CD+LFS       HIR
Sbjct:  453 VRWHMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIR 532          

HSP 7 Score: 61.6178 bits (148), Expect = 3.105e-11
Identity = 28/79 (35.44%), Postives = 40/79 (50.63%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K F C  C + F     LK H R HTGE+   C  CD  F  +  L+ H+ +HT   P++C +C+  F  S    +H+R
Sbjct:  981 KPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMVMHTSMHPFKCPFCEESFRTSLHCRKHMR 1059          

HSP 8 Score: 60.4622 bits (145), Expect = 7.798e-11
Identity = 28/56 (50.00%), Postives = 35/56 (62.50%), Query Frame = 3
Query:  426 ERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 593
            +RP  C +C+K F +S HL  H+R HTGEKPY+C  C R F  S     HIR TH+
Sbjct:  632 DRPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIR-THV 686          

HSP 9 Score: 58.5362 bits (140), Expect = 2.834e-10
Identity = 25/70 (35.71%), Postives = 39/70 (55.71%), Query Frame = 3
Query:  372 KSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +S   +  L  H + HTG++   CH C+  F     L  H+R+HTG KP++C +C++ F  S  R  HI+
Sbjct: 1181 RSITVKSTLDCHVKTHTGQKHFKCHICNSPFSTKGSLKVHMRLHTGAKPFKCPHCEQRFRTSGHRKSHIQ 1250          

HSP 10 Score: 58.151 bits (139), Expect = 4.719e-10
Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHV-RIHTGEKP------YQCSYCDRLFSRSDERLRHIRQTH 590
            FTC  C ++F ++  L+ H+  HTGERP  C FC   F +  +L  H+ R+H+  KP      +QC  C  +F +      HI + H
Sbjct:  191 FTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGEQPVFQCEDCSCVFKKLGSLNAHISRMH 277          

HSP 11 Score: 55.8398 bits (133), Expect = 2.661e-9
Identity = 25/79 (31.65%), Postives = 37/79 (46.84%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K + C  C +SF     LK H R H G +   C  CD  F  +  L  H+  H+  +P+ C YC + F  S    +H++
Sbjct:  661 KPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHMK 739          

HSP 12 Score: 54.6842 bits (130), Expect = 6.106e-9
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 3
Query:  441 CHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C +C+K F +S HL  HVR HTGEKP++C+ C R F  S     H+R
Sbjct:  957 CGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMR 1003          

HSP 13 Score: 51.2174 bits (121), Expect = 7.447e-8
Identity = 23/59 (38.98%), Postives = 33/59 (55.93%), Query Frame = 3
Query:  327 KSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K+   +K+F C  C K F  +  LK H R+HTG +P  C  C+K+F  S H  +H+  H
Sbjct:  504 KTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHIASH 562          

HSP 14 Score: 50.8322 bits (120), Expect = 1.125e-7
Identity = 21/53 (39.62%), Postives = 30/53 (56.60%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C+ C   F  +  LK H R+HTG +P  C  C++RF  S H  +H++ H
Sbjct: 1200 KHFKCHICNSPFSTKGSLKVHMRLHTGAKPFKCPHCEQRFRTSGHRKSHIQSH 1252          

HSP 15 Score: 46.595 bits (109), Expect = 2.872e-6
Identity = 24/56 (42.86%), Postives = 32/56 (57.14%), Query Frame = 3
Query:  423 GERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            G R   C +C+K F +   L  H+RIHT EKPY+C+ C R F+       H R+TH
Sbjct:  452 GVRWHMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAH-RKTH 506          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000923.1 (pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 gene:ENSPMAG00000000839.1 transcript:ENSPMAT00000000923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 2.486e-21
Identity = 35/81 (43.21%), Postives = 49/81 (60.49%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQT 587
            + + C  C + F R    +RH R+HTGERP AC  C +RF +  HL+ H R+HTGE+PY C+ C R F++     RH+R  
Sbjct:   20 RPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRFAKPYSLTRHLRSA 100          

HSP 2 Score: 58.151 bits (139), Expect = 1.380e-11
Identity = 27/57 (47.37%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  411 RIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            R HTGERP AC  C +RF R  +   H R+HTGE+PY C+ C R F +      H R
Sbjct:   14 RNHTGERPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAHTR 70          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007569.1 (pep scaffold:Pmarinus_7.0:GL477836:135382:139743:-1 gene:ENSPMAG00000006836.1 transcript:ENSPMAT00000007569.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 2.668e-20
Identity = 51/136 (37.50%), Postives = 68/136 (50.00%), Query Frame = 3
Query:  216 VFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQ--------------FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            V +Y  ED    FS   +    + +     P S       FR+KQ              F C+ C + F  +  L+ H R HTGERP AC FCD+RF+RSD+L+ H RIHTGE+P+ C  C + FS S    +H R
Sbjct:   87 VNLYACEDCGKKFSLSHDLTRHRRIHTGERPFSCRDCGMTFRLKQHLRRHQKTHEGEAPFRCDHCGRLFMHKRSLRIHVRNHTGERPYACDFCDQRFLRSDNLTRHRRIHTGERPFGCERCGKRFSCSHHLTQHRR 222          

HSP 2 Score: 69.3218 bits (168), Expect = 1.801e-14
Identity = 34/80 (42.50%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            + C+ C + F R D L RH RIHTGERP  C  C KRF  S HL+ H R  T   P+ C+ C ++F +  + L + +Q H
Sbjct:  174 YACDFCDQRFLRSDNLTRHRRIHTGERPFGCERCGKRFSCSHHLTQHRRSCTMTAPFTCTLCGQMFGKKSDSLGYHQQLH 253          

HSP 3 Score: 65.855 bits (159), Expect = 3.691e-13
Identity = 33/66 (50.00%), Postives = 40/66 (60.61%), Query Frame = 3
Query:  354 TCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGE-KPYQCSYCDRLF 548
             C  C   F +  E+ RH RIHTGE+P AC  C +RF  S+ L+ H RIHTGE KP+QC  C   F
Sbjct:    6 ACEVCGALFRKACEVTRHRRIHTGEKPFACEKCGRRFTWSNSLARHRRIHTGESKPFQCGDCGHRF 71          

HSP 4 Score: 65.4698 bits (158), Expect = 3.727e-13
Identity = 32/86 (37.21%), Postives = 44/86 (51.16%), Query Frame = 3
Query:  324 EKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +++   +  + C  C K F    +L RH RIHTGERP +C  C   F    HL  H + H GE P++C +C RLF        H+R
Sbjct:   81 QRTHTGVNLYACEDCGKKFSLSHDLTRHRRIHTGERPFSCRDCGMTFRLKQHLRRHQKTHEGEAPFRCDHCGRLFMHKRSLRIHVR 166          

HSP 5 Score: 56.9954 bits (136), Expect = 3.889e-10
Identity = 34/82 (41.46%), Postives = 43/82 (52.44%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            K F C  C   F      +RH+R HTG    AC  C K+F  S  L+ H RIHTGE+P+ C  C   F R  + LR  ++TH
Sbjct:   60 KPFQCGDCGHRFRNVISFRRHQRTHTGVNLYACEDCGKKFSLSHDLTRHRRIHTGERPFSCRDCGMTF-RLKQHLRRHQKTH 140          

HSP 6 Score: 53.9138 bits (128), Expect = 5.291e-9
Identity = 33/80 (41.25%), Postives = 38/80 (47.50%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGE-RPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K F C  C + F   + L RH RIHTGE +P  C  C  RF        H R HTG   Y C  C + FS S +  RH R
Sbjct:   31 KPFACEKCGRRFTWSNSLARHRRIHTGESKPFQCGDCGHRFRNVISFRRHQRTHTGVNLYACEDCGKKFSLSHDLTRHRR 110          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005004.1 (pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 gene:ENSPMAG00000004537.1 transcript:ENSPMAT00000005004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 6.532e-20
Identity = 36/82 (43.90%), Postives = 53/82 (64.63%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            K + C+ C   F ++  L+RHE+IH+GE+P  C  C  RF++  HL  H R H+GEKPY+C YC + +SR+D+  +H R  H
Sbjct:   32 KAYQCSQCTMRFIQKYLLQRHEKIHSGEKPFTCEQCGMRFIQKYHLERHKRTHSGEKPYECDYCHQYYSRTDQLAKHKRMCH 113          

HSP 2 Score: 54.6842 bits (130), Expect = 4.113e-9
Identity = 26/72 (36.11%), Postives = 41/72 (56.94%), Query Frame = 3
Query:  285 SLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRI 500
            ++R I   L +  EK     K FTC  C   F ++  L+RH+R H+GE+P  C +C + + R+D L+ H R+
Sbjct:   40 TMRFIQKYLLQRHEKIHSGEKPFTCEQCGMRFIQKYHLERHKRTHSGEKPYECDYCHQYYSRTDQLAKHKRM 111          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 83.5741 bits (205), Expect = 6.317e-19
Identity = 36/85 (42.35%), Postives = 50/85 (58.82%), Query Frame = 3
Query:  327 KSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K   + K + C TCK+ F   + L +H R H+GE+P  CH C+K+F  S  L  H+R HTGEKP QC  C + F+ S    +HI+
Sbjct:  760 KVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 844          

HSP 2 Score: 60.077 bits (144), Expect = 4.818e-11
Identity = 27/72 (37.50%), Postives = 42/72 (58.33%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C ++F +R +L RH ++H+  +P  C  C + F   + L  H R H+GEKPY+C  C++ F+ S     HIR
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIR 816          

HSP 3 Score: 45.4394 bits (106), Expect = 3.458e-6
Identity = 29/86 (33.72%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  345 KQFTC--NTCKKSFYRRDELKRH-ERIHT--GERPLAC--HFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +Q  C  + C KSF    EL  H E +H   G+    C  H C + F +   L  H+++H+  KPY+C  C R FS  +  ++H R
Sbjct:  703 EQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR 788          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 77.7962 bits (190), Expect = 5.661e-17
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  342 IKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHI 578
            +K+  C  C + F +   L+ H R H G +P  C +C KRF +  +L TH R+HTGEKPY C  CD+ FSR      H+
Sbjct:  590 VKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668          

HSP 2 Score: 72.0182 bits (175), Expect = 4.855e-15
Identity = 31/82 (37.80%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  315 EISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSY--CDRLFSR 554
            E+  +S    K F C+ C K F +   L+ HER+HTGE+P +C  CDK+F R  +L+ H+  H   KP+ C    C++ F++
Sbjct:  609 EVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQ 690          

HSP 3 Score: 45.8246 bits (107), Expect = 3.009e-6
Identity = 18/47 (38.30%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  441 CHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C +C + F ++ HL  HVR H G KP+ C YC + F++      H R
Sbjct:  595 CPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHER 641          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: MSN2 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes; relative distribution to nucleus increases upon DNA replication stress [Source:SGD;Acc:S000004640])

HSP 1 Score: 72.0182 bits (175), Expect = 4.640e-15
Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 3
Query:  318 ISEKSQFRIKQFTCNTCKKSFYRRDELKRHER-IHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            I    +   K F C+ C KSF R + LKRH R +H+ ERP ACH CDK+F RSD+LS H++ H
Sbjct:  636 IESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTH 698          

HSP 2 Score: 64.3142 bits (155), Expect = 1.682e-12
Identity = 27/53 (50.94%), Postives = 36/53 (67.92%), Query Frame = 3
Query:  426 ERPLACHFCDKRFMRSDHLSTHVR-IHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            E+P  CH C K F RS+HL  HVR +H+ E+P+ C  CD+ FSRSD   +HI+
Sbjct:  644 EKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: MSN4 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes, inducing gene expression; involved in diauxic shift [Source:SGD;Acc:S000001545])

HSP 1 Score: 67.0106 bits (162), Expect = 1.997e-13
Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHER-IHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C  C+K+F R + LKRH R +H+ ERP AC FC+K+F RSD+LS H++ H
Sbjct:  571 KPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTH 624          

HSP 2 Score: 56.9954 bits (136), Expect = 4.691e-10
Identity = 22/52 (42.31%), Postives = 36/52 (69.23%), Query Frame = 3
Query:  429 RPLACHFCDKRFMRSDHLSTHVR-IHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            +P  C  C+K F RS+HL  H+R +H+ E+P+ C +C++ FSRSD   +H++
Sbjct:  571 KPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 65.0846 bits (157), Expect = 9.584e-13
Identity = 34/86 (39.53%), Postives = 40/86 (46.51%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCS---------YCDRLFSRSDERLRHIR 581
            F C+ C K F R   LK H R HT ERP  C  C K F R      H  +HTG+K Y C           C + F+RSD   RH +
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654          

HSP 2 Score: 49.6766 bits (117), Expect = 1.567e-7
Identity = 23/64 (35.94%), Postives = 34/64 (53.12%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHF---------CDKRFMRSDHLSTHVRIHTGEK 515
            F C+ C K+F R+ + KRHE +HTG++   C           C K+F RSD L  H +  +G +
Sbjct:  597 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRR 660          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO49112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT8])

HSP 1 Score: 93.2041 bits (230), Expect = 9.207e-25
Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            TC + F R DEL RH R HTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH++
Sbjct:   10 TCPRRFSRSDELTRHMRTHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMK 82          

HSP 2 Score: 56.225 bits (134), Expect = 9.853e-11
Identity = 27/56 (48.21%), Postives = 33/56 (58.93%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGE 512
            K F C  C ++F R D L  H R HTGE+P AC  C +RF RSD    H++IH  E
Sbjct:   32 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMKIHLRE 87          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO32891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS3])

HSP 1 Score: 85.5001 bits (210), Expect = 2.600e-20
Identity = 59/200 (29.50%), Postives = 88/200 (44.00%), Query Frame = 3
Query:   27 SIKMVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSP-MDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEIS--EKSQFRI---------KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            ++ +V+   KL      D L+  E+   Y           +   E   +     P   C     +F YE   D +   T+   N     R    PL + S  ++ + RI         +   C+ C+K F +   L +H R+H+GERP  C FCDK F  S  L TH+R H+GEKP++C YC R F+       H+R+TH
Sbjct:   11 NVNLVQRGTKLYYETSRDVLQGEELLVWYGEGHVTMMGLPIGLAEKAKDATQNGPSFPCERCGKLFAYEYYRDKHLKYTRCLDNGD---RRFPCPLCDRSFDKRDRLRIHVLHVHEKHRPHECHVCQKRFSQSSSLNKHMRVHSGERPYKCTFCDKAFTASSILRTHIRQHSGEKPFKCKYCGRAFASHAAHDSHVRRTH 207          

HSP 2 Score: 47.3654 bits (111), Expect = 1.285e-6
Identity = 26/81 (32.10%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHV-RIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            + C  C K+F     L+ H R H+GE+P  C +C + F       +HV R HT ++ + C  C ++F+   + L + R TH
Sbjct:  156 YKCTFCDKAFTASSILRTHIRQHSGEKPFKCKYCGRAFASHAAHDSHVRRTHTRDQTWTCEVCGQVFTDMTQ-LHYHRNTH 235          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO43177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ64])

HSP 1 Score: 82.0333 bits (201), Expect = 1.596e-19
Identity = 39/89 (43.82%), Postives = 56/89 (62.92%), Query Frame = 3
Query:  327 KSQFRI----KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K+  R+    K F C TC+KSF +   LK H R+H+ E+P  CH C +RF +S  ++TH+RIH+GE+PY+C  C R FS S    + +R
Sbjct:   50 KAHLRVHTGKKPFRCPTCQKSFSQDANLKAHLRVHSKEKPFKCHICHRRFAQSSSVTTHMRIHSGERPYKCKVCARGFSDSSTLTKRLR 138          

HSP 2 Score: 68.9366 bits (167), Expect = 1.326e-14
Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
             TC+ C K + R   LK H R+HTG++P  C  C K F +  +L  H+R+H+ EKP++C  C R F++S     H+R
Sbjct:   34 ITCHVCHKIYSRPSTLKAHLRVHTGKKPFRCPTCQKSFSQDANLKAHLRVHSKEKPFKCHICHRRFAQSSSVTTHMR 110          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO46333 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB7])

HSP 1 Score: 83.1889 bits (204), Expect = 8.620e-19
Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  357 CNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTH 590
            C+ CKK F +   L +H R+H+GERP  C +CDK F  S  L TH+R H+GEKP++C +C R F+       H+R+TH
Sbjct:  219 CHVCKKRFSQSSSLNKHMRVHSGERPYKCTYCDKAFTASSILRTHIRQHSGEKPFKCKHCGRAFASHAAHDSHVRRTH 296          

HSP 2 Score: 79.7221 bits (195), Expect = 1.512e-17
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHE-RIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQ 584
            ++F C  C +SF +RD L+ H   +H   RP  CH C KRF +S  L+ H+R+H+GE+PY+C+YCD+ F+ S     HIRQ
Sbjct:  186 RRFPCEQCDRSFDKRDRLRIHVLHVHEKHRPHECHVCKKRFSQSSSLNKHMRVHSGERPYKCTYCDKAFTASSILRTHIRQ 266          

HSP 3 Score: 55.8398 bits (133), Expect = 2.796e-9
Identity = 30/77 (38.96%), Postives = 40/77 (51.95%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHV-RIHTGEKPYQCSYCDRLFSRSDERLRHI 578
            + C  C K+F     L+ H R H+GE+P  C  C + F       +HV R HT EKP  C YC + F++S E   HI
Sbjct:  245 YKCTYCDKAFTASSILRTHIRQHSGEKPFKCKHCGRAFASHAAHDSHVRRTHTKEKPCICEYCGKAFAQSYELKFHI 321          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO40036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B6])

HSP 1 Score: 80.8777 bits (198), Expect = 1.465e-18
Identity = 40/89 (44.94%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  327 KSQFRI----KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K   RI    K +TC  C++SF     L +H R HTGERP  C  CDK F +S  L  H+R+HTGEKPY C  C+R F++      H+R
Sbjct:  105 KGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMRVHTGEKPYPCPLCERAFAKGYNLKTHMR 193          

HSP 2 Score: 80.8777 bits (198), Expect = 1.640e-18
Identity = 33/78 (42.31%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQ 584
            + C  C K+F +   LK H R+HTGE+P  C  C++ F +  +L TH+R HTGEKPY+C +C +LFS+    ++H+++
Sbjct:  145 YKCKECDKAFSQSGGLKVHMRVHTGEKPYPCPLCERAFAKGYNLKTHMRTHTGEKPYKCDFCSKLFSQHSTLMQHVQR 222          

HSP 3 Score: 76.6406 bits (187), Expect = 5.005e-17
Identity = 37/79 (46.84%), Postives = 47/79 (59.49%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K+  C+TC K F     LK H RIHTGE+P  C FC + F     L+ H R HTGE+PY+C  CD+ FS+S     H+R
Sbjct:   87 KEHKCDTCGKQFNSFANLKGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMR 165          

HSP 4 Score: 56.225 bits (134), Expect = 1.230e-9
Identity = 29/77 (37.66%), Postives = 40/77 (51.95%), Query Frame = 3
Query:  351 FTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            + C+ C +    R  L  H RIH  ++   C  C K+F    +L  H+RIHTGEKPY C +C R F+      +H R
Sbjct:   61 YQCHHCPEKLKLRCHLNYHLRIHAPKKEHKCDTCGKQFNSFANLKGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRR 137          

HSP 5 Score: 50.0618 bits (118), Expect = 1.541e-7
Identity = 24/58 (41.38%), Postives = 32/58 (55.17%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKP 518
            K + C  C+++F +   LK H R HTGE+P  C FC K F +   L  HV+ H G  P
Sbjct:  171 KPYPCPLCERAFAKGYNLKTHMRTHTGEKPYKCDFCSKLFSQHSTLMQHVQRHQGNAP 228          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: ENSORLT00000000940.2 (early growth response protein 1 [Source:NCBI gene;Acc:101160576])

HSP 1 Score: 102.064 bits (253), Expect = 1.047e-24
Identity = 42/75 (56.00%), Postives = 54/75 (72.00%), Query Frame = 3
Query:  357 CNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
             + C++ F R DEL RH R+HTG++P  C  C + F RSDHL+TH+R HTGEKP+ CS C R F+RSDER RH +
Sbjct:  287 ADGCERRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFPCSECGRKFARSDERKRHAK 361          

HSP 2 Score: 58.9214 bits (141), Expect = 7.733e-10
Identity = 25/53 (47.17%), Postives = 30/53 (56.60%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K F C  C +SF R D L  H R HTGE+P  C  C ++F RSD    H +IH
Sbjct:  311 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFPCSECGRKFARSDERKRHAKIH 363          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100272163])

HSP 1 Score: 102.064 bits (253), Expect = 1.554e-24
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  363 TCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH +
Sbjct:  319 TCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 391          

HSP 2 Score: 61.6178 bits (148), Expect = 1.152e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    H +IH  +K
Sbjct:  341 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQK 397          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: ENSORLT00000034291.1 (early growth response protein 2b [Source:NCBI gene;Acc:101164744])

HSP 1 Score: 98.9821 bits (245), Expect = 7.157e-24
Identity = 56/136 (41.18%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  213 FVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQ--FTC--NTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKE 608
            F     S       +     +    LR I  P    +  S+  + Q  + C   +C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C  C R F+RSDER RH++  HL R KE
Sbjct:  256 FTLAAPSSAAEGPMAAAFPAHQNLPLRPILRPRKYPNRPSKTPVHQRPYPCPAESCDRRFSRSDELSRHLRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCQQCGRKFARSDERRRHMK-IHL-RQKE 389          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:100272164])

HSP 1 Score: 99.3673 bits (246), Expect = 7.282e-24
Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +
Sbjct:  303 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAK 374          

HSP 2 Score: 66.6254 bits (161), Expect = 1.695e-12
Identity = 33/54 (61.11%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  426 ERPLACHF--CDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ERP AC    CD+RF RSD L+ H+RIHTG KP+QC  C R FSRSD    HIR
Sbjct:  293 ERPHACPAENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 346          

HSP 3 Score: 62.7734 bits (151), Expect = 3.957e-11
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C +SF R D L  H R HTGE+P +C FC ++F RSD    H ++H  +K
Sbjct:  324 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQK 380          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:101170128])

HSP 1 Score: 98.5969 bits (244), Expect = 1.733e-23
Identity = 47/81 (58.02%), Postives = 56/81 (69.14%), Query Frame = 3
Query:  366 CKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKE 608
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH+R HTGEKP+ C +C R F+RSDER RH +  HL R KE
Sbjct:  337 CDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTK-IHL-RQKE 415          

HSP 2 Score: 65.4698 bits (158), Expect = 4.709e-12
Identity = 32/54 (59.26%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  426 ERPLAC--HFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ERP  C    CD+RF RSD L+ H+RIHTG KP+QC  C R FSRSD    HIR
Sbjct:  327 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 380          

HSP 3 Score: 62.003 bits (149), Expect = 6.991e-11
Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEK 515
            K F C  C ++F R D L  H R HTGE+P AC FC ++F RSD    H +IH  +K
Sbjct:  358 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQK 414          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000000960.1 (SMESG000000960.1)

HSP 1 Score: 386.341 bits (991), Expect = 2.205e-138
Identity = 186/186 (100.00%), Postives = 186/186 (100.00%), Query Frame = 3
Query:   36 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 593
            MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL
Sbjct:    1 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 186          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000000959.1 (SMESG000000959.1)

HSP 1 Score: 298.13 bits (762), Expect = 2.153e-103
Identity = 145/197 (73.60%), Postives = 165/197 (83.76%), Query Frame = 3
Query:   36 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKL-------NPNTKKSLRII----SSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 593
            MV+NIQKLTL VKIDK EF+EIQTGYTPLPGIHESFYL+NTENW+NLKTPSPMDC ++EF+ IY S++D+  +ST +         N+ KSL +I    SSPLSE S KSQ R++QFTCNTCKK+FYRRDELKRHERIHTGERPLAC+FCDKRFMRSDHLSTH RIHTGEKPY+C+ C RLF RSDERLRH RQ HL
Sbjct:    1 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 197          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 116.316 bits (290), Expect = 5.070e-31
Identity = 52/90 (57.78%), Postives = 67/90 (74.44%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENV 614
            + F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH+R HTGEKPY C  C + F+RSDE+LRH R     ++K+N+
Sbjct:  176 RNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKKNI 265          

HSP 2 Score: 63.929 bits (154), Expect = 8.578e-12
Identity = 28/52 (53.85%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  426 ERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ER   C FC  +F R D L  H +IH+GEKP  C YCD+ F RSD R  HIR
Sbjct:  175 ERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIR 226          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 116.316 bits (290), Expect = 9.019e-31
Identity = 52/90 (57.78%), Postives = 67/90 (74.44%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*RTKENV 614
            + F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH+R HTGEKPY C  C + F+RSDE+LRH R     ++K+N+
Sbjct:  201 RNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKKNI 290          

HSP 2 Score: 63.929 bits (154), Expect = 1.035e-11
Identity = 28/52 (53.85%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  426 ERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            ER   C FC  +F R D L  H +IH+GEKP  C YCD+ F RSD R  HIR
Sbjct:  200 ERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIR 251          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000042500.1 (SMESG000042500.1)

HSP 1 Score: 116.316 bits (290), Expect = 3.774e-30
Identity = 49/79 (62.03%), Postives = 62/79 (78.48%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 581
            K F C+TC   F RRDEL+RHE+IH+GE+PL+C +CDK F+RSDH  TH+R HTGEKPY C  C + F+RSDE+LRH +
Sbjct:  266 KTFCCSTCDVKFTRRDELRRHEKIHSGEKPLSCPYCDKCFIRSDHRKTHIRTHTGEKPYACDICLKRFARSDEKLRHTK 344          

HSP 2 Score: 55.8398 bits (133), Expect = 6.925e-9
Identity = 26/53 (49.06%), Postives = 29/53 (54.72%), Query Frame = 3
Query:  345 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIH 503
            K  +C  C K F R D  K H R HTGE+P AC  C KRF RSD    H + H
Sbjct:  294 KPLSCPYCDKCFIRSDHRKTHIRTHTGEKPYACDICLKRFARSDEKLRHTKTH 346          
The following BLAST results are available for this feature:
BLAST of EGR-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EGR44.269e-2548.11early growth response 4 [Source:HGNC Symbol;Acc:HG... [more]
EGR45.983e-2547.66early growth response 4 [Source:HGNC Symbol;Acc:HG... [more]
EGR13.894e-2457.53early growth response 1 [Source:HGNC Symbol;Acc:HG... [more]
EGR36.743e-2458.33early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
EGR28.216e-2459.26early growth response 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egrh-28.853e-2643.48EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.077e-2552.81EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.272e-2541.45EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.753e-2552.81EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-12.225e-2451.69EGR (Early Growth factor Response factor) Homolog ... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sr4.839e-2456.94gene:FBgn0003499 transcript:FBtr0083542[more]
sr5.132e-2456.94gene:FBgn0003499 transcript:FBtr0330050[more]
sr1.111e-2356.94gene:FBgn0003499 transcript:FBtr0301615[more]
sr1.431e-2356.94gene:FBgn0003499 transcript:FBtr0344633[more]
sr1.431e-2356.94gene:FBgn0003499 transcript:FBtr0083543[more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr44.522e-2553.93early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
egr18.952e-2558.90early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr18.952e-2558.90early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr2a8.803e-2458.33early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
egr2a8.803e-2458.33early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr12.767e-2457.53early growth response 1 [Source:NCBI gene;Acc:1000... [more]
egr13.329e-2457.53early growth response 1 [Source:NCBI gene;Acc:1000... [more]
tbl1x5.933e-2459.26transducin beta like 1 X-linked [Source:Xenbase;Ac... [more]
serpinb41.125e-2358.33serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
usp312.587e-2356.96ubiquitin specific peptidase 31 [Source:Xenbase;Ac... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egr45.050e-2647.66early growth response 4 [Source:MGI Symbol;Acc:MGI... [more]
Egr12.423e-2457.53early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr12.423e-2457.53early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr34.358e-2458.33early growth response 3 [Source:MGI Symbol;Acc:MGI... [more]
Egr25.405e-2459.26early growth response 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WUF2|EGR4_MOUSE3.533e-2547.66Early growth response protein 4 OS=Mus musculus OX... [more]
sp|Q00911|EGR4_RAT9.698e-2546.73Early growth response protein 4 OS=Rattus norvegic... [more]
sp|Q9GL32|EGR4_BOVIN2.255e-2447.66Early growth response protein 4 OS=Bos taurus OX=9... [more]
sp|O73693|EGR1_TAEGU2.342e-2458.33Early growth response protein 1 (Fragment) OS=Taen... [more]
sp|Q05215|EGR4_HUMAN2.873e-2447.66Early growth response protein 4 OS=Homo sapiens OX... [more]
back to top
BLAST of EGR-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G1CSV57.929e-135100.00EGR-like protein 1 OS=Schmidtea mediterranea OX=79... [more]
I1ZI705.259e-9973.10Early growth response-3 OS=Schmidtea mediterranea ... [more]
T1DF981.187e-7559.89Egrl-3 (Fragment) OS=Dendrocoelum lacteum OX=27895... [more]
T1E1164.475e-6352.97Egrl-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZI722.371e-2757.78Early growth response-4 OS=Schmidtea mediterranea ... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr49.666e-2657.83early growth response protein 1-B [Source:NCBI gen... [more]
egr41.406e-2557.83early growth response protein 1-B [Source:NCBI gen... [more]
egr11.752e-2458.90early growth response 1 [Source:NCBI gene;Acc:1030... [more]
egr37.111e-2458.33early growth response 3 [Source:NCBI gene;Acc:1030... [more]
egr2b1.221e-2358.02early growth response 2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr48.048e-2654.02early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000005225.14.822e-2245.56pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1... [more]
ENSPMAT00000000923.12.486e-2143.21pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 ... [more]
ENSPMAT00000007569.12.668e-2037.50pep scaffold:Pmarinus_7.0:GL477836:135382:139743:-... [more]
ENSPMAT00000005004.16.532e-2043.90pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 g... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP16.317e-1942.35Zinc-regulated transcription factor; binds to zinc... [more]
AZF15.661e-1741.77Zinc-finger transcription factor; involved in diau... [more]
MSN24.640e-1550.79Stress-responsive transcriptional activator; activ... [more]
MSN41.997e-1353.70Stress-responsive transcriptional activator; activ... [more]
CRZ19.584e-1339.53Transcription factor, activates transcription of s... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491129.207e-2557.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328912.600e-2029.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431771.596e-1943.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463338.620e-1946.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400361.465e-1844.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000940.21.047e-2456.00early growth response protein 1 [Source:NCBI gene;... [more]
egr11.554e-2458.90early growth response 1 [Source:NCBI gene;Acc:1002... [more]
ENSORLT00000034291.17.157e-2441.18early growth response protein 2b [Source:NCBI gene... [more]
egr37.282e-2458.33early growth response 3 [Source:NCBI gene;Acc:1002... [more]
egr2b1.733e-2358.02early growth response 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of EGR-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000960.12.205e-138100.00SMESG000000960.1[more]
SMESG000000959.12.153e-10373.60SMESG000000959.1[more]
SMESG000028801.15.070e-3157.78SMESG000028801.1[more]
SMESG000028801.19.019e-3157.78SMESG000028801.1[more]
SMESG000042500.13.774e-3062.03SMESG000042500.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029780
GenBankAEI69697.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029780 ID=SMED30029780|Name=EGR-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=718bp
AATTTAGTATTTGTTACATTTAAGTTTCGATCAAAATGGTTAAAAATATT
CAGAAGTTAACTCTACCAGTGAAAATCGACAAATTAGAATTTAACGAAAT
CCAAACAGGATATACTCCGTTGCCAGGAATTCATGAGTCGTTCTATCTCG
ATAATACAGAAAATTGGAGTAATTTAAAAACACCATCTCCAATGGATTGC
AATAATTTGGAATTCGTTTTCATTTATGAATCTGAAGACGATTCCAATCA
TTTCTCAACCAAATTAAATCCGAACACCAAAAAATCTCTTCGTATTATTT
CGAGTCCTCTGTCAGAAATTAGCGAGAAAAGTCAATTTCGAATAAAACAA
TTTACTTGTAACACATGCAAAAAGTCATTTTATCGTCGGGATGAATTGAA
AAGACACGAAAGAATTCACACTGGCGAACGTCCGTTAGCGTGCCATTTTT
GTGATAAAAGATTTATGAGATCAGATCACTTATCAACCCATGTTAGAATT
CATACGGGCGAGAAGCCTTATCAATGCAGCTATTGTGATCGTTTGTTCAG
CAGATCTGATGAAAGGCTCAGGCATATTAGACAAACTCATTTATAGAGAA
CAAAAGAAAATGTATTTTGAAGATTTAGTGACATATTTTATTATTTTATG
TATATATTTGATATATCATTTTATTTTTGTTATAACATATTTGAAATATA
TTTTCCTATGTAAAAAAA
back to top

protein sequence of SMED30029780-orf-1

>SMED30029780-orf-1 ID=SMED30029780-orf-1|Name=SMED30029780-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=187bp
MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTP
SPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQ
FRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLS
THVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 134..156
e-value: 0.041
score: 23.0
coord: 106..128
e-value: 9.3E-4
score: 28.5
coord: 162..185
e-value: 0.0041
score: 26.3
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 136..156
e-value: 0.0024
score: 18.3
coord: 106..128
e-value: 1.4E-5
score: 25.2
coord: 162..185
e-value: 5.1E-4
score: 20.4
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 136..156
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 164..185
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 108..128
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 106..133
score: 16.976
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 134..161
score: 15.23
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 162..186
score: 11.323
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 131..154
e-value: 1.4E-13
score: 52.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 155..186
e-value: 1.9E-10
score: 42.5
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 97..130
e-value: 1.8E-12
score: 48.7
NoneNo IPR availablePANTHERPTHR23235:SF90KRUEPPEL-LIKE FACTOR LUNAcoord: 148..183
coord: 109..175
NoneNo IPR availablePANTHERPTHR23235TRANSCRIPTION FACTOR SP3coord: 148..183
NoneNo IPR availablePANTHERPTHR23235TRANSCRIPTION FACTOR SP3coord: 109..175
NoneNo IPR availableCDDcd17276RMtype1_S_Sau1132ORF3780P-TRD1-CR1_likecoord: 18..67
e-value: 0.00431916
score: 34.4827
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 98..133
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 128..180