ATP-binding cassette sub-family F member 2

Overview
NameATP-binding cassette sub-family F member 2
Smed IDSMED30029770
Length (bp)2011
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-binding cassette sub-family F member 2 (SMED30029770) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-binding cassette sub-family F member 2 (SMED30029770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-binding cassette sub-family F member 2 (SMED30029770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-binding cassette sub-family F member 2 (SMED30029770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30029770SMESG000071613.1 dd_Smed_v4_434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029770SMESG000071613.1 Contig49726uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029770SMESG000071613.1 Contig49726newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30029770SMESG000071613.1 dd_Smed_v6_434_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30029770SMESG000071613.1 dd_Smed_v6_434_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Human
Match: ABCF2 (ATP binding cassette subfamily F member 2 [Source:HGNC Symbol;Acc:HGNC:71])

HSP 1 Score: 781.171 bits (2016), Expect = 0.000e+0
Identity = 371/562 (66.01%), Postives = 459/562 (81.67%), Query Frame = 2
Query:  227 EDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            E +++  L  E+E   +   K +  R+VTGVL+SH  S DVH  N+ +TFHGQE+L DT LELN+GRRYG IG NG GKS L + +   E+P+P HID Y L REMPPSDKT L  VME D E+  LEKEAE LA  +D E + +L+E+YERL++LDA++AE RA+ IL GLGFT  MQ+K++K FSGGWRMR++LAR LF++P +L+LDEPTNHLDL+ACVWLE+EL  + RIL+++SHS+DFLNGVCTNIIHM +KKL YY GNYDQY++T++E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KM+ SGLT++V  DK L F FP CG+IPPPVI +QNVSF+Y ++ P IY+N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHL E LDL+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+  AWLA   PHML LDEPTNHLD+ETID+LADAINEFEGG++LVSHDFRLI +VA EIWVC   T+TKW GDI +YK  L
Sbjct:   49 ETTEVDLLTKELEDFEM---KKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLA-HEDAECE-KLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHL 605          

HSP 2 Score: 67.3958 bits (163), Expect = 5.306e-11
Identity = 70/264 (26.52%), Postives = 114/264 (43.18%), Query Frame = 2
Query: 1235 GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIAS----------------ELEPTDGLIRRHSHCRIGRYHQHL-----TEILDLNSSPMDWMMKSFPNIKERD----EMR--KKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            G++ S P+  ++      I N+S  +H  +  +  +    ++   R  L+G NG GKS LL  I                  E+ P+D   +   HC +    +        E L    +  + +M+ +  ++E D    EMR  + L   G T A Q   +K  S G R R+  A      P MLLLDEPTNHLDL+    L + +  F+  L+LVSH    +  V   I   ++  +  + G+   Y  + + E+E+   +R
Sbjct:   75 GVLASHPNSTDV-----HIINLSLTFHGQE--LLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSD---KTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRL-ELEENQMKR 327          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Human
Match: ABCF2 (ATP binding cassette subfamily F member 2 [Source:HGNC Symbol;Acc:HGNC:71])

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 371/562 (66.01%), Postives = 459/562 (81.67%), Query Frame = 2
Query:  227 EDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            E +++  L  E+E   +   K +  R+VTGVL+SH  S DVH  N+ +TFHGQE+L DT LELN+GRRYG IG NG GKS L + +   E+P+P HID Y L REMPPSDKT L  VME D E+  LEKEAE LA  +D E + +L+E+YERL++LDA++AE RA+ IL GLGFT  MQ+K++K FSGGWRMR++LAR LF++P +L+LDEPTNHLDL+ACVWLE+EL  + RIL+++SHS+DFLNGVCTNIIHM +KKL YY GNYDQY++T++E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KM+ SGLT++V  DK L F FP CG+IPPPVI +QNVSF+Y ++ P IY+N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHL E LDL+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+  AWLA   PHML LDEPTNHLD+ETID+LADAINEFEGG++LVSHDFRLI +VA EIWVC   T+TKW GDI +YK  L
Sbjct:   49 ETTEVDLLTKELEDFEM---KKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLA-HEDAECE-KLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHL 605          

HSP 2 Score: 67.3958 bits (163), Expect = 5.016e-11
Identity = 70/264 (26.52%), Postives = 114/264 (43.18%), Query Frame = 2
Query: 1235 GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIAS----------------ELEPTDGLIRRHSHCRIGRYHQHL-----TEILDLNSSPMDWMMKSFPNIKERD----EMR--KKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            G++ S P+  ++      I N+S  +H  +  +  +    ++   R  L+G NG GKS LL  I                  E+ P+D   +   HC +    +        E L    +  + +M+ +  ++E D    EMR  + L   G T A Q   +K  S G R R+  A      P MLLLDEPTNHLDL+    L + +  F+  L+LVSH    +  V   I   ++  +  + G+   Y  + + E+E+   +R
Sbjct:   75 GVLASHPNSTDV-----HIINLSLTFHGQE--LLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSD---KTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRL-ELEENQMKR 327          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Human
Match: ABCF3 (ATP binding cassette subfamily F member 3 [Source:HGNC Symbol;Acc:HGNC:72])

HSP 1 Score: 431.795 bits (1109), Expect = 7.952e-142
Identity = 220/543 (40.52%), Postives = 342/543 (62.98%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEAD---EEKMRLEKE--AEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            S   +S DV   N  ++F  + +L    + L  GRRYG +G NG GK++L  +LA   L VP+HI    +++E+   D  ALQ+V+E+D   E+ +R E+E  A+  A + +      L E+Y +L++++A++A  RA+ IL GLGFT  MQQ+  + FSGGWRMR++LAR LF +P LL+LDEPTN LD+ A +WLE  L  +   ++++SH  +FLN + T+IIH+  ++L  Y G+++ +I++K E   NQ ++Y+ +Q    H++ +I RF + + + A Q QSK K L+K+ +    + V ++  +V  FP   E   PP++Q+  V F Y++ K +I+  +    DL++R+ +VG NGAGKST+LKL+  +L P  G+   H + +IG + QH  E LDLN S ++ + + FP   E +E R +LGRYG++G   + P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L  A+N F GG++LVSHD R I  V  E+WVC  G VT+ +G    Y+A L ++  +E
Sbjct:  164 SGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANR-ASQVQSKLKMLEKLPE---LKPVDKESEVVMKFPDGFEKFSPPILQLDEVDF-YYDPKHVIFSRLSVSADLESRICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGRPE-EEYRHQLGRYGISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCRELWVCEGGGVTRVEGGFDQYRALLQEQFRRE 700          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Human
Match: ABCF3 (ATP binding cassette subfamily F member 3 [Source:HGNC Symbol;Acc:HGNC:72])

HSP 1 Score: 431.409 bits (1108), Expect = 1.076e-141
Identity = 220/543 (40.52%), Postives = 342/543 (62.98%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEAD---EEKMRLEKE--AEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            S   +S DV   N  ++F  + +L    + L  GRRYG +G NG GK++L  +LA   L VP+HI    +++E+   D  ALQ+V+E+D   E+ +R E+E  A+  A + +      L E+Y +L++++A++A  RA+ IL GLGFT  MQQ+  + FSGGWRMR++LAR LF +P LL+LDEPTN LD+ A +WLE  L  +   ++++SH  +FLN + T+IIH+  ++L  Y G+++ +I++K E   NQ ++Y+ +Q    H++ +I RF + + + A Q QSK K L+K+ +    + V ++  +V  FP   E   PP++Q+  V F Y++ K +I+  +    DL++R+ +VG NGAGKST+LKL+  +L P  G+   H + +IG + QH  E LDLN S ++ + + FP   E +E R +LGRYG++G   + P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L  A+N F GG++LVSHD R I  V  E+WVC  G VT+ +G    Y+A L ++  +E
Sbjct:  170 SGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANR-ASQVQSKLKMLEKLPE---LKPVDKESEVVMKFPDGFEKFSPPILQLDEVDF-YYDPKHVIFSRLSVSADLESRICVVGENGAGKSTMLKLLLGDLAPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGRPE-EEYRHQLGRYGISGELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNNFRGGVILVSHDERFIRLVCRELWVCEGGGVTRVEGGFDQYRALLQEQFRRE 706          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Human
Match: ABCF1 (ATP binding cassette subfamily F member 1 [Source:HGNC Symbol;Acc:HGNC:70])

HSP 1 Score: 369.392 bits (947), Expect = 4.305e-119
Identity = 215/549 (39.16%), Postives = 332/549 (60.47%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQ----DDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKY--------------KWEQDQMAHMKDYIARFGHGSRKLARQAQSKE--KTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
            + D+      I+ HG+E+ ++  L +  GRRYG +GPNG GK++L   +AN  L +P +ID  L ++E+   +  A+QAV+ AD ++++L +E   L  Q    DDT + +RL +VYE L    A  AE +A  IL GLGF  +MQ +  + FSGGWRMR+SLAR LF++P LLMLDEPTNHLDLNA +WL   L  + + L+I+SH + FL+ VCT+IIH+  ++L YY GNY  + +   + ++  +K+Y              K  +      K+ + R     R+  +  +S+E  + LK+           ++  + F+FP    + PPV+ +  V+F Y   KPL + N+DFGID+D+R+ +VGPNG GKSTLL L+  +L PT G +R++   +IG ++Q   E L +  +P +++ + F N+  +D  RK LGR+GL        I  LS GQ+ R++FA LA   P +L+LDEPTN+LD+E+ID+L +AINE++G +++VSHD RLI     ++WV    +V++ DGD   YK  +++ +
Sbjct:   52 ASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAA-ERLEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEESQEAPELLKR----------PKEYTVRFTFPDPPPLSPPVLGLHGVTFGYQGQKPL-FKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGF-NLPYQD-ARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEAL 586          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Celegans
Match: abcf-2 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:G5EFG4])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 356/575 (61.91%), Postives = 455/575 (79.13%), Query Frame = 2
Query:  221 DEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            DEE  + A  + +IE  N  +      RSV G L+S  +  D    ++ ITFHG+EI++DT LELN GRRYG IG NG GKS++   + N E+P+P  +D YL+ REMP S+KTALQAV++ D  +  LE  AE LA Q D ESQD+L++VYERLD++DA  AEK+AAEIL GLGFTK MQ K+ K FSGGWRMRI+LAR LF+KP++L+LDEPTNHLDL ACVWLE+EL+QY R L+++SHS+DF+NGVCTNIIH+  K+LVYY GNYDQ+++T++E  ENQ K+Y WEQ Q+ HMKDY+ARFGHGS KLARQAQSKEKT+ KM+  GL +K   +    F F   GEIPPPVI +Q+VSFRY+EN P IY +IDFGIDLDTR+ALVGPNGAGKSTLLKL+ +++ PTDGLIRRHSHC+IGRYHQHL E L L+ S +++MMK FP++KE++EMRK +GRYG+TG +Q+CP+K LSDGQRCR+ FAWLA   PH+LLLDEPTNHLD+E+ID+LA+AIN F GG++LVSHDFRL+ +VA+E+WVC++  + KWDGDI+S+K  L K+I+++   R
Sbjct:   46 DEELDQAAATLAKIELENAAA------RSVAGSLTSDPKGLDHRVESLTITFHGREIVVDTKLELNRGRRYGLIGLNGSGKSTIIQAIYNKEMPIPESVDMYLVSREMPASEKTALQAVVDVDSVRKELEHLAEQLASQTDEESQDKLMDVYERLDEMDASLAEKKAAEILHGLGFTKTMQMKKCKDFSGGWRMRIALARALFLKPSVLLLDEPTNHLDLEACVWLEEELAQYKRTLLVVSHSQDFMNGVCTNIIHLFQKQLVYYGGNYDQFVKTRLELLENQQKRYNWEQSQLQHMKDYVARFGHGSAKLARQAQSKEKTMAKMIAGGLAEKAVTETVKQFYFFDAGEIPPPVIMVQHVSFRYNENTPWIYKDIDFGIDLDTRIALVGPNGAGKSTLLKLLCTDVMPTDGLIRRHSHCKIGRYHQHLHEELPLDLSALEFMMKEFPDVKEKEEMRKIVGRYGITGREQVCPMKQLSDGQRCRVSFAWLAWQQPHLLLLDEPTNHLDMESIDALAEAINCFPGGMILVSHDFRLVSQVAEEVWVCDNQGILKWDGDIFSFKEHLRKQIDKDVRSR 614          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Celegans
Match: abcf-2 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:G5EFG4])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 356/575 (61.91%), Postives = 455/575 (79.13%), Query Frame = 2
Query:  221 DEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            DEE  + A  + +IE  N  +      RSV G L+S  +  D    ++ ITFHG+EI++DT LELN GRRYG IG NG GKS++   + N E+P+P  +D YL+ REMP S+KTALQAV++ D  +  LE  AE LA Q D ESQD+L++VYERLD++DA  AEK+AAEIL GLGFTK MQ K+ K FSGGWRMRI+LAR LF+KP++L+LDEPTNHLDL ACVWLE+EL+QY R L+++SHS+DF+NGVCTNIIH+  K+LVYY GNYDQ+++T++E  ENQ K+Y WEQ Q+ HMKDY+ARFGHGS KLARQAQSKEKT+ KM+  GL +K   +    F F   GEIPPPVI +Q+VSFRY+EN P IY +IDFGIDLDTR+ALVGPNGAGKSTLLKL+ +++ PTDGLIRRHSHC+IGRYHQHL E L L+ S +++MMK FP++KE++EMRK +GRYG+TG +Q+CP+K LSDGQRCR+ FAWLA   PH+LLLDEPTNHLD+E+ID+LA+AIN F GG++LVSHDFRL+ +VA+E+WVC++  + KWDGDI+S+K  L K+I+++   R
Sbjct:   46 DEELDQAAATLAKIELENAAA------RSVAGSLTSDPKGLDHRVESLTITFHGREIVVDTKLELNRGRRYGLIGLNGSGKSTIIQAIYNKEMPIPESVDMYLVSREMPASEKTALQAVVDVDSVRKELEHLAEQLASQTDEESQDKLMDVYERLDEMDASLAEKKAAEILHGLGFTKTMQMKKCKDFSGGWRMRIALARALFLKPSVLLLDEPTNHLDLEACVWLEEELAQYKRTLLVVSHSQDFMNGVCTNIIHLFQKQLVYYGGNYDQFVKTRLELLENQQKRYNWEQSQLQHMKDYVARFGHGSAKLARQAQSKEKTMAKMIAGGLAEKAVTETVKQFYFFDAGEIPPPVIMVQHVSFRYNENTPWIYKDIDFGIDLDTRIALVGPNGAGKSTLLKLLCTDVMPTDGLIRRHSHCKIGRYHQHLHEELPLDLSALEFMMKEFPDVKEKEEMRKIVGRYGITGREQVCPMKQLSDGQRCRVSFAWLAWQQPHLLLLDEPTNHLDMESIDALAEAINCFPGGMILVSHDFRLVSQVAEEVWVCDNQGILKWDGDIFSFKEHLRKQIDKDVRSR 614          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Celegans
Match: abcf-1 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:Q19554])

HSP 1 Score: 409.068 bits (1050), Expect = 1.792e-134
Identity = 216/566 (38.16%), Postives = 339/566 (59.89%), Query Frame = 2
Query:  290 VSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRL-EKEAEYLAL--QDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMV-------------------DSGLTQKVSRDK--GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLI 1915
            VSQ       L+    S D+   N  I+  G+ +    +L +  GRRYG +GPNG GK++L   +   +L +PSHID    ++E+     +A+  V+++D++++ L E+EA+ ++   +  TE+ +R+ EV + L D+ A+ AE RA  IL GLGF+K+MQ+K    FSGGWRMRISLAR LF++P LLMLDEPTNHLDLNA +WL+  L  + + L+I+SH + FL+ VCT+IIH+ ++KL  Y GNY  + +   +  +   K +  +Q Q+  MK           K  + A+  E+ +K+ +                   D+G  + + R K   + F FP   ++ PPV+ + +V+F Y   K +++  ++FG+D+D+R+A+VGPNG GKSTLLKL+  +++P DG +R+H   RIG + QH  E L+   +P++++   F NI +  E RK+LG  GL        IK LS GQ+ R+    LA   P +++LDEPTN+LD+E+ID+LA+AI +F GG+++V+HD RL+ R    +WV  +  + + DGD   YK  ++
Sbjct:   61 VSQLSKTGTQLAQMENSMDIKIENFDISAQGKLLFDKASLTIVYGRRYGLVGPNGMGKTTLLKHIGARKLAIPSHIDLLYCEQEIQVDSTSAIDTVVKSDKKRLALLEEEAKLMSEIEEGKTEAAERMKEVADELRDIGADSAEPRARRILAGLGFSKEMQEKPCTDFSGGWRMRISLARALFLEPTLLMLDEPTNHLDLNAVIWLDNYLQTWKKTLLIVSHDQGFLDSVCTDIIHLDNQKLHTYRGNYTLFKKQYAQDMQVHEKNFDQQQKQLKAMK-----------KEGKSAKQAEEQVKQQMANKAKKGGKKNAGKVNDDDDAGAPELLQRRKEYSVKFQFPETTKLNPPVLGLHDVNFGY--GKDVLFKKLNFGVDMDSRIAIVGPNGVGKSTLLKLLIGKIDPNDGELRKHRTLRIGWFDQHANEALNGEQTPVEFLCTKF-NI-DYQEARKQLGTTGLAAHAHTVKIKDLSGGQKSRVALCNLALGGPDIIILDEPTNNLDIESIDALAEAIRDFNGGVVMVTHDERLVVRTDCNLWVVENQGIDEIDGDFEDYKKEVL 611          

HSP 2 Score: 67.3958 bits (163), Expect = 2.027e-11
Identity = 60/244 (24.59%), Postives = 105/244 (43.03%), Query Frame = 2
Query: 1283 IQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIAS------------------ELEPTDGL--IRRHSHCRIGRYHQH---LTEILDLNSSPMDWMMKSFPNIKE------RDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIE 1927
            I+I+N  F       L++D     I    R  LVGPNG GK+TLLK I +                  +++ T  +  + +    R+    +    ++EI +  +   + M +    +++          R+ L   G +   Q  P    S G R RI  A      P +L+LDEPTNHLDL  +  L + +  ++  LL+VSHD   +  V  +I   ++  +  + G+   +K    ++++
Sbjct:   80 IKIEN--FDISAQGKLLFDKASLTIVYGRRYGLVGPNGMGKTTLLKHIGARKLAIPSHIDLLYCEQEIQVDSTSAIDTVVKSDKKRLALLEEEAKLMSEIEEGKTEAAERMKEVADELRDIGADSAEPRARRILAGLGFSKEMQEKPCTDFSGGWRMRISLARALFLEPTLLMLDEPTNHLDLNAVIWLDNYLQTWKKTLLIVSHDQGFLDSVCTDIIHLDNQKLHTYRGNYTLFKKQYAQDMQ 321          

HSP 3 Score: 53.9138 bits (128), Expect = 3.622e-7
Identity = 51/242 (21.07%), Postives = 106/242 (43.80%), Query Frame = 2
Query:  344 DVHFSNVCITFHGQEILLDTTLELNNG----RRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMES 1057
            DV+F       +G+++L     +LN G     R   +GPNG GKS+L  +L     P    +  +   R +   D+ A +A+                         +   VE      ++D + A K+    L   G        ++K  SGG + R++L       P +++LDEPTN+LD+ +   L + +  ++  +++++H E  +     N+  ++++ +   +G+++ Y +  +++
Sbjct:  409 DVNFG------YGKDVLFK---KLNFGVDMDSRIAIVGPNGVGKSTLLKLLIGKIDPNDGELRKHRTLR-IGWFDQHANEAL-----------------------NGEQTPVEFLCTKFNIDYQEARKQ----LGTTGLAAHAHTVKIKDLSGGQKSRVALCNLALGGPDIIILDEPTNNLDIESIDALAEAIRDFNGGVVMVTHDERLVVRTDCNLWVVENQGIDEIDGDFEDYKKEVLDA 613          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Celegans
Match: abcf-3 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:Q20306])

HSP 1 Score: 382.489 bits (981), Expect = 4.305e-123
Identity = 202/539 (37.48%), Postives = 334/539 (61.97%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRL---EKEAEYLALQDD------TESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIE 1927
            S+D+   +V I+   +++L    + +  GRRYG +G NG GK++L  ++++ +L +P+ I    +++E+   D   L AV+ +D ++  L   EK  +    +D+      T+  D L ++Y  ++ L  ++A  RA+ +L+GLGFT D Q++  K FSGGWRMR++LAR LFVKP LL+LDEPTN LD+ A  WLE  L  +   ++ +SH   FLN +CT+I+H+  ++L +Y GNYDQ+ +T  E    Q ++Y+ +Q    H +++I +F + +++ A   QS+ K L+K+    +   V  +  + F FP C  +  PV+Q+  VSFRY+E+ P ++  ++ G   ++R+ +VG NGAGK+TLLKL+  +L+P+ GL   +   RI  + QH  + LD+ +S ++ +MK+ P  K +++ R  LGR+GL G   +  +++LS GQ+ R+ FA LA   P+ L+LDEPTNHLD+ET+++L  A+N F GG++LVSHD +LI  V  E+WV     VT  +G +  Y+  + K+++
Sbjct:  176 SKDIKLESVDISIGTKQLLSCADVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGISMLSVEQEVEGDDTLVLDAVLMSDTKRQTLLDREKTLQSRINKDNINDAEKTKWNDELSKLYIEMEALQLDKAPARASSLLYGLGFTPDEQKRPTKEFSGGWRMRVALARALFVKPDLLLLDEPTNMLDMRAVYWLEGHLQGWEGTILTVSHDRKFLNEICTDIVHLHTRRLDHYKGNYDQFEKTMKEKLTQQQREYESQQQLRQHTQEFIDKFRYNAKR-APMVQSRIKMLEKL---PVLLPVELESDIHFKFPECEVLSNPVLQLDEVSFRYNEDSPYLFRKLNLGTHANSRICIVGENGAGKTTLLKLLLDDLQPSVGLRNVNRRIRIAYFTQHHVDQLDMETSAIEVLMKNHPG-KTQEDYRAALGRFGLAGDMALQSVETLSGGQKSRLAFANLALMQPNYLILDEPTNHLDVETVEALGKALNVFNGGVVLVSHDEQLIELVCKELWVVKDRMVTTLEGGLEEYRKQVYKQLQ 709          

HSP 2 Score: 64.6994 bits (156), Expect = 1.477e-10
Identity = 60/232 (25.86%), Postives = 98/232 (42.24%), Query Frame = 2
Query: 1346 DFGIDLDTRVALVGPNGAGKSTLLKLIAS----------------ELEPTDGLI---------RRHS--------HCRIGRYHQHLTEILDLNS--SPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEH 1936
            D  +    R  LVG NG GK+TLLK+I+S                E+E  D L+         +R +          RI + + +  E    N   S +   M++    K        L   G T  +Q  P K  S G R R+  A      P +LLLDEPTN LD+  +  L   +  +EG +L VSHD + +  +  +I   +   +  + G+   ++ ++ +++ Q+ 
Sbjct:  198 DVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGISMLSVEQEVEGDDTLVLDAVLMSDTKRQTLLDREKTLQSRINKDNINDAEKTKWNDELSKLYIEMEALQLDKAPARASSLLYGLGFTPDEQKRPTKEFSGGWRMRVALARALFVKPDLLLLDEPTNMLDMRAVYWLEGHLQGWEGTILTVSHDRKFLNEICTDIVHLHTRRLDHYKGNYDQFEKTMKEKLTQQQ 429          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Celegans
Match: abcf-3 (ABC transporter, class F [Source:UniProtKB/TrEMBL;Acc:Q20306])

HSP 1 Score: 382.489 bits (981), Expect = 4.305e-123
Identity = 202/539 (37.48%), Postives = 334/539 (61.97%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRL---EKEAEYLALQDD------TESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIE 1927
            S+D+   +V I+   +++L    + +  GRRYG +G NG GK++L  ++++ +L +P+ I    +++E+   D   L AV+ +D ++  L   EK  +    +D+      T+  D L ++Y  ++ L  ++A  RA+ +L+GLGFT D Q++  K FSGGWRMR++LAR LFVKP LL+LDEPTN LD+ A  WLE  L  +   ++ +SH   FLN +CT+I+H+  ++L +Y GNYDQ+ +T  E    Q ++Y+ +Q    H +++I +F + +++ A   QS+ K L+K+    +   V  +  + F FP C  +  PV+Q+  VSFRY+E+ P ++  ++ G   ++R+ +VG NGAGK+TLLKL+  +L+P+ GL   +   RI  + QH  + LD+ +S ++ +MK+ P  K +++ R  LGR+GL G   +  +++LS GQ+ R+ FA LA   P+ L+LDEPTNHLD+ET+++L  A+N F GG++LVSHD +LI  V  E+WV     VT  +G +  Y+  + K+++
Sbjct:  176 SKDIKLESVDISIGTKQLLSCADVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGISMLSVEQEVEGDDTLVLDAVLMSDTKRQTLLDREKTLQSRINKDNINDAEKTKWNDELSKLYIEMEALQLDKAPARASSLLYGLGFTPDEQKRPTKEFSGGWRMRVALARALFVKPDLLLLDEPTNMLDMRAVYWLEGHLQGWEGTILTVSHDRKFLNEICTDIVHLHTRRLDHYKGNYDQFEKTMKEKLTQQQREYESQQQLRQHTQEFIDKFRYNAKR-APMVQSRIKMLEKL---PVLLPVELESDIHFKFPECEVLSNPVLQLDEVSFRYNEDSPYLFRKLNLGTHANSRICIVGENGAGKTTLLKLLLDDLQPSVGLRNVNRRIRIAYFTQHHVDQLDMETSAIEVLMKNHPG-KTQEDYRAALGRFGLAGDMALQSVETLSGGQKSRLAFANLALMQPNYLILDEPTNHLDVETVEALGKALNVFNGGVVLVSHDEQLIELVCKELWVVKDRMVTTLEGGLEEYRKQVYKQLQ 709          

HSP 2 Score: 64.6994 bits (156), Expect = 1.477e-10
Identity = 60/232 (25.86%), Postives = 98/232 (42.24%), Query Frame = 2
Query: 1346 DFGIDLDTRVALVGPNGAGKSTLLKLIAS----------------ELEPTDGLI---------RRHS--------HCRIGRYHQHLTEILDLNS--SPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEH 1936
            D  +    R  LVG NG GK+TLLK+I+S                E+E  D L+         +R +          RI + + +  E    N   S +   M++    K        L   G T  +Q  P K  S G R R+  A      P +LLLDEPTN LD+  +  L   +  +EG +L VSHD + +  +  +I   +   +  + G+   ++ ++ +++ Q+ 
Sbjct:  198 DVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGISMLSVEQEVEGDDTLVLDAVLMSDTKRQTLLDREKTLQSRINKDNINDAEKTKWNDELSKLYIEMEALQLDKAPARASSLLYGLGFTPDEQKRPTKEFSGGWRMRVALARALFVKPDLLLLDEPTNMLDMRAVYWLEGHLQGWEGTILTVSHDRKFLNEICTDIVHLHTRRLDHYKGNYDQFEKTMKEKLTQQQ 429          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Fly
Match: CG9281 (gene:FBgn0030672 transcript:FBtr0340308)

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 368/552 (66.67%), Postives = 456/552 (82.61%), Query Frame = 2
Query:  293 SQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARRA 1948
            ++ RS TG L+ H  SRDV  +N  ITF G E+L DT LELN GRRYG IG NGCGKSSL AVL   E+PVP HID + L RE+P S K+ALQ VME DEE+++LEK AE LA+ ++ ++Q++L+++YERLDD+ A+ AE +AA IL GLGF K MQQK+ K FSGGWRMRI+LAR LFVKP LL+LDEPTNHLDL+ACVWLE+EL  Y RIL++ISHS+DFLNGVCTNIIH+  K+L YY GNY+ ++RT+ME  ENQMK+Y WEQDQ++HMK+YIARFGHGS KLARQAQSKEKTL KMV  GLT+KVS DK L F FPSCG++PPPVI +QNV+FRY++  P IY N++FGIDLDTR+ALVGPNGAGKSTLLKL+  +L PT G+IR++SH RI RYHQHL E+LDL++SP+++MM++FP++KE++EMRK +GRYGLTG QQ+CPI+ LSDGQRCR++FAWLA   PH+LLLDEPTNHLD+ETID+LADAIN+F+GG++LVSHDFRLI +VA+EIWVC   TVTKW G I  YK  L  +I  E+ ++A
Sbjct:   56 AEARSCTGSLAVHPRSRDVKIANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPPHIDIFHLTREIPASSKSALQCVMEVDEERIKLEKLAEELAMSEEDDAQEQLIDIYERLDDMSADLAEVKAARILHGLGFDKAMQQKQAKDFSGGWRMRIALARALFVKPHLLLLDEPTNHLDLDACVWLEEELKTYKRILVLISHSQDFLNGVCTNIIHLTGKRLKYYTGNYEAFVRTRMELLENQMKQYNWEQDQISHMKNYIARFGHGSAKLARQAQSKEKTLAKMVAQGLTEKVSDDKVLNFYFPSCGKVPPPVIMVQNVNFRYNDETPWIYKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNSHLRIARYHQHLHELLDLDASPLEYMMRAFPDVKEKEEMRKIIGRYGLTGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDMETIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETVTKWKGGILDYKDHLKNKITSENEKKA 607          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Fly
Match: CG9281 (gene:FBgn0030672 transcript:FBtr0074057)

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 368/552 (66.67%), Postives = 456/552 (82.61%), Query Frame = 2
Query:  293 SQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARRA 1948
            ++ RS TG L+ H  SRDV  +N  ITF G E+L DT LELN GRRYG IG NGCGKSSL AVL   E+PVP HID + L RE+P S K+ALQ VME DEE+++LEK AE LA+ ++ ++Q++L+++YERLDD+ A+ AE +AA IL GLGF K MQQK+ K FSGGWRMRI+LAR LFVKP LL+LDEPTNHLDL+ACVWLE+EL  Y RIL++ISHS+DFLNGVCTNIIH+  K+L YY GNY+ ++RT+ME  ENQMK+Y WEQDQ++HMK+YIARFGHGS KLARQAQSKEKTL KMV  GLT+KVS DK L F FPSCG++PPPVI +QNV+FRY++  P IY N++FGIDLDTR+ALVGPNGAGKSTLLKL+  +L PT G+IR++SH RI RYHQHL E+LDL++SP+++MM++FP++KE++EMRK +GRYGLTG QQ+CPI+ LSDGQRCR++FAWLA   PH+LLLDEPTNHLD+ETID+LADAIN+F+GG++LVSHDFRLI +VA+EIWVC   TVTKW G I  YK  L  +I  E+ ++A
Sbjct:   56 AEARSCTGSLAVHPRSRDVKIANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPPHIDIFHLTREIPASSKSALQCVMEVDEERIKLEKLAEELAMSEEDDAQEQLIDIYERLDDMSADLAEVKAARILHGLGFDKAMQQKQAKDFSGGWRMRIALARALFVKPHLLLLDEPTNHLDLDACVWLEEELKTYKRILVLISHSQDFLNGVCTNIIHLTGKRLKYYTGNYEAFVRTRMELLENQMKQYNWEQDQISHMKNYIARFGHGSAKLARQAQSKEKTLAKMVAQGLTEKVSDDKVLNFYFPSCGKVPPPVIMVQNVNFRYNDETPWIYKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNSHLRIARYHQHLHELLDLDASPLEYMMRAFPDVKEKEEMRKIIGRYGLTGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDMETIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETVTKWKGGILDYKDHLKNKITSENEKKA 607          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Fly
Match: CG9281 (gene:FBgn0030672 transcript:FBtr0074056)

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 368/552 (66.67%), Postives = 456/552 (82.61%), Query Frame = 2
Query:  293 SQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARRA 1948
            ++ RS TG L+ H  SRDV  +N  ITF G E+L DT LELN GRRYG IG NGCGKSSL AVL   E+PVP HID + L RE+P S K+ALQ VME DEE+++LEK AE LA+ ++ ++Q++L+++YERLDD+ A+ AE +AA IL GLGF K MQQK+ K FSGGWRMRI+LAR LFVKP LL+LDEPTNHLDL+ACVWLE+EL  Y RIL++ISHS+DFLNGVCTNIIH+  K+L YY GNY+ ++RT+ME  ENQMK+Y WEQDQ++HMK+YIARFGHGS KLARQAQSKEKTL KMV  GLT+KVS DK L F FPSCG++PPPVI +QNV+FRY++  P IY N++FGIDLDTR+ALVGPNGAGKSTLLKL+  +L PT G+IR++SH RI RYHQHL E+LDL++SP+++MM++FP++KE++EMRK +GRYGLTG QQ+CPI+ LSDGQRCR++FAWLA   PH+LLLDEPTNHLD+ETID+LADAIN+F+GG++LVSHDFRLI +VA+EIWVC   TVTKW G I  YK  L  +I  E+ ++A
Sbjct:   56 AEARSCTGSLAVHPRSRDVKIANFSITFFGSELLQDTMLELNCGRRYGLIGLNGCGKSSLLAVLGGREVPVPPHIDIFHLTREIPASSKSALQCVMEVDEERIKLEKLAEELAMSEEDDAQEQLIDIYERLDDMSADLAEVKAARILHGLGFDKAMQQKQAKDFSGGWRMRIALARALFVKPHLLLLDEPTNHLDLDACVWLEEELKTYKRILVLISHSQDFLNGVCTNIIHLTGKRLKYYTGNYEAFVRTRMELLENQMKQYNWEQDQISHMKNYIARFGHGSAKLARQAQSKEKTLAKMVAQGLTEKVSDDKVLNFYFPSCGKVPPPVIMVQNVNFRYNDETPWIYKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNSHLRIARYHQHLHELLDLDASPLEYMMRAFPDVKEKEEMRKIIGRYGLTGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDMETIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETVTKWKGGILDYKDHLKNKITSENEKKA 607          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Fly
Match: CG9330 (gene:FBgn0036888 transcript:FBtr0074940)

HSP 1 Score: 420.624 bits (1080), Expect = 8.161e-138
Identity = 222/537 (41.34%), Postives = 336/537 (62.57%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRL-EKEAEYLA-----LQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPL-IYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIE 1927
            S D+   N  + F  + +L +  L L+ GRRYG +G NG GK++L  ++A  +L +PSHI    +++E+   D  A+++V+E D E+ RL  +E E LA     +QD T S + L E Y  L +++A++A  RA+ IL GLGF  DMQ +  K FSGGWRMR++LAR LF KP LL+LDEPTN LD+ A +WLE  L  ++  ++++SH  +FL+ V T+IIH+  ++L  Y GNY+Q+ +TK E  ++Q ++Y+ +    AH++D+I RF + + + A   QSK K L+K+ +    + V ++  +   FP    + PPV+ I  V+FRY+   PL I+  ++     D+R+ +VG NGAGKSTLLK+I  +L    G I  H   RIG + QH  + L++N + +  + + FP  +  +E R++LG +G++G   +  I SLS GQ+ R+  A +    P+ L+LDEPTNHLD+ETID+L  AIN F+GG++LVSHD RLI  V  E+WVC + TV   +G +  YK  + KEIE
Sbjct:  175 SMDIKIENFDLAFGEKVLLQNANLLLSYGRRYGLVGRNGLGKTTLLRMIAERQLQIPSHISVLHVEQEVVGDDTPAVESVLECDTERTRLLTREKEILAALNNGVQDATLSNE-LSETYASLQNIEADKAVARASVILKGLGFDADMQLRPTKSFSGGWRMRLALARALFSKPDLLLLDEPTNMLDIKAIIWLENYLQTWATTILVVSHDRNFLDTVPTDIIHLHSQELEAYKGNYEQFEKTKTEKLKSQRREYEAQMAHRAHVQDFIDRFRYNANR-ASSVQSKIKMLEKLPE---LKPVEKETVVTLKFPEVEPLNPPVLAISEVTFRYNPEDPLPIFKGVNLSATSDSRICIVGENGAGKSTLLKIIVGQLSTIHGNIVLHRGLRIGYFAQHHVDHLNMNVTCVGVLAELFPG-RPDEEYRRQLGSFGISGPLALQSIASLSGGQKSRVALAKMCMAEPNFLVLDEPTNHLDIETIDALGRAINAFKGGVILVSHDERLIKVVCKELWVCGNRTVRAIEGGLDEYKREVYKEIE 705          

HSP 2 Score: 63.929 bits (154), Expect = 3.052e-10
Identity = 68/269 (25.28%), Postives = 111/269 (41.26%), Query Frame = 2
Query: 1283 IQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLT-------------------------EILD-LNSSPMDWMMK--------SFPNIKERDEMRKK---LGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYK-------ASLIKEIEQEHARRALIE 1957
            I+I+N    + E   ++  N +  +    R  LVG NG GK+TLL++IA      +  ++  SH  +    Q +                          EIL  LN+   D  +         S  NI+    + +    L   G     Q+ P KS S G R R+  A    + P +LLLDEPTN LD++ I  L + +  +   +L+VSHD   +  V  +I   +   +  + G+   ++        S  +E E + A RA ++
Sbjct:  178 IKIENFDLAFGEK--VLLQNANLLLSYGRRYGLVGRNGLGKTTLLRMIA------ERQLQIPSHISVLHVEQEVVGDDTPAVESVLECDTERTRLLTREKEILAALNNGVQDATLSNELSETYASLQNIEADKAVARASVILKGLGFDADMQLRPTKSFSGGWRMRLALARALFSKPDLLLLDEPTNMLDIKAIIWLENYLQTWATTILVVSHDRNFLDTVPTDIIHLHSQELEAYKGNYEQFEKTKTEKLKSQRREYEAQMAHRAHVQ 438          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Fly
Match: CG1703 (gene:FBgn0030321 transcript:FBtr0343647)

HSP 1 Score: 415.616 bits (1067), Expect = 1.071e-133
Identity = 215/552 (38.95%), Postives = 333/552 (60.33%), Query Frame = 2
Query:  290 VSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQ---DDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQM----AHMKDYIARFGHGSRKLAR-QAQSKEKTLKKMVDSGLTQKVSRDKGLV--FSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLI 1915
            +SQ +   G  ++  ++ D+   N  I+  G ++ ++  L + +GRRYG +GPNG GK++L   +A     +P +ID  L ++E+  +DKTA+  ++EAD  +  + K+A+ L  Q    D   Q+ L + +  L  + A  AE RA  IL GLGF+K+MQ +    FSGGWRMR+SLAR L+++P LLMLDEPTNHLDLNA +WL+  L  + + L+I+SH + FL+ VC  IIH+  KKL YY GNY  + +  ++     +K+Y+ ++ ++    AH +   A        L R Q ++K K  K+  D G  + ++R K  +  F FP   ++ PP++ + NV+F +   KPL +  +DFGIDL +RVA+VGPNG GKST LKL+  ELEP +G  R++    +GR+ QH  E L    S  +++ + F N+   ++ RK LG +GL        +K LS GQ+ R+  A L  + P +L+LDEPTN+LD+E+ID+LA+AINE+EGG+++VSHD RLI      ++V    T+ +  G+   Y+  ++
Sbjct:  333 MSQVQKSAGQKAALEQAVDIKIENFTISAKGNDLFVNANLLIAHGRRYGLVGPNGHGKTTLLRHIATRAFAIPPNIDVLLCEQEVVATDKTAINTILEADVRRTEMLKKADELEKQFVAGDLTVQEELNDTFAELKAIGAYSAEARARRILAGLGFSKEMQDRPTNKFSGGWRMRVSLARALYLEPTLLMLDEPTNHLDLNAVIWLDNYLQGWKKTLLIVSHDQSFLDNVCNEIIHLDQKKLQYYKGNYSMFKKMYVQKRREMIKEYEKQEKRLRELKAHGQSKKAAEKKQKESLTRKQEKNKSKQQKQDEDEGPQELLARPKEYIVKFRFPEPSQLQPPILGVHNVTFAFPSQKPL-FIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQRKNHRLHVGRFDQHSGEHLTAEESAAEYLQRLF-NLP-HEKARKALGSFGLVSHAHTIKMKDLSGGQKARVALAELCLSAPDVLILDEPTNNLDIESIDALAEAINEYEGGVIIVSHDERLIRETGCTLYVIEDQTINEIVGEFDDYRKEVL 881          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Zebrafish
Match: abcf2a (ATP-binding cassette, sub-family F (GCN20), member 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8714])

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 372/549 (67.76%), Postives = 464/549 (84.52%), Query Frame = 2
Query:  287 KVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            K ++ R+VTGVL+SH  S DVH S++ +TFHGQE+L DT+LELN+GRRYG IG NG GKS L + +++ E+P+P HID Y L REM PS+KTALQ VME DEE+++LEKEAE LA  +D+E + +L+E+YERL++LDA++A  RA+ IL GLGFT  MQQK++K FSGGWRMR++LAR LF+KP +L+LDEPTNHLDL+ACVWLE+ELSQ+ RIL++ISHS+DFLNGVCTNIIH+  +KL YY GNYDQY++T+ E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT++V  DK L F FP CG+IPPPVI +QNVSFRY EN P IY N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL P+DG+IR+HSH +IGRYHQHLTE L+L+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LA+AIN+FEGG++LVSHDFRLI +VA EIWVC   T+TKW  DI +YK  L  +I+++
Sbjct:   63 KKTEARAVTGVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAISHREVPIPEHIDIYHLTREMAPSEKTALQCVMEVDEERIKLEKEAERLA-HEDSECE-KLMELYERLEELDADKASMRASRILHGLGFTTSMQQKKLKDFSGGWRMRVALARALFLKPFMLLLDEPTNHLDLDACVWLEEELSQFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTERVVNDKTLSFYFPPCGKIPPPVIMVQNVSFRYSENTPYIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPSDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINDFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWSRDILAYKEHLKSKIDKQ 609          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Zebrafish
Match: abcf2a (ATP-binding cassette, sub-family F (GCN20), member 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8714])

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 372/549 (67.76%), Postives = 464/549 (84.52%), Query Frame = 2
Query:  287 KVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            K ++ R+VTGVL+SH  S DVH S++ +TFHGQE+L DT+LELN+GRRYG IG NG GKS L + +++ E+P+P HID Y L REM PS+KTALQ VME DEE+++LEKEAE LA  +D+E + +L+E+YERL++LDA++A  RA+ IL GLGFT  MQQK++K FSGGWRMR++LAR LF+KP +L+LDEPTNHLDL+ACVWLE+ELSQ+ RIL++ISHS+DFLNGVCTNIIH+  +KL YY GNYDQY++T+ E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT++V  DK L F FP CG+IPPPVI +QNVSFRY EN P IY N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL P+DG+IR+HSH +IGRYHQHLTE L+L+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LA+AIN+FEGG++LVSHDFRLI +VA EIWVC   T+TKW  DI +YK  L  +I+++
Sbjct:   63 KKTEARAVTGVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAISHREVPIPEHIDIYHLTREMAPSEKTALQCVMEVDEERIKLEKEAERLA-HEDSECE-KLMELYERLEELDADKASMRASRILHGLGFTTSMQQKKLKDFSGGWRMRVALARALFLKPFMLLLDEPTNHLDLDACVWLEEELSQFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTERVVNDKTLSFYFPPCGKIPPPVIMVQNVSFRYSENTPYIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPSDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINDFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWSRDILAYKEHLKSKIDKQ 609          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Zebrafish
Match: abcf2b (ATP-binding cassette, sub-family F (GCN20), member 2b [Source:ZFIN;Acc:ZDB-GENE-050506-58])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 378/581 (65.06%), Postives = 473/581 (81.41%), Query Frame = 2
Query:  197 DDEFMGSEDEEDSK--MAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            DD    +E   D+   +A L  E++   +   + ++ R+VTGVL+SH  S DVH S++ +TFHGQE+L DT+LELN+GRRYG IG NG GKS L + + + E+P+P HID + L REM PS+KTALQ VME DEE+++LEKEAE LA  +D+E + +L+E+YERL++LDA++AE RA+ ILFGLGFT  MQ+K++K FSGGWRMR+SLAR LF+KP +L+LDEPTNHLDL+ACVWLE+EL  + RIL++ISHS+DFLNGVCTNIIH+  +KL YY GNYDQY++T+ E EENQMK+Y WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT +V  DK L F FP CG IPPPVI +QNVSFRY  +  +IY N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHLTE L+L+ SP+++MMK FP IKE++EMRK +G YGLTG QQ+ PI++LSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LA+AINEFEGG++LVSHDFRLI +VA EIWVC   T+TKW GDI +YK  L  +I+++
Sbjct:   37 DDPVNDAETNGDANGDVAALSKELDEFEM---RKTEARAVTGVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIFHLTREMAPSEKTALQCVMEVDEERIKLEKEAERLA-HEDSECE-KLMEIYERLEELDADKAEVRASRILFGLGFTPAMQRKKLKDFSGGWRMRVSLARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRYNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTARVMNDKTLSFYFPPCGTIPPPVIMVQNVSFRYSSDTQIIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCFPEIKEKEEMRKIIGCYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWKGDILAYKEHLKSKIDKQ 612          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Zebrafish
Match: abcf1 (ATP-binding cassette, sub-family F (GCN20), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-31])

HSP 1 Score: 372.474 bits (955), Expect = 1.798e-117
Identity = 213/545 (39.08%), Postives = 341/545 (62.57%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQ----DDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSG----------LTQKVSRDK--GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
            + D+      I+ HG+E+ ++  L +  GRRYG +GPNG GK++L   +AN  L +P +ID  L ++E+   D  A+QAV++AD  +++L +E   L  +    DD+ S+ RL +VYE L  + A  AE +A  IL GL FT +MQ +  K FSGGWRMR+SLAR LF++P LLMLDEPTNHLDLNA +WL   L  + + L+I+SH + FL+ VCT+IIH+ ++KL YY GNY  + +  ++ ++   K+Y  ++ ++  +K      G  S K A + Q+KE   +K                T+ + R K   + F+FP+   + PP++ + +V F Y   KPL + N+DFGID+++R+ +VGPNG GKSTLL L+  +L PT G +R++   ++G ++Q   + L+++ +  +++ ++F N++ +D  RK LGR+GL        I  LS GQ+ R++F+ L+   P +L+LDEPTN+LD+E+ID+L++AINE++G +++VSHD RLI     ++WV    ++ + DGD   YK  +++ +
Sbjct:  313 ASDIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADDTPAVQAVLKADTRRLKLLEEERQLQSRLEKGDDSVSE-RLDKVYEELRAIGAAAAEAKARRILAGLSFTPEMQNRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQSWKKTLLIVSHDQSFLDDVCTDIIHLDNQKLYYYRGNYLTFKKMYIQKQKELQKQYDKQEKKLKDLK-----AGGKSTKQA-EKQTKEALTRKQQKGKKKSQEEESHEATELLKRPKEYTVKFTFPNPPPLSPPILGLHSVDFGYEGQKPL-FKNVDFGIDMESRICIVGPNGVGKSTLLLLLTGKLNPTKGEMRKNHRLKVGFFNQQYADQLNMDEAATEYLQRNF-NLQYQDS-RKCLGRFGLESHAHTIQISKLSGGQKARVVFSELSCRQPDVLILDEPTNNLDIESIDALSEAINEYKGAVIIVSHDARLITETQCQLWVVEDQSINQIDGDFEDYKREVLEAL 847          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Zebrafish
Match: abcf1 (ATP-binding cassette, sub-family F (GCN20), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-31])

HSP 1 Score: 372.474 bits (955), Expect = 3.200e-117
Identity = 213/545 (39.08%), Postives = 341/545 (62.57%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQ----DDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSG----------LTQKVSRDK--GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
            + D+      I+ HG+E+ ++  L +  GRRYG +GPNG GK++L   +AN  L +P +ID  L ++E+   D  A+QAV++AD  +++L +E   L  +    DD+ S+ RL +VYE L  + A  AE +A  IL GL FT +MQ +  K FSGGWRMR+SLAR LF++P LLMLDEPTNHLDLNA +WL   L  + + L+I+SH + FL+ VCT+IIH+ ++KL YY GNY  + +  ++ ++   K+Y  ++ ++  +K      G  S K A + Q+KE   +K                T+ + R K   + F+FP+   + PP++ + +V F Y   KPL + N+DFGID+++R+ +VGPNG GKSTLL L+  +L PT G +R++   ++G ++Q   + L+++ +  +++ ++F N++ +D  RK LGR+GL        I  LS GQ+ R++F+ L+   P +L+LDEPTN+LD+E+ID+L++AINE++G +++VSHD RLI     ++WV    ++ + DGD   YK  +++ +
Sbjct:  333 ASDIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADDTPAVQAVLKADTRRLKLLEEERQLQSRLEKGDDSVSE-RLDKVYEELRAIGAAAAEAKARRILAGLSFTPEMQNRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQSWKKTLLIVSHDQSFLDDVCTDIIHLDNQKLYYYRGNYLTFKKMYIQKQKELQKQYDKQEKKLKDLK-----AGGKSTKQA-EKQTKEALTRKQQKGKKKSQEEESHEATELLKRPKEYTVKFTFPNPPPLSPPILGLHSVDFGYEGQKPL-FKNVDFGIDMESRICIVGPNGVGKSTLLLLLTGKLNPTKGEMRKNHRLKVGFFNQQYADQLNMDEAATEYLQRNF-NLQYQDS-RKCLGRFGLESHAHTIQISKLSGGQKARVVFSELSCRQPDVLILDEPTNNLDIESIDALSEAINEYKGAVIIVSHDARLITETQCQLWVVEDQSINQIDGDFEDYKREVLEAL 867          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 428.328 bits (1100), Expect = 2.064e-140
Identity = 223/547 (40.77%), Postives = 340/547 (62.16%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYL-----ALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            S   +S D+   N  ++F  + +L    L L  GRRYG +G NG GK++L  +LA   L VPSHI    +++E+   +  ALQ+V+E D  + RL +E + L     A + D     RL E+Y +L++++A++A  RA+ IL GLGF   MQQ+  K FSGGWRMR++LAR LF +P LL+LDEPTN LD+ A +WLE  L  +   ++++SH  +FLN V T+I+H+  ++L  Y GN++ +++TK E  +NQ ++Y+ +Q    H++ +I RF + + + A Q QSK K L+K+ +    + V +D  ++  FP   E   PP++Q+  + F Y  ++P ++ N+    DLD+R+ +VG NGAGKST+LKL+  EL P  G+   H + +IG + QH  + LDLN S ++ + K F   K  +E R +LG YG++G   + P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L  A+N+F+GG++LVSHD R I  V  E+WVC +G VT+ +G    Y     + I QE  RR
Sbjct:  172 SGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQVFIDRFRYNANR-ASQVQSKLKLLEKLPE---LKPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQP-VFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSG-KTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEY-----RNILQEQFRR 707          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 399.053 bits (1024), Expect = 1.315e-130
Identity = 210/549 (38.25%), Postives = 323/549 (58.83%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYL-----ALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLAR-CLFVKPALL-MLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            S   +S D+   N  ++F  + +L    L L  GRRYG +G NG GK++L  +LA   L VPSHI    +++E+   +  ALQ+V+E D  + RL +E + L     A + D     RL E+Y +L++++A++A  RA+ IL GLGF   MQQ+  K FSGGWRMR++LAR  LF    L+ ++ EPTN LD+ A +WLE  L  +   ++++SH  +FLN V T+I+H+  ++L  Y GN++ +++TK E  +NQ ++Y+ +Q    H++ Y+A+                            + V +D  ++  FP   E   PP++Q+  + F Y  ++P ++ N+    DLD+R+ +VG NGAGKST+LKL+  EL P  G+   H + +IG + QH  + LDLN S ++ + K F   K  +E R +LG YG++G   + P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L  A+N+F+GG++LVSHD R I  V  E+WVC +G VT+ +G    Y     + I QE  RR
Sbjct:   80 SGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARLVLFACKTLISIILEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQIYLAKL---------------------------KPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQP-VFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSG-KTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEY-----RNILQEQFRR 594          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 398.282 bits (1022), Expect = 1.167e-129
Identity = 210/549 (38.25%), Postives = 323/549 (58.83%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYL-----ALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLAR-CLFVKPALL-MLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            S   +S D+   N  ++F  + +L    L L  GRRYG +G NG GK++L  +LA   L VPSHI    +++E+   +  ALQ+V+E D  + RL +E + L     A + D     RL E+Y +L++++A++A  RA+ IL GLGF   MQQ+  K FSGGWRMR++LAR  LF    L+ ++ EPTN LD+ A +WLE  L  +   ++++SH  +FLN V T+I+H+  ++L  Y GN++ +++TK E  +NQ ++Y+ +Q    H++ Y+A+                            + V +D  ++  FP   E   PP++Q+  + F Y  ++P ++ N+    DLD+R+ +VG NGAGKST+LKL+  EL P  G+   H + +IG + QH  + LDLN S ++ + K F   K  +E R +LG YG++G   + P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L  A+N+F+GG++LVSHD R I  V  E+WVC +G VT+ +G    Y     + I QE  RR
Sbjct:  126 SGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARLVLFACKTLISIILEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQIYLAKL---------------------------KPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQP-VFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSG-KTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEY-----RNILQEQFRR 640          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 399.053 bits (1024), Expect = 2.009e-129
Identity = 210/549 (38.25%), Postives = 323/549 (58.83%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYL-----ALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLAR-CLFVKPALL-MLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            S   +S D+   N  ++F  + +L    L L  GRRYG +G NG GK++L  +LA   L VPSHI    +++E+   +  ALQ+V+E D  + RL +E + L     A + D     RL E+Y +L++++A++A  RA+ IL GLGF   MQQ+  K FSGGWRMR++LAR  LF    L+ ++ EPTN LD+ A +WLE  L  +   ++++SH  +FLN V T+I+H+  ++L  Y GN++ +++TK E  +NQ ++Y+ +Q    H++ Y+A+                            + V +D  ++  FP   E   PP++Q+  + F Y  ++P ++ N+    DLD+R+ +VG NGAGKST+LKL+  EL P  G+   H + +IG + QH  + LDLN S ++ + K F   K  +E R +LG YG++G   + P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L  A+N+F+GG++LVSHD R I  V  E+WVC +G VT+ +G    Y     + I QE  RR
Sbjct:  172 SGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARLVLFACKTLISIILEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQIYLAKL---------------------------KPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQP-VFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSG-KTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEY-----RNILQEQFRR 686          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Xenopus
Match: matn1 (matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559])

HSP 1 Score: 398.282 bits (1022), Expect = 2.804e-129
Identity = 210/549 (38.25%), Postives = 323/549 (58.83%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYL-----ALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLAR-CLFVKPALL-MLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            S   +S D+   N  ++F  + +L    L L  GRRYG +G NG GK++L  +LA   L VPSHI    +++E+   +  ALQ+V+E D  + RL +E + L     A + D     RL E+Y +L++++A++A  RA+ IL GLGF   MQQ+  K FSGGWRMR++LAR  LF    L+ ++ EPTN LD+ A +WLE  L  +   ++++SH  +FLN V T+I+H+  ++L  Y GN++ +++TK E  +NQ ++Y+ +Q    H++ Y+A+                            + V +D  ++  FP   E   PP++Q+  + F Y  ++P ++ N+    DLD+R+ +VG NGAGKST+LKL+  EL P  G+   H + +IG + QH  + LDLN S ++ + K F   K  +E R +LG YG++G   + P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L  A+N+F+GG++LVSHD R I  V  E+WVC +G VT+ +G    Y     + I QE  RR
Sbjct:  152 SGKNKSYDIRIENFDVSFGERVLLTGAELHLATGRRYGLVGRNGLGKTTLLKMLAGRSLRVPSHISILHVEQEVAGDETPALQSVLECDTLRERLLQEEKELNTKISAGRGDGSESLRLSEIYSKLEEIEADKAPARASVILAGLGFKHSMQQQMTKEFSGGWRMRLALARLVLFACKTLISIILEPTNMLDVRAILWLECYLQTWPSTILVVSHDRNFLNAVATDIVHLHSQRLEAYRGNFESFLKTKEERLKNQQREYEAQQQYREHIQIYLAKL---------------------------KPVEKDTEVILRFPDGFEKFSPPILQLDEIGFWYSSDQP-VFKNLSVSADLDSRICVVGENGAGKSTMLKLLMGELSPVQGIRNAHRNLKIGYFSQHHVDQLDLNISAVELLAKRFSG-KTEEEYRHQLGSYGISGELAVRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNKFKGGVILVSHDERFIRLVCQELWVCENGGVTRIEGGFDEY-----RNILQEQFRR 666          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Mouse
Match: Abcf2 (ATP-binding cassette, sub-family F (GCN20), member 2 [Source:MGI Symbol;Acc:MGI:1351657])

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 378/586 (64.51%), Postives = 468/586 (79.86%), Query Frame = 2
Query:  155 NGDAKDHKHTKHELDDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            NGDA        E  +E  G E   D ++  L  E+E   +   K +  R+VTGVL+SH  S DVH  N+ +TFHGQE+L DT LELN+GRRYG IG NG GKS L + +   E+P+P HID Y L REMPPS+KT LQ VME D E+  LE+EAE LA  +D E + +L+E+YERL++LDA++AE RA+ IL GLGFT  MQ+K++K FSGGWRMR++LAR LF++P +L+LDEPTNHLDL+ACVWLE+EL  + RIL+++SHS+DFLNGVCTNIIHM +KKL YY GNYDQY++T++E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KM+ SGLT++V  DK L F FP CG+IPPPVI +QNVSF+Y ++ P IY+N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHL E LDL+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+  AWLA   PHML LDEPTNHLD+ETID+LADAINEFEGG++LVSHDFRLI +VA EIWVC   T+TKW GDI +YK  L
Sbjct:   30 NGDAVTEPQVAEEKIEEANGRETTGDGEVDLLTKELEDFEM---KKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSEKTPLQCVMEVDTERAMLEREAERLA-HEDAECE-KLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHL 610          

HSP 2 Score: 63.929 bits (154), Expect = 4.548e-10
Identity = 71/269 (26.39%), Postives = 111/269 (41.26%), Query Frame = 2
Query: 1235 GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYH--------------------------QHLTEILDLNSSPMDWMMKSFPNIKERD----EMR--KKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            G++ S P+  ++      I N+S  +H  +  +  +    ++   R  L+G NG GKS LL  I     P    I  H    I  YH                          +   E L    +  + +M+ +  ++E D    EMR  + L   G T A Q   +K  S G R R+  A      P MLLLDEPTNHLDL+    L + +  F+  L+LVSH    +  V   I   ++  +  + G+   Y  + + E+E+   +R
Sbjct:   80 GVLASHPNSTDV-----HIINLSLTFHGQE--LLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVP----IPEH----IDIYHLTREMPPSEKTPLQCVMEVDTERAMLEREAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRL-ELEENQMKR 332          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Mouse
Match: Abcf3 (ATP-binding cassette, sub-family F (GCN20), member 3 [Source:MGI Symbol;Acc:MGI:1351656])

HSP 1 Score: 433.721 bits (1114), Expect = 1.270e-142
Identity = 219/543 (40.33%), Postives = 342/543 (62.98%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEAD---EEKMRLEKEAEYLALQDDTESQD--RLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            S   +S DV   N  ++F  + +L    + L  GRRYG +G NG GK++L  +LA   L VP+HI    +++E+   D  ALQ+V+E+D   E+ +R E+E          E  +  +L E+Y +L++++A++A  RA+ IL GLGFT  MQQ+  + FSGGWRMR++LAR LF +P LL+LDEPTN LD+ A +WLE  L  +   ++++SH  +FLN + T+IIH+  ++L  Y G+++ +I++K E   NQ ++Y+ +Q    H++ +I RF + + + A Q QSK K L+K+ +    + V ++  +V  FP   E   PP++Q+  V F Y++ K  I+  +    DL++R+ +VG NGAGKST+LKL+  +L P  G+   H + +IG + QH  E LDLN S ++ + + FP + E +E R +LGRYG++G   + P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L  A+N F GG++LVSHD R I  V  E+WVC +G+VT+ +G    Y+A L ++  +E
Sbjct:  170 SGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANR-ASQVQSKLKMLEKLPE---LKPVDKESEVVLKFPDGFEKFSPPILQLDEVDF-YYDPKHSIFSRLSVSADLESRICVVGENGAGKSTMLKLLMGDLSPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGLPE-EEYRHQLGRYGISGELAMRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGQALNNFRGGVILVSHDERFIRLVCKELWVCENGSVTRVEGGFDQYRALLQEQFRRE 706          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Mouse
Match: Abcf1 (ATP-binding cassette, sub-family F (GCN20), member 1 [Source:MGI Symbol;Acc:MGI:1351658])

HSP 1 Score: 360.918 bits (925), Expect = 2.696e-113
Identity = 220/580 (37.93%), Postives = 345/580 (59.48%), Query Frame = 2
Query:  257 EIESLNLCSEKVSQYRSVTGVLSSHR----ESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQ----DDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKY--------------KWEQDQMAHMKDYIARFGHGSRKLARQAQSKE--KTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
            ++ESL   +   + +      +SS +     + D+      I+ HG+E+ ++  L +  GRRYG +GPNG GK++L   +AN  L +P +ID  L ++E+   +  A+QAV+ AD +++RL +E   L  Q    DDT ++ +L +VYE L    A  AE +A  IL GLGF  +MQ +  + FSGGWRMR+SLAR LF++P LLMLDEPTNHLDLNA +WL   L  + + L+I+SH + FL+ VCT+IIH+  ++L YY GNY  + +   + ++  +K+Y              K  +      K+ + R     R+  +  +S+E  + LK+           ++  + F+FP    + PPV+ +  V+F Y   KPL + N+DFGID+D+R+ +VGPNG GKSTLL L+  +L PT+G +R++   +IG ++Q   E L +  +P +++ +SF N+  +D  RK LGR+GL        I  LS GQ+ R++FA LA   P +L+LDEPTN+LD+E+ID+L +AIN+++G +++VSHD RLI     ++WV     V++ DGD   YK  +++ +
Sbjct:  262 QVESLKAANAAENDFSVSQAEVSSRQAMLENASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLRLLEEERRLQGQLEQGDDTAAE-KLEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDTQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQEPPELLKR----------PKEYTVRFTFPDPPPLSPPVLGLHGVTFGYEGQKPL-FKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTNGEMRKNHRLKIGFFNQQYAEQLHMEETPTEYLQRSF-NLPYQD-ARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINDYKGAVIVVSHDARLITETNCQLWVVEEQGVSQIDGDFDDYKREVLEAL 827          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Mouse
Match: Abcf3 (ATP-binding cassette, sub-family F (GCN20), member 3 [Source:MGI Symbol;Acc:MGI:1351656])

HSP 1 Score: 310.457 bits (794), Expect = 9.410e-97
Identity = 161/419 (38.42%), Postives = 257/419 (61.34%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEAD---EEKMRLEKEAEYLALQDDTESQD--RLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFP 1561
            S   +S DV   N  ++F  + +L    + L  GRRYG +G NG GK++L  +LA   L VP+HI    +++E+   D  ALQ+V+E+D   E+ +R E+E          E  +  +L E+Y +L++++A++A  RA+ IL GLGFT  MQQ+  + FSGGWRMR++LAR LF +P LL+LDEPTN LD+ A +WLE  L  +   ++++SH  +FLN + T+IIH+  ++L  Y G+++ +I++K E   NQ ++Y+ +Q    H++ +I RF + + + A Q QSK K L+K+ +    + V ++  +V  FP   E   PP++Q+  V F Y++ K  I+  +    DL++R+ +VG NGAGKST+LKL+  +L P  G+   H + +IG + QH  E LDLN S ++ + + FP
Sbjct:  164 SGKNKSYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVEQEVAGDDTPALQSVLESDTVREDLLRQERELSLRIAAGRAEGSEAAQLAEIYGKLEEIEADKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANR-ASQVQSKLKMLEKLPE---LKPVDKESEVVLKFPDGFEKFSPPILQLDEVDF-YYDPKHSIFSRLSVSADLESRICVVGENGAGKSTMLKLLMGDLSPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFP 577          

HSP 2 Score: 55.8398 bits (133), Expect = 1.388e-7
Identity = 33/105 (31.43%), Postives = 50/105 (47.62%), Query Frame = 2
Query: 1595 LGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKAS 1909
            L   G T   Q  P +  S G R R+  A      P +LLLDEPTN LD+  I  L + +  +   +L+VSHD   +  +A +I   +   +  + GD  ++  S
Sbjct:  305 LAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKS 409          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Mouse
Match: Abcf3 (ATP-binding cassette, sub-family F (GCN20), member 3 [Source:MGI Symbol;Acc:MGI:1351656])

HSP 1 Score: 132.494 bits (332), Expect = 5.240e-35
Identity = 74/223 (33.18%), Postives = 120/223 (53.81%), Query Frame = 2
Query:  854 DEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILD 1519
            DEPTN LD+ A +WLE  L  +   ++++SH  +FLN + T+IIH+  ++L  Y G+++ +I++K E   NQ ++Y+ +Q    H++ +I RF + + + A Q QSK K L+K+ +    + V ++  +V  FP   E   PP++Q+  V                            G NGAGKST+LKL+  +L P  G+   H + +IG + QH  E LD
Sbjct:    2 DEPTNMLDVRAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERLLNQQREYEAQQQYRQHIQVFIDRFRYNANR-ASQVQSKLKMLEKLPE---LKPVDKESEVVLKFPDGFEKFSPPILQLDEV----------------------------GENGAGKSTMLKLLMGDLSPVRGIRHAHRNLKIGYFSQHHVEQLD 192          
BLAST of ATP-binding cassette sub-family F member 2 vs. UniProt/SwissProt
Match: sp|Q99LE6|ABCF2_MOUSE (ATP-binding cassette sub-family F member 2 OS=Mus musculus OX=10090 GN=Abcf2 PE=1 SV=1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 378/586 (64.51%), Postives = 468/586 (79.86%), Query Frame = 2
Query:  155 NGDAKDHKHTKHELDDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            NGDA        E  +E  G E   D ++  L  E+E   +   K +  R+VTGVL+SH  S DVH  N+ +TFHGQE+L DT LELN+GRRYG IG NG GKS L + +   E+P+P HID Y L REMPPS+KT LQ VME D E+  LE+EAE LA  +D E + +L+E+YERL++LDA++AE RA+ IL GLGFT  MQ+K++K FSGGWRMR++LAR LF++P +L+LDEPTNHLDL+ACVWLE+EL  + RIL+++SHS+DFLNGVCTNIIHM +KKL YY GNYDQY++T++E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KM+ SGLT++V  DK L F FP CG+IPPPVI +QNVSF+Y ++ P IY+N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHL E LDL+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+  AWLA   PHML LDEPTNHLD+ETID+LADAINEFEGG++LVSHDFRLI +VA EIWVC   T+TKW GDI +YK  L
Sbjct:   30 NGDAVTEPQVAEEKIEEANGRETTGDGEVDLLTKELEDFEM---KKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSEKTPLQCVMEVDTERAMLEREAERLA-HEDAECE-KLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHL 610          

HSP 2 Score: 63.929 bits (154), Expect = 3.181e-9
Identity = 71/269 (26.39%), Postives = 111/269 (41.26%), Query Frame = 2
Query: 1235 GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYH--------------------------QHLTEILDLNSSPMDWMMKSFPNIKERD----EMR--KKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            G++ S P+  ++      I N+S  +H  +  +  +    ++   R  L+G NG GKS LL  I     P    I  H    I  YH                          +   E L    +  + +M+ +  ++E D    EMR  + L   G T A Q   +K  S G R R+  A      P MLLLDEPTNHLDL+    L + +  F+  L+LVSH    +  V   I   ++  +  + G+   Y  + + E+E+   +R
Sbjct:   80 GVLASHPNSTDV-----HIINLSLTFHGQE--LLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVP----IPEH----IDIYHLTREMPPSEKTPLQCVMEVDTERAMLEREAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRL-ELEENQMKR 332          
BLAST of ATP-binding cassette sub-family F member 2 vs. UniProt/SwissProt
Match: sp|Q9UG63|ABCF2_HUMAN (ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 371/562 (66.01%), Postives = 459/562 (81.67%), Query Frame = 2
Query:  227 EDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            E +++  L  E+E   +   K +  R+VTGVL+SH  S DVH  N+ +TFHGQE+L DT LELN+GRRYG IG NG GKS L + +   E+P+P HID Y L REMPPSDKT L  VME D E+  LEKEAE LA  +D E + +L+E+YERL++LDA++AE RA+ IL GLGFT  MQ+K++K FSGGWRMR++LAR LF++P +L+LDEPTNHLDL+ACVWLE+EL  + RIL+++SHS+DFLNGVCTNIIHM +KKL YY GNYDQY++T++E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KM+ SGLT++V  DK L F FP CG+IPPPVI +QNVSF+Y ++ P IY+N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHL E LDL+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+  AWLA   PHML LDEPTNHLD+ETID+LADAINEFEGG++LVSHDFRLI +VA EIWVC   T+TKW GDI +YK  L
Sbjct:   49 ETTEVDLLTKELEDFEM---KKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLA-HEDAECE-KLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHL 605          

HSP 2 Score: 67.3958 bits (163), Expect = 2.409e-10
Identity = 70/264 (26.52%), Postives = 114/264 (43.18%), Query Frame = 2
Query: 1235 GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIAS----------------ELEPTDGLIRRHSHCRIGRYHQHL-----TEILDLNSSPMDWMMKSFPNIKERD----EMR--KKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            G++ S P+  ++      I N+S  +H  +  +  +    ++   R  L+G NG GKS LL  I                  E+ P+D   +   HC +    +        E L    +  + +M+ +  ++E D    EMR  + L   G T A Q   +K  S G R R+  A      P MLLLDEPTNHLDL+    L + +  F+  L+LVSH    +  V   I   ++  +  + G+   Y  + + E+E+   +R
Sbjct:   75 GVLASHPNSTDV-----HIINLSLTFHGQE--LLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSD---KTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRL-ELEENQMKR 327          
BLAST of ATP-binding cassette sub-family F member 2 vs. UniProt/SwissProt
Match: sp|Q2KJA2|ABCF2_BOVIN (ATP-binding cassette sub-family F member 2 OS=Bos taurus OX=9913 GN=ABCF2 PE=2 SV=1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 371/586 (63.31%), Postives = 457/586 (77.99%), Query Frame = 2
Query:  155 NGDAKDHKHTKHELDDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            NGDA        E ++E  G E  E   +  L  E+E   +   K +  R+VTGVL+SH  S D H  N+ +TFHGQE+L DT LELN+GRRYG IG NG GKS L + +   E+P+P HID Y L REMPPSDKT LQ VME D E+  LE+EAE LA  +D E +  L       +  DA++AE RA+ IL GLGFT  MQ+K++K FSGGWRMR++LAR LF++P +L+LDEPTNHLDL+ACVWLE+EL  + RIL+++SHS+DFLNGVCTNIIHM +KKL YY GNYDQY++T++E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KM+ SGLT++V  DK L F FP CG+IPPPVI +QNVSF+Y ++ P IY+N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHL E LDL+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+  AWLA   PHML LDEPTNHLD+ETID+LADAIN+FEGG++LVSHDFRLI +VA EIWVC   T+TKW GDI +YK  L
Sbjct:   30 NGDAITEPQVAEERNEEANGRETTE---VDLLTKELEDFEM---KKAAARAVTGVLASHPNSTDAHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLQCVMEVDTERAMLEREAERLA-HEDAECEKLLELYERLEEL-DADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINDFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHL 607          

HSP 2 Score: 59.3066 bits (142), Expect = 7.654e-8
Identity = 73/271 (26.94%), Postives = 113/271 (41.70%), Query Frame = 2
Query: 1235 GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLT-EILDLNSSPMDWMMK--SFPNIKERD-----------------------------EMR--KKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            G++ S P+  +       I N+S  +H  +  +  +    ++   R  L+G NG GKS LL  I     P    I  H    I  YH  LT E+   + +P+  +M+  +   + ER+                             EMR  + L   G T A Q   +K  S G R R+  A      P MLLLDEPTNHLDL+    L + +  F+  L+LVSH    +  V   I   ++  +  + G+   Y  + + E+E+   +R
Sbjct:   77 GVLASHPNSTDA-----HIINLSLTFHGQE--LLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVP----IPEH----IDIYH--LTREMPPSDKTPLQCVMEVDTERAMLEREAERLAHEDAECEKLLELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRL-ELEENQMKR 329          
BLAST of ATP-binding cassette sub-family F member 2 vs. UniProt/SwissProt
Match: sp|Q9FJH6|AB1F_ARATH (ABC transporter F family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCF1 PE=2 SV=1)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 335/537 (62.38%), Postives = 423/537 (78.77%), Query Frame = 2
Query:  302 RSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            R+ TGVL SH +SRD+   ++ +TFHG ++++D+ LELN GRRYG +G NGCGKS+L   +   E+P+P  +D Y L  E+  +D ++L+AV+  DEE++RLEKE E L  QDD    +RL  +YERLD +DAE AEKRAAEILFGLGF K+MQ K+ K FSGGWRMRI+LAR LF+ P +L+LDEPTNHLDL ACVWLE+ L  + RIL+++SHS+DFLNGVCTNIIHMQ K+L YY GN+DQY +T+ E EENQMK+Y+WEQ+Q++HMK+YIARFGHGS KLARQAQSKEKTL KM   GLT+KV+RD  LVF F   G++PPPV+Q   VSF Y  +  LIY NIDFG+DLD+RVALVGPNGAGKSTLLKL+  EL PT+G++RRH+H +I +YHQHL E LDL    + +MM+ FP  +E ++MR  +GR+GLTG  Q+ P+K+LSDGQR R+IFAWLA   P+MLLLDEPTNHLD+ETIDSLA+A+NE++GGL+LVSHDFRLI +VA EIWVC    +TKW+GDI  +K  L
Sbjct:   54 RTCTGVLCSHPQSRDIRIESLSVTFHGYDLIVDSMLELNYGRRYGLLGLNGCGKSTLLTAIGRREIPIPDQMDIYHLSHEIEATDMSSLEAVVSCDEERLRLEKEVEILVQQDDG-GGERLQSIYERLDAMDAETAEKRAAEILFGLGFDKEMQAKKTKDFSGGWRMRIALARALFIMPTILLLDEPTNHLDLEACVWLEESLKNFDRILVVVSHSQDFLNGVCTNIIHMQSKQLKYYTGNFDQYCQTRSELEENQMKQYRWEQEQISHMKEYIARFGHGSAKLARQAQSKEKTLAKMERGGLTEKVARDSVLVFRFADVGKLPPPVLQFVEVSFGYTPDY-LIYKNIDFGVDLDSRVALVGPNGAGKSTLLKLMTGELHPTEGMVRRHNHLKIAQYHQHLAEKLDLELPALLYMMREFPGTEE-EKMRAAIGRFGLTGKAQVMPMKNLSDGQRSRVIFAWLAYKQPNMLLLDEPTNHLDIETIDSLAEALNEWDGGLVLVSHDFRLINQVAHEIWVCEKQCITKWNGDIMDFKRHL 587          
BLAST of ATP-binding cassette sub-family F member 2 vs. UniProt/SwissProt
Match: sp|Q8T6B7|ABCF2_DICDI (ABC transporter F family member 2 OS=Dictyostelium discoideum OX=44689 GN=abcF2 PE=3 SV=1)

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 292/538 (54.28%), Postives = 386/538 (71.75%), Query Frame = 2
Query:  305 SVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYH-ENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNI-KERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            + TG L+S   SRDV    V +TFHG+E+L DTT+E+N GRRYG IG NGCGKS+ F  LA  ELP+P HID + L  E  PS++TALQ+V++  E++++  +  E   L++     + L +VYERL++LD      RA+EIL GLGFT     K+ K  SGGWRMR+SLA+ LF+KP LL+LDEPTNHLDL ACVWLE  L+ Y R LIIISHS+DFLN VCTNIIHM   KL YY GNYD +++TK E E NQMK Y  +Q+++AH+K +IA  G  S  L RQ +SK+K + KM ++GL ++V  DK   FSFP CGE+ PP++   NV+F Y  +   ++Y N+D  IDLD+R+ALVGPNGAGKSTLLKL+  ++ PT G I++HSH ++ RYHQH  E+LDL ++P+D++   F ++ K+ +E R+++GR+G+TG  Q   I  +SDG + R+IF  +A   PH+LLLDEPTNHLD+E IDSLA AIN F GG++LVSHDFRLI +VA EIWVC++ T+TKW GDI SYK  L
Sbjct:   39 TATGALASKESSRDVKIEQVTLTFHGKELLSDTTVEINFGRRYGLIGQNGCGKSTFFQCLAVRELPIPEHIDIFHLSEEAHPSERTALQSVIDDAEKEVKRLEVLEERLLEEQGPESEELFDVYERLENLDPTTFVPRASEILIGLGFTSQTMLKKTKDLSGGWRMRVSLAKALFIKPTLLLLDEPTNHLDLGACVWLEDYLANYDRSLIIISHSQDFLNAVCTNIIHMTQSKLKYYGGNYDNFVKTKAELEVNQMKAYHKQQEEIAHIKSFIASCGTYSN-LVRQGKSKQKIIDKMEEAGLVERVQEDKIFNFSFPPCGELAPPIMHFDNVTFSYSGKEADVLYRNLDLAIDLDSRIALVGPNGAGKSTLLKLMVGQISPTQGFIKKHSHLKMARYHQHAHEVLDLTATPLDFVRSKFAHMNKDTEEWRREIGRFGVTGKAQTEAIGCMSDGIKSRLIFCLMALENPHLLLLDEPTNHLDMECIDSLALAINSFPGGMILVSHDFRLISQVAKEIWVCDNKTITKWAGDITSYKNHL 575          
BLAST of ATP-binding cassette sub-family F member 2 vs. TrEMBL
Match: A0A267EW45 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024741g1 PE=4 SV=1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 416/583 (71.36%), Postives = 497/583 (85.25%), Query Frame = 2
Query:  197 DDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            D++FMGS+D+  S +A   +EIE+LNL S++V  +R+ T VL+SH ++RD+   N+ ITFHGQE+L DT LELN GRRYG IG NGCGKS+L A LAN EL +  H+D +LLQREMPPSDKTA+Q VME DEE++RLE EAE LAL +D ES DRL+++Y+RL++LDA++A  RAAE+L GLGFT +MQ K+VKHFSGGWRMRISLAR LFVKP LLMLDEPTNHLDLNACVWLE+EL QY RIL+IISHS+DFLNGVCTNIIHM+HK+L+YY GN+DQY++T+ME EENQMK++KWEQ Q+++M++YIARFGHGS KLARQAQSKEKTL KMVD GLT +V+ DK + F FP CGEIPPPVI IQNVSF+Y   KP IY ++DFG+DLDTRVALVGPNGAGKSTLLKLIA EL+PTDGLIRRHSH RIGRYHQHL E+LD++ + +DWMM+ FP I ERDEMRK LGRYGLTGAQQ+CPI++LSDGQRCRIIFAWLA   PHMLLLDEPTNHLD+ETID+LA+AI EF+GGLLLVSHDFRLI +VA+EIW CN+  VTKW+GDI+SYK  L KEI + +  R
Sbjct:   82 DEDFMGSDDDMPSALA---SEIETLNLLSDRVVAHRACTSVLASHPDARDIQLINLSITFHGQELLQDTKLELNCGRRYGLIGLNGCGKSTLLAALANRELQIQPHVDIFLLQREMPPSDKTAIQCVMEVDEERVRLETEAEALALHEDQESHDRLMDIYDRLEELDADKAATRAAELLHGLGFTAEMQNKQVKHFSGGWRMRISLARALFVKPDLLMLDEPTNHLDLNACVWLEEELKQYKRILVIISHSQDFLNGVCTNIIHMRHKRLIYYGGNFDQYMQTRMEMEENQMKRFKWEQGQISNMRNYIARFGHGSAKLARQAQSKEKTLAKMVDKGLTDRVAHDKTVTFYFPDCGEIPPPVIMIQNVSFQYAPGKPFIYKDLDFGVDLDTRVALVGPNGAGKSTLLKLIAGELQPTDGLIRRHSHVRIGRYHQHLHEMLDISLTSLDWMMRQFPEITERDEMRKILGRYGLTGAQQVCPIRTLSDGQRCRIIFAWLANKSPHMLLLDEPTNHLDIETIDALAEAICEFQGGLLLVSHDFRLIQQVAEEIWECNNCKVTKWEGDIFSYKEELTKEITKANDAR 661          
BLAST of ATP-binding cassette sub-family F member 2 vs. TrEMBL
Match: A0A267FTW6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024741g3 PE=4 SV=1)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 416/583 (71.36%), Postives = 497/583 (85.25%), Query Frame = 2
Query:  197 DDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            D++FMGS+D+  S +A   +EIE+LNL S++V  +R+ T VL+SH ++RD+   N+ ITFHGQE+L DT LELN GRRYG IG NGCGKS+L A LAN EL +  H+D +LLQREMPPSDKTA+Q VME DEE++RLE EAE LAL +D ES DRL+++Y+RL++LDA++A  RAAE+L GLGFT +MQ K+VKHFSGGWRMRISLAR LFVKP LLMLDEPTNHLDLNACVWLE+EL QY RIL+IISHS+DFLNGVCTNIIHM+HK+L+YY GN+DQY++T+ME EENQMK++KWEQ Q+++M++YIARFGHGS KLARQAQSKEKTL KMVD GLT +V+ DK + F FP CGEIPPPVI IQNVSF+Y   KP IY ++DFG+DLDTRVALVGPNGAGKSTLLKLIA EL+PTDGLIRRHSH RIGRYHQHL E+LD++ + +DWMM+ FP I ERDEMRK LGRYGLTGAQQ+CPI++LSDGQRCRIIFAWLA   PHMLLLDEPTNHLD+ETID+LA+AI EF+GGLLLVSHDFRLI +VA+EIW CN+  VTKW+GDI+SYK  L KEI + +  R
Sbjct:   78 DEDFMGSDDDMPSALA---SEIETLNLLSDRVVAHRACTSVLASHPDARDIQLINLSITFHGQELLQDTKLELNCGRRYGLIGLNGCGKSTLLAALANRELQIQPHVDIFLLQREMPPSDKTAIQCVMEVDEERVRLETEAEALALHEDQESHDRLMDIYDRLEELDADKAATRAAELLHGLGFTAEMQNKQVKHFSGGWRMRISLARALFVKPDLLMLDEPTNHLDLNACVWLEEELKQYKRILVIISHSQDFLNGVCTNIIHMRHKRLIYYGGNFDQYMQTRMEMEENQMKRFKWEQGQISNMRNYIARFGHGSAKLARQAQSKEKTLAKMVDKGLTDRVAHDKTVTFYFPDCGEIPPPVIMIQNVSFQYAPGKPFIYKDLDFGVDLDTRVALVGPNGAGKSTLLKLIAGELQPTDGLIRRHSHVRIGRYHQHLHEMLDISLTSLDWMMRQFPEITERDEMRKILGRYGLTGAQQVCPIRTLSDGQRCRIIFAWLANKSPHMLLLDEPTNHLDIETIDALAEAICEFQGGLLLVSHDFRLIQQVAEEIWECNNCKVTKWEGDIFSYKEELTKEITKANDAR 657          
BLAST of ATP-binding cassette sub-family F member 2 vs. TrEMBL
Match: A0A267DII7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024741g2 PE=4 SV=1)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 416/583 (71.36%), Postives = 497/583 (85.25%), Query Frame = 2
Query:  197 DDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            D++FMGS+D+  S +A   +EIE+LNL S++V  +R+ T VL+SH ++RD+   N+ ITFHGQE+L DT LELN GRRYG IG NGCGKS+L A LAN EL +  H+D +LLQREMPPSDKTA+Q VME DEE++RLE EAE LAL +D ES DRL+++Y+RL++LDA++A  RAAE+L GLGFT +MQ K+VKHFSGGWRMRISLAR LFVKP LLMLDEPTNHLDLNACVWLE+EL QY RIL+IISHS+DFLNGVCTNIIHM+HK+L+YY GN+DQY++T+ME EENQMK++KWEQ Q+++M++YIARFGHGS KLARQAQSKEKTL KMVD GLT +V+ DK + F FP CGEIPPPVI IQNVSF+Y   KP IY ++DFG+DLDTRVALVGPNGAGKSTLLKLIA EL+PTDGLIRRHSH RIGRYHQHL E+LD++ + +DWMM+ FP I ERDEMRK LGRYGLTGAQQ+CPI++LSDGQRCRIIFAWLA   PHMLLLDEPTNHLD+ETID+LA+AI EF+GGLLLVSHDFRLI +VA+EIW CN+  VTKW+GDI+SYK  L KEI + +  R
Sbjct:   83 DEDFMGSDDDMPSALA---SEIETLNLLSDRVVAHRACTSVLASHPDARDIQLINLSITFHGQELLQDTKLELNCGRRYGLIGLNGCGKSTLLAALANRELQIQPHVDIFLLQREMPPSDKTAIQCVMEVDEERVRLETEAEALALHEDQESHDRLMDIYDRLEELDADKAATRAAELLHGLGFTAEMQNKQVKHFSGGWRMRISLARALFVKPDLLMLDEPTNHLDLNACVWLEEELKQYKRILVIISHSQDFLNGVCTNIIHMRHKRLIYYGGNFDQYMQTRMEMEENQMKRFKWEQGQISNMRNYIARFGHGSAKLARQAQSKEKTLAKMVDKGLTDRVAHDKTVTFYFPDCGEIPPPVIMIQNVSFQYAPGKPFIYKDLDFGVDLDTRVALVGPNGAGKSTLLKLIAGELQPTDGLIRRHSHVRIGRYHQHLHEMLDISLTSLDWMMRQFPEITERDEMRKILGRYGLTGAQQVCPIRTLSDGQRCRIIFAWLANKSPHMLLLDEPTNHLDIETIDALAEAICEFQGGLLLVSHDFRLIQQVAEEIWECNNCKVTKWEGDIFSYKEELTKEITKANDAR 662          
BLAST of ATP-binding cassette sub-family F member 2 vs. TrEMBL
Match: A0A1I8J326 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 416/583 (71.36%), Postives = 497/583 (85.25%), Query Frame = 2
Query:  197 DDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            D++FMGS+D+  S +A   +EIE+LNL S++V  +R+ T VL+SH ++RD+   N+ ITFHGQE+L DT LELN GRRYG IG NGCGKS+L A LAN EL +  H+D +LLQREMPPSDKTA+Q VME DEE++RLE EAE LAL +D ES DRL+++Y+RL++LDA++A  RAAE+L GLGFT +MQ K+VKHFSGGWRMRISLAR LFVKP LLMLDEPTNHLDLNACVWLE+EL QY RIL+IISHS+DFLNGVCTNIIHM+HK+L+YY GN+DQY++T+ME EENQMK++KWEQ Q+++M++YIARFGHGS KLARQAQSKEKTL KMVD GLT +V+ DK + F FP CGEIPPPVI IQNVSF+Y   KP IY ++DFG+DLDTRVALVGPNGAGKSTLLKLIA EL+PTDGLIRRHSH RIGRYHQHL E+LD++ + +DWMM+ FP I ERDEMRK LGRYGLTGAQQ+CPI++LSDGQRCRIIFAWLA   PHMLLLDEPTNHLD+ETID+LA+AI EF+GGLLLVSHDFRLI +VA+EIW CN+  VTKW+GDI+SYK  L KEI + +  R
Sbjct:   74 DEDFMGSDDDMPSALA---SEIETLNLLSDRVVAHRACTSVLASHPDARDIQLINLSITFHGQELLQDTKLELNCGRRYGLIGLNGCGKSTLLAALANRELQIQPHVDIFLLQREMPPSDKTAIQCVMEVDEERVRLETEAEALALHEDQESHDRLMDIYDRLEELDADKAATRAAELLHGLGFTAEMQNKQVKHFSGGWRMRISLARALFVKPDLLMLDEPTNHLDLNACVWLEEELKQYKRILVIISHSQDFLNGVCTNIIHMRHKRLIYYGGNFDQYMQTRMEMEENQMKRFKWEQGQISNMRNYIARFGHGSAKLARQAQSKEKTLAKMVDKGLTDRVAHDKTVTFYFPDCGEIPPPVIMIQNVSFQYAPGKPFIYKDLDFGVDLDTRVALVGPNGAGKSTLLKLIAGELQPTDGLIRRHSHVRIGRYHQHLHEMLDISLTSLDWMMRQFPEITERDEMRKILGRYGLTGAQQVCPIRTLSDGQRCRIIFAWLANKSPHMLLLDEPTNHLDIETIDALAEAICEFQGGLLLVSHDFRLIQQVAEEIWECNNCKVTKWEGDIFSYKEELTKEITKANDAR 653          
BLAST of ATP-binding cassette sub-family F member 2 vs. TrEMBL
Match: A0A1I8FV71 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 416/583 (71.36%), Postives = 497/583 (85.25%), Query Frame = 2
Query:  197 DDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            D++FMGS+D+  S +A   +EIE+LNL S++V  +R+ T VL+SH ++RD+   N+ ITFHGQE+L DT LELN GRRYG IG NGCGKS+L A LAN EL +  H+D +LLQREMPPSDKTA+Q VME DEE++RLE EAE LAL +D ES DRL+++Y+RL++LDA++A  RAAE+L GLGFT +MQ K+VKHFSGGWRMRISLAR LFVKP LLMLDEPTNHLDLNACVWLE+EL QY RIL+IISHS+DFLNGVCTNIIHM+HK+L+YY GN+DQY++T+ME EENQMK++KWEQ Q+++M++YIARFGHGS KLARQAQSKEKTL KMVD GLT +V+ DK + F FP CGEIPPPVI IQNVSF+Y   KP IY ++DFG+DLDTRVALVGPNGAGKSTLLKLIA EL+PTDGLIRRHSH RIGRYHQHL E+LD++ + +DWMM+ FP I ERDEMRK LGRYGLTGAQQ+CPI++LSDGQRCRIIFAWLA   PHMLLLDEPTNHLD+ETID+LA+AI EF+GGLLLVSHDFRLI +VA+EIW CN+  VTKW+GDI+SYK  L KEI + +  R
Sbjct:   74 DEDFMGSDDDMPSALA---SEIETLNLLSDRVVAHRACTSVLASHPDARDIQLINLSITFHGQELLQDTKLELNCGRRYGLIGLNGCGKSTLLAALANRELQIQPHVDIFLLQREMPPSDKTAIQCVMEVDEERVRLETEAEALALHEDQESHDRLMDIYDRLEELDADKAATRAAELLHGLGFTAEMQNKQVKHFSGGWRMRISLARALFVKPDLLMLDEPTNHLDLNACVWLEEELKQYKRILVIISHSQDFLNGVCTNIIHMRHKRLIYYGGNFDQYMQTRMEMEENQMKRFKWEQGQISNMRNYIARFGHGSAKLARQAQSKEKTLAKMVDKGLTDRVAHDKTVTFYFPDCGEIPPPVIMIQNVSFQYAPGKPFIYKDLDFGVDLDTRVALVGPNGAGKSTLLKLIAGELQPTDGLIRRHSHVRIGRYHQHLHEMLDISLTSLDWMMRQFPEITERDEMRKILGRYGLTGAQQVCPIRTLSDGQRCRIIFAWLANKSPHMLLLDEPTNHLDIETIDALAEAICEFQGGLLLVSHDFRLIQQVAEEIWECNNCKVTKWEGDIFSYKEELTKEITKANDAR 653          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Cavefish
Match: abcf2b (ATP-binding cassette sub-family F member 2 [Source:NCBI gene;Acc:103022164])

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 373/573 (65.10%), Postives = 473/573 (82.55%), Query Frame = 2
Query:  215 SEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            S  E + ++  L  E++   L   +  + R+VTGVL+SH  S DVH S++ +TFHGQE+L DT+LELN+GRRYG IG NG GKS L + + + E+P+P HID Y L REM PS+KTAL+ VME D+E++ LEKEAE LA  +D+E + +L+E+YERL++LDA++A+ RA+ IL+GLGFT  MQ+K++K FSGGWRMR+SLAR LF+KP +L+LDEPTNHLDL+ACVWLE+EL  + RIL++ISHS+DFLNG+CTNIIH+  +KL YY GNYDQY++T++E EENQMK+Y WEQDQ++HMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT +V  DK L F FP CG+IPPPVI +QNVSFRY E+ P IY N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHLTE L+L+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LADAIN+FEGG++LVSHDFRLI +VA EIWVC   T+TKW+GDI +YK  L  +I+++
Sbjct:   43 SNGEANGEVTALTKELDEFEL---RKMEARAVTGVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSEKTALECVMEVDKERIELEKEAERLA-HEDSECE-KLMEIYERLEELDADKAQVRASRILYGLGFTPAMQRKKLKDFSGGWRMRVSLARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGICTNIIHLHQRKLKYYTGNYDQYVKTRLEVEENQMKRYNWEQDQISHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTSRVVSDKTLSFYFPPCGKIPPPVIMVQNVSFRYSEDTPCIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINDFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWNGDILAYKEHLKSKIDKQ 610          

HSP 2 Score: 62.3882 bits (150), Expect = 1.017e-9
Identity = 66/264 (25.00%), Postives = 113/264 (42.80%), Query Frame = 2
Query: 1235 GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIA----------------SELEPTDGLIRRHSHCRIGRYHQHL-----TEILDLNSSPMDWMMKSFPNIKERD----EMRKKLGRYGL--TGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            G++ S P+  ++      I ++S  +H  + L   +    ++   R  L+G NG GKS LL  I                  E+ P++   +    C +    + +      E L    S  + +M+ +  ++E D    ++R     YGL  T A Q   +K  S G R R+  A      P MLLLDEPTNHLDL+    L + +  F+  L+L+SH    +  +   I   +   +  + G+   Y  + + E+E+   +R
Sbjct:   73 GVLASHPNSTDV-----HISSLSLTFHGQELL--SDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSE---KTALECVMEVDKERIELEKEAERLAHEDSECEKLMEIYERLEELDADKAQVRASRILYGLGFTPAMQRKKLKDFSGGWRMRVSLARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGICTNIIHLHQRKLKYYTGNYDQYVKTRL-EVEENQMKR 325          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Cavefish
Match: abcf2a (ATP-binding cassette sub-family F member 2 [Source:NCBI gene;Acc:103039473])

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 372/568 (65.49%), Postives = 469/568 (82.57%), Query Frame = 2
Query:  227 EDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQ 1930
            E + +A +  E++   L   K ++ R+VTGVL+SH  S DVH S++ +TFHGQE+L DT+LELN+GRRYG IG NG GKS L + +   E+P+P HID Y L REMPPS+KTALQ VME D+E+++LEKE E LA  +D+E + +L+++YERL++LDA +AE RA+ IL GLGFT  MQ+K++K FSGGWRMR++LAR LF+KP +L+LDEPTNHLDL+ACVWLE+EL Q+ RIL++ISHS+DFLNGVCTNII++  +KL YY GNYDQY++T+ E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT++V  DK L F FP CG+IPPPVI +QNVSFRY +  P+IY +++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHLTE L+L+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LA+AINEFEGGL+LVSHDFRLI +VA EIWVC   T+TKW  DI +YK  L  +I++
Sbjct:   45 EVNGVASITKELDEFEL---KKTEARAVTGVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGYREVPIPEHIDIYHLTREMPPSEKTALQCVMEVDDERIQLEKEVERLA-HEDSECE-KLMDLYERLEELDAAKAEVRASRILHGLGFTAAMQKKKLKDFSGGWRMRVALARALFLKPFMLLLDEPTNHLDLDACVWLEEELKQFKRILVLISHSQDFLNGVCTNIINLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTERVVNDKTLSFYFPPCGKIPPPVIMVQNVSFRYSDETPIIYKSLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALAEAINEFEGGLMLVSHDFRLIQQVAQEIWVCEKQTITKWKKDILAYKEHLKSKIDK 607          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Cavefish
Match: abcf3 (ATP binding cassette subfamily F member 3 [Source:NCBI gene;Acc:103024060])

HSP 1 Score: 417.542 bits (1072), Expect = 1.506e-136
Identity = 225/549 (40.98%), Postives = 339/549 (61.75%), Query Frame = 2
Query:  320 LSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYL------ALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            +S    S D+   N  ++F  + +L    L L +GRRYG +G NG GK++L  +LA+  L VP+HI    +++E+   D  ALQ+V+E+D  +  L  E   L         D +ES  RL E+Y RL++++A++A  RA+ IL GLGF+  MQQ+  K FSGGWRMR++LAR LF KP LL+LDEPTN LD+ A +WLE  L  +   ++++SH  +FLN V T+IIH+  ++L  Y G+Y+ +I+TK +  +NQ ++Y+ +     H++ +I RF + + + A Q QSK K L+K+      + + ++  +V  FP   E + PP++Q+  V F Y  +  L +  +    DL++R+ +VG NGAGKSTLLKL+  +L P  G    H + +IG + QH  + LDLN   ++ ++  FP + E +E R++LGRYG++G     P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++LA ++N F+GG++LVSHD RLI  V  E+WVC  G V + DG    Y     K+I QE  RR
Sbjct:  171 MSGKNRSYDIRIENFDVSFGERSLLQGAELCLASGRRYGLVGRNGLGKTTLLKMLASRSLRVPAHISILHVEQEVAGDDTPALQSVLESDTVREELLTEERKLNAHIANGTADGSESV-RLSEIYARLEEIEADKAPARASVILAGLGFSPKMQQQTTKEFSGGWRMRLALARALFAKPDLLLLDEPTNMLDVRAILWLENYLQTWQSTILVVSHDRNFLNAVATDIIHLHTQRLDSYRGDYENFIKTKEDRLKNQQREYEAQLQYREHIQVFIDRFRYNANRAA-QVQSKLKLLEKLP---ELKPIDKESVVVLCFPDNFEKLSPPILQLDEVEFSYSPDIHL-FTGLCVSADLESRICIVGENGAGKSTLLKLLMGDLTPISGTRHAHRNLKIGYFSQHHVDQLDLNVCSVELLLSKFPGLTE-EEYRRQLGRYGISGELATRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALAKSLNTFKGGVVLVSHDERLIRLVCKELWVCEAGRVHRIDGGFDEY-----KDILQEQFRR 707          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Cavefish
Match: abcf1 (ATP binding cassette subfamily F member 1 [Source:NCBI gene;Acc:103030134])

HSP 1 Score: 372.089 bits (954), Expect = 5.357e-117
Identity = 211/544 (38.79%), Postives = 336/544 (61.76%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRL---EKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQ------------KVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
            + D+      I+ HG+E+ ++  L +  GRRYG +GPNG GK++L   ++N  L +P +ID  L ++E+   D  A+QAV++AD  +++L   EK+ +    + +    +RL +VYE L  + A  AE +A  IL GL FT +MQ +  K FSGGWRMR+SLAR LF++P LLMLDEPTNHLDLNA +WL   L  + + L+I+SH + FL+ VCT+IIH+ ++KL YY GNY  + +  ++ ++  +K+Y+ ++ ++  +K      G  S K A + Q+KE   +K                    K  ++  + F+FP+   + PP++ + +V F Y   KPL + N+DFGID+++R+ +VGPNG GKSTLL L+  +L PT G +R++   ++G ++Q   + L +  +P +++ ++F N+  +D  RK LGR+GL        I  LS GQ+ R++FA L+   P +L+LDEPTN+LD+E+ID+L++AINE++G +++VSHD RLI      +WV    TV + DGD   YK  +++ +
Sbjct:  360 ASDIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHISNRALSIPPNIDVLLCEQEVIADDTPAVQAVLKADTRRLKLLEEEKQLQNRLEKGEDGVSERLEKVYEELRAIGAAAAEAKARRILAGLSFTPEMQNRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWKKTLLIVSHDQSFLDDVCTDIIHLDNQKLYYYRGNYLTFKKMYVQKQKELLKQYEKQEKKLKDLK-----AGGKSTKQAEK-QTKEALTRKQQKGKKKGQEEESHEAPELLKRPKEYTVKFTFPNPPPLSPPILGLHSVDFGYEGQKPL-FKNVDFGIDMESRICIVGPNGVGKSTLLLLLTGKLTPTKGEMRKNHRLKVGFFNQQYADQLIMEEAPTEYLQRNF-NLPYQDS-RKCLGRFGLESHAHTIQISKLSGGQKARVVFAELSCRQPDVLILDEPTNNLDIESIDALSEAINEYKGAVIIVSHDARLITETQCHLWVVEDQTVNQIDGDFEDYKREVLEAL 894          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Cavefish
Match: abcf3 (ATP binding cassette subfamily F member 3 [Source:NCBI gene;Acc:103024060])

HSP 1 Score: 315.079 bits (806), Expect = 5.830e-98
Identity = 191/549 (34.79%), Postives = 297/549 (54.10%), Query Frame = 2
Query:  320 LSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYL------ALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARR 1945
            +S    S D+   N  ++F  + +L    L L +GRRYG +G NG GK++L  +LA+  L VP+HI    +++E+   D  ALQ+V+E+D  +  L  E   L         D +ES  RL E+Y RL++++A++A  R                                       P LL+LDEPTN LD+ A +WLE  L  +   ++++SH  +FLN V T+IIH+  ++L  Y G+Y+ +I+TK +  +NQ ++Y+ +     H++ +I RF + + + A Q QSK K L+K+ +    + + ++  +V  FP   E + PP++Q+  V F Y  +  L +  +    DL++R+ +VG NGAGKSTLLKL+  +L P  G    H + +IG + QH  + LDLN   ++ ++  FP + E +E R++LGRYG++G     P+ SLS GQ+ R+ FA +   CP+  +LDEPTNHLD+ETI++L   +N  E           LI  V  E+WVC  G V + DG    Y     K+I QE  RR
Sbjct:  158 MSGKNRSYDIRIENFDVSFGERSLLQGAELCLASGRRYGLVGRNGLGKTTLLKMLASRSLRVPAHISILHVEQEVAGDDTPALQSVLESDTVREELLTEERKLNAHIANGTADGSESV-RLSEIYARLEEIEADKAPAR---------------------------------------PDLLLLDEPTNMLDVRAILWLENYLQTWQSTILVVSHDRNFLNAVATDIIHLHTQRLDSYRGDYENFIKTKEDRLKNQQREYEAQLQYREHIQVFIDRFRYNANRAA-QVQSKLKLLEKLPE---LKPIDKESVVVLCFPDNFEKLSPPILQLDEVEFSYSPDIHL-FTGLCVSADLESRICIVGENGAGKSTLLKLLMGDLTPISGTRHAHRNLKIGYFSQHHVDQLDLNVCSVELLLSKFPGLTE-EEYRRQLGRYGISGELATRPVASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALRGLLNTME-----------LIRLVCKELWVCEAGRVHRIDGGFDEY-----KDILQEQFRR 644          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Sea Lamprey
Match: abcf2a (ATP-binding cassette, sub-family F (GCN20), member 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8714])

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 371/571 (64.97%), Postives = 469/571 (82.14%), Query Frame = 2
Query:  212 GSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
             ++ E    +AE ++E+E       K ++ R+ TGVL+SH  S DVH  N+ +TFHGQE+L DT LELN+GRRYG IG NG GKS L + +   ELP+P HID Y L REM PSDKTALQ VME D E++ LEKEAE LA  +D+ES+ +L+E+YERL++LDA +AE RAA IL GLGF+  MQ+K++K FSGGWRMR++L+R LF++P +L+LDEPTNHLDL+ACVWLE+EL  + RILI+ISHS+DFLNGVCTNIIH+ ++KL  + GNYDQY++T++E E++QMKK+ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT+++  DK L F FP+CG+IPPPVI +Q+VSF+Y E+ PLIY  ++FGIDLD+RVALVGPNGAGKSTLLKL+A EL PTDG+IR+HSH +IGRYHQHLTE LDL+ SP+D+MMK +P++KE+++MRK +GRYGLTG QQ+ PI+SLSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LA+AINEFEGG++LVSHDFRLI +VA EIWVC H T+TKW G I +YK  L  ++
Sbjct:   39 AADGESVVALAEQLDEMEL------KKAEARACTGVLASHPNSMDVHIINMSLTFHGQELLSDTQLELNSGRRYGLIGLNGTGKSMLLSTIGTRELPIPEHIDIYHLTREMAPSDKTALQCVMEVDTERIVLEKEAERLA-HEDSESE-KLMEIYERLEELDASKAEMRAARILHGLGFSPAMQRKKMKDFSGGWRMRVALSRALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILIVISHSQDFLNGVCTNIIHLHNRKLKVFTGNYDQYVKTRLELEDHQMKKFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTERIVNDKTLSFFFPACGKIPPPVIMVQHVSFKYTEDGPLIYKALEFGIDLDSRVALVGPNGAGKSTLLKLLAGELLPTDGMIRKHSHVKIGRYHQHLTEQLDLDLSPLDYMMKCYPDVKEKEDMRKIIGRYGLTGKQQVSPIRSLSDGQKCRVCFAWLAWQTPHMLFLDEPTNHLDMETIDALAEAINEFEGGMMLVSHDFRLIQQVAQEIWVCEHATITKWKGGIQAYKEHLKNKV 601          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007174.1 (pep scaffold:Pmarinus_7.0:GL490431:841:5388:1 gene:ENSPMAG00000006481.1 transcript:ENSPMAT00000007174.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 3.273e-47
Identity = 89/198 (44.95%), Postives = 125/198 (63.13%), Query Frame = 2
Query:  539 EMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQD-----RLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEK-ELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMK 1114
            E+      A+QAV+ AD  +  L +E     LQ   ES D     RL +V E L  + A+ AE +A  IL GLGFT +MQ +  K FSGGWRMR+SLAR LF++P LLMLDEPTNHLDLNA +WL K  L  + + L+I+SH + FL+ VCT+IIH+ ++KL YY GNY  + +  ++ ++   K Y  ++ ++  +K
Sbjct:    1 EVVADSTPAVQAVLRADVRRGVLLQEES--KLQARLESGDDSVGPRLEKVIEELRAMGADAAEAKARRILAGLGFTPEMQGRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNKYYLLTWRKTLLIVSHDQSFLDDVCTDIIHLDYQKLFYYRGNYLTFKKMYVQKQKELQKLYDKQERRLKELK 196          

HSP 2 Score: 53.9138 bits (128), Expect = 1.937e-8
Identity = 35/113 (30.97%), Postives = 55/113 (48.67%), Query Frame = 2
Query: 1586 RKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLAD-AINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKE 1921
            R+ L   G T   Q  P K  S G R R+  A      P +L+LDEPTNHLDL  +  L    +  +   LL+VSHD   +  V  +I   ++  +  + G+  ++K   +++
Sbjct:   65 RRILAGLGFTPEMQGRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNKYYLLTWRKTLLIVSHDQSFLDDVCTDIIHLDYQKLFYYRGNYLTFKKMYVQK 177          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007172.1 (pep scaffold:Pmarinus_7.0:GL490431:841:5397:1 gene:ENSPMAG00000006481.1 transcript:ENSPMAT00000007172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.696 bits (413), Expect = 6.321e-47
Identity = 88/198 (44.44%), Postives = 125/198 (63.13%), Query Frame = 2
Query:  539 EMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQD-----RLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEK-ELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMK 1114
            E+      A+QAV+ AD  +  L +E     LQ   ES D     RL +V E L  + A+ AE +A  IL GLGFT +MQ +  K FSGGWRMR+SLAR LF++P LLMLDEPTNHLDLNA +WL K  +  + + L+I+SH + FL+ VCT+IIH+ ++KL YY GNY  + +  ++ ++   K Y  ++ ++  +K
Sbjct:    1 EVVADSTPAVQAVLRADVRRGVLLQEES--KLQARLESGDDSVGPRLEKVIEELRAMGADAAEAKARRILAGLGFTPEMQGRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNKFFMLTWRKTLLIVSHDQSFLDDVCTDIIHLDYQKLFYYRGNYLTFKKMYVQKQKELQKLYDKQERRLKELK 196          

HSP 2 Score: 53.9138 bits (128), Expect = 1.909e-8
Identity = 37/117 (31.62%), Postives = 56/117 (47.86%), Query Frame = 2
Query: 1586 RKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEF-----EGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKE 1921
            R+ L   G T   Q  P K  S G R R+  A      P +L+LDEPTNHLDL  +  L    N+F        LL+VSHD   +  V  +I   ++  +  + G+  ++K   +++
Sbjct:   65 RRILAGLGFTPEMQGRPTKKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWL----NKFFMLTWRKTLLIVSHDQSFLDDVCTDIIHLDYQKLFYYRGNYLTFKKMYVQK 177          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005077.1 (pep scaffold:Pmarinus_7.0:GL479589:38272:41290:-1 gene:ENSPMAG00000004621.1 transcript:ENSPMAT00000005077.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 6.414e-24
Identity = 48/95 (50.53%), Postives = 64/95 (67.37%), Query Frame = 2
Query: 1634 PIKSLSDGQRCRIIFAWLAETCP--HMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL 1912
            P+ SLS GQ+ R+ FA +   CP  +  +LDEPTNHLD+ETI++L  A+N+F+GG++LVSHD RLI  V  E+WVC    V + DG    YK  L
Sbjct:    3 PVASLSGGQKSRVAFAQMT-ICPSPNFYILDEPTNHLDMETIEALGCALNKFKGGVILVSHDERLIRTVCRELWVCEERGVRRVDGGFDEYKHVL 96          

HSP 2 Score: 54.6842 bits (130), Expect = 1.227e-9
Identity = 27/91 (29.67%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  767 KEVKHFSGGWRMRISLARCLFV-KPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQY 1036
            + V   SGG + R++ A+      P   +LDEPTNHLD+     L   L+++   +I++SH E  +  VC  +   + + +   +G +D+Y
Sbjct:    2 RPVASLSGGQKSRVAFAQMTICPSPNFYILDEPTNHLDMETIEALGCALNKFKGGVILVSHDERLIRTVCRELWVCEERGVRRVDGGFDEY 92          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009626.1 (pep scaffold:Pmarinus_7.0:GL487706:825:5638:1 gene:ENSPMAG00000008701.1 transcript:ENSPMAT00000009626.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 1.601e-23
Identity = 53/158 (33.54%), Postives = 90/158 (56.96%), Query Frame = 2
Query: 1451 GLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
            G  R++   +IG ++Q   + L +  +  +++ + F N+  + E RK+LGR+GL        I  LS G       A L      + + DEPTN+LD+E+ID+L +AIN+++GG+++VSHD RLI     ++WV    TV + +GD   YK  +++ +
Sbjct:    2 GERRKNHRLKIGFFNQQYADQLAMEETATEYLQRCF-NLPYQ-EARKRLGRFGLESHAHTIQINKLSAGVEWHRHSAGLTIRRLQVHIQDEPTNNLDIESIDALGEAINQYKGGVVIVSHDARLITETNCQLWVVEESTVNQVEGDFEDYKREVLESL 157          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Yeast
Match: ARB1 (ATPase of the ATP-binding cassette (ABC) family; involved in 40S and 60S ribosome biogenesis, has similarity to Gcn20p; shuttles from nucleus to cytoplasm, physically interacts with Tif6p, Lsg1p; human homolog ABCF2 can complement yeast ARB1 mutant [Source:SGD;Acc:S000000838])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 280/570 (49.12%), Postives = 382/570 (67.02%), Query Frame = 2
Query:  227 EDSKMAELINEIESLNLCSEKVS-QYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQ-AVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPL-IYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEM-RKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
            E+S++     EI+ + L  +K     R VTGVLSS   SRD+  S+V + FHG+ ++ D+ LELN GRRYG +G NGCGKS+    LA  E P+P HID YLL     PS+ +AL   V EA  E  R+E   E   L+D  ES+  L  +YER+D LD +  E RAA IL GLGF K    K+ K  SGGW+MR++LA+ LFVKP LL+LD+PT HLDL ACVWLE+ L ++ R L+++SHS+DFLNGVCTN+I M+ +KL  Y GNYD Y +T+ E E NQMK+Y  +Q+++ H+K +IA  G  +  L +QA+S++K L KM   GL Q V  DK   F FP    +PPPV+   ++SF Y  N    +Y++++FG+D+D+R+ALVGPNG GKSTLLK++  EL P  G + RH+H ++G Y QH  + LDL  S ++++   + NI +  +  R +LGRYGLTG  Q   + +LS+GQR R++FA LA   P++LLLDEPTN LD+ TIDSLADAINEF GG+++VSHDFRL+ ++A +I+V  + T T+WDG I  YK  L K +
Sbjct:   41 EESEVDAAAREIKMMKLQQDKDGLSDRVVTGVLSSLETSRDIKLSSVSLLFHGKVLIQDSGLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHELKRIEDLVEKTILEDGPESE-LLEPLYERMDSLDPDTFESRAAIILIGLGFNKKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLVSHSQDFLNGVCTNMIDMRAQKLTAYGGNYDSYHKTRSELETNQMKQYNKQQEEIQHIKKFIASAGTYA-NLVKQAKSRQKILDKMEADGLVQPVVPDKVFSFRFPQVERLPPPVLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVVENKTATRWDGSILQYKNKLAKNV 608          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Yeast
Match: GCN20 (Positive regulator of the Gcn2p kinase activity; forms a complex with Gcn1p; proposed to stimulate Gcn2p activation by an uncharged tRNA [Source:SGD;Acc:S000001905])

HSP 1 Score: 419.468 bits (1077), Expect = 1.261e-137
Identity = 219/557 (39.32%), Postives = 345/557 (61.94%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITF-HGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEAD--------EEK-----------MRLEKEAEYLALQD-DTESQD---RLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNG-NYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIK 1918
            SS  +S+D+H     +    GQ IL +  L L+ G RYG +G NG GKS+L   L+  EL VP H+    +++E+   D  ALQ+V++AD        EE            +R E E + L ++  D E +D    L+++ ++L D+++++AE RAA IL+GLGF+ + QQ+    FSGGWRMR+SLAR LF +P LL+LDEP+N LD+ +  +L + L  Y   ++ +SH   FLN V T+II+  +++L YY G ++D +  TK E  +N  ++Y  +     H++++I ++ + + K +++AQS+ K L+K+    + +   +DK + F FP C ++ PP+IQ+Q+VSF Y EN  L+ D ++  + +D+R+ALVG NG GK+TLLK++  +L P  G + R+   RIG + QH  + +DL +S +DWM KSFP  K  +E R+ LG +G+TG   +  ++ LS GQ+ R+ FA L    PH+L+LDEP+NHLD   +D+L +A+  F GG+L+VSHD  +I  V  EIWV   GTV +++G IY Y+  +++
Sbjct:  191 SSAGKSKDIHIDTFDLYVGDGQRILSNAQLTLSFGHRYGLVGQNGIGKSTLLRALSRRELNVPKHVSILHVEQELRGDDTKALQSVLDADVWRKQLLSEEAKINERLKEMDVLRQEFEEDSLEVKKLDNEREDLDNHLIQISDKLVDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTYPNTVLTVSHDRAFLNEVATDIIYQHNERLDYYRGQDFDTFYTTKEERRKNAQREYDNQMVYRKHLQEFIDKYRYNAAK-SQEAQSRIKKLEKL---PVLEPPEQDKTIDFKFPECDKLSPPIIQLQDVSFGYDENNLLLKD-VNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLRIGYFTQHHVDSMDLTTSAVDWMSKSFPG-KTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVEALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTIYDYRDYILQ 741          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Yeast
Match: NEW1 (ATP binding cassette protein; cosediments with polysomes and is required for biogenesis of the small ribosomal subunit; Asn/Gln-rich rich region supports [NU+] prion formation and susceptibility to [PSI+] prion induction [Source:SGD;Acc:S000006147])

HSP 1 Score: 169.859 bits (429), Expect = 1.862e-44
Identity = 121/382 (31.68%), Postives = 183/382 (47.91%), Query Frame = 2
Query:  377 HGQEILLD-TTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAV-----MEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRIL-IIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQH 1501
            +G  +LL+ T L L  G RYG  G NG GKS+L   +AN +L      D +         DK  L+       ++ +E  + L     ++AL ++ +S  R                 +  A  L  +GF ++ + + V   SGGW+M++ LAR +  K  +L+LDEPTNHLD++   WLE+ L +++ I  +I+SH   FL+ VCT+IIH ++KKL YY GN   ++  K E+     K Y    D  A M     RF      +    +S  + + KM D            + FS+P                      KP +  ++   + L +RVA +GPNGAGKSTL+KL+  EL P +G + +H + RIG   QH
Sbjct:  581 YGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANGQL------DGF--------PDKDTLRTCFVEHKLQGEEGDLDL---VSFIALDEELQSTSR-----------------EEIAAALESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEHTDITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEA-----KSYYTLTDSNAQM-----RFPPPG--ILTGVKSNTRAVAKMTD------------VTFSYPGA-------------------QKPSL-SHVSCSLSLSSRVACLGPNGAGKSTLIKLLTGELVPNEGKVEKHPNLRIGYIAQH 884          

HSP 2 Score: 74.3294 bits (181), Expect = 4.041e-14
Identity = 30/82 (36.59%), Postives = 54/82 (65.85%), Query Frame = 2
Query: 1631 CPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTK 1876
             P+ SLS GQ  +++ A      PH+L+LDEPTN+LD +++ +LA AI ++ GG++++SH+   +G +  E W+  +G + +
Sbjct: 1028 TPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNEFVGALCPEQWIVENGKMVQ 1109          

HSP 3 Score: 56.9954 bits (136), Expect = 8.196e-9
Identity = 57/210 (27.14%), Postives = 95/210 (45.24%), Query Frame = 2
Query: 1283 IQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHS--HCRIGRYHQHLTEILDLNSS-PMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEG-GLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSY 1900
            I+I N  F       ++ +  +  +    R  L G NGAGKSTL++ IA+     DG   + +   C +    Q     LDL S   +D  ++S      R+E+   L   G    ++   + SLS G + ++  A        +LLLDEPTNHLD+  +  L + + E      L+VSHD   +  V  +I    +  +  + G++ ++
Sbjct:  570 IEIVNTDFSLAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANG--QLDGFPDKDTLRTCFVEHKLQGEEGDLDLVSFIALDEELQS----TSREEIAAALESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEHTDITSLIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLAAF 773          

HSP 4 Score: 53.9138 bits (128), Expect = 7.471e-8
Identity = 44/177 (24.86%), Postives = 84/177 (47.46%), Query Frame = 2
Query:  557 KTALQAVMEADEEKMRLEKEAEYLALQDDTES---QDRLVE-----VYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHF------------------SGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLV 1009
            K A++A++   + K   + E ++   +    S   +D LVE     + ++ DD +A R          GLG+ + +     KHF                  SGG  +++ +A  ++  P LL+LDEPTN+LD ++   L   +  +S  +++ISH+ +F+  +C     +++ K+V
Sbjct:  941 KRAIEAIVGRQKLKKSFQYEVKWKYWKPKYNSWVPKDVLVEHGFEKLVQKFDDHEASRE---------GLGYRELIPSVITKHFEDVGLDSEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNEFVGALCPEQWIVENGKMV 1108          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Yeast
Match: YEF3 (Translation elongation factor 3; contains two ABC cassettes; binds and hydrolyzes ATP; YEF3 has a paralog, HEF3, that arose from the whole genome duplication [Source:SGD;Acc:S000004239])

HSP 1 Score: 156.762 bits (395), Expect = 3.206e-40
Identity = 118/407 (28.99%), Postives = 181/407 (44.47%), Query Frame = 2
Query:  377 HGQEILLDTT-LELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRY-HENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILD--LNSSPMDWMMKSFPNIKERDEM 1585
            +G +ILL+ T L L   RRYG  GPNGCGKS+L   +AN        +D +  Q                  EE   +  E +      DT   D + E       +  + A K   + L   GFT +M    +   SGGW+M+++LAR +     +L+LDEPTNHLD     WL   L+      I ISH   FL+ VC  II+ +  KL  Y GN+ ++++    +     K Y+        + +    F           ++K+K + K                                + N+ F+Y   +KP I D I+F   L +R+A++GPNGAGKSTL+ ++  EL PT G +  H +CRI    QH    ++  L+ +P +++   F   ++R+ M
Sbjct:  440 YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIAN------GQVDGFPTQ------------------EECRTVYVEHDIDGTHSDTSVLDFVFE-----SGVGTKEAIK---DKLIEFGFTDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAA-----KAYE-------ELSNTDLEFKFPEPGYLEGVKTKQKAIVK--------------------------------VTNMEFQYPGTSKPQITD-INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEVYTHENCRIAYIKQHAFAHIESHLDKTPSEYIQWRFQTGEDRETM 769          

HSP 2 Score: 72.0182 bits (175), Expect = 1.711e-13
Identity = 28/79 (35.44%), Postives = 52/79 (65.82%), Query Frame = 2
Query: 1637 IKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVT 1873
            I+ LS GQ+ +++ A      PH+++LDEPTN+LD +++ +L+ A+ EFEGG+++++H       + +E+W    G +T
Sbjct:  894 IRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEVWAVKDGRMT 972          

HSP 3 Score: 71.2478 bits (173), Expect = 3.173e-13
Identity = 51/177 (28.81%), Postives = 85/177 (48.02%), Query Frame = 2
Query: 1370 RVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSY 1900
            R  + GPNG GKSTL++ IA+     DG       CR   Y +H  +    ++S +D++ +S   +  ++ ++ KL  +G T      PI +LS G + ++  A        +LLLDEPTNHLD   +  L + +N      + +SHD   +  V + I       + K+ G+   +
Sbjct:  458 RYGICGPNGCGKSTLMRAIANG--QVDGF-PTQEECRT-VYVEHDIDGTHSDTSVLDFVFES--GVGTKEAIKDKLIEFGFTDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEGLKLRKYKGNFTEF 628          

HSP 4 Score: 55.8398 bits (133), Expect = 2.012e-8
Identity = 30/113 (26.55%), Postives = 64/113 (56.64%), Query Frame = 2
Query:  773 VKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNY--DQYIRTKMESEENQMKKYKWEQDQMA 1105
            ++  SGG ++++ LA   + +P L++LDEPTN+LD ++   L K L ++   +III+HS +F   +   +  ++  ++     N+   Q    ++E +E++  K+    +++A
Sbjct:  894 IRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEVWAVKDGRMTPSGHNWVSGQGAGPRIEKKEDEEDKFDAMGNKIA 1006          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Yeast
Match: HEF3 (Translational elongation factor EF-3; member of the ABC superfamily; stimulates EF-1 alpha-dependent binding of aminoacyl-tRNA by the ribosome; normally expressed in zinc deficient cells; HEF3 has a paralog, YEF3, that arose from the whole genome duplication [Source:SGD;Acc:S000004959])

HSP 1 Score: 148.288 bits (373), Expect = 1.541e-37
Identity = 106/406 (26.11%), Postives = 176/406 (43.35%), Query Frame = 2
Query:  377 HGQEILLDTT-LELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILD--LNSSPMDWMMKSFPNIKERDEM 1585
            +G +ILL+ T L L  GRRYG  GPNG GKS+L   +AN        +D +       P+        +E D +    +          +  ++D +    +                     GF+ +M +  +   SGGW+M+++LAR +     +L+LDEPTNHLD     WL   L+      +I+SH   FL+ VC  IIH +  KL  Y GN  ++++    ++      Y+     +         F   +       ++K+K + K+ +            + F +P                      KP + D + F   L +R+A++GPNGAGKSTL+ ++  EL PT G +  H +CRI    QH    ++  L+ +P +++   F   ++R+ M
Sbjct:  440 YGAKILLNKTQLRLKRGRRYGLCGPNGAGKSTLMRSIAN------GQVDGF-------PTQDECRTVYVEHDIDNTHSDMSVLDFVYSGNVGTKDVITSKLKEF-------------------GFSDEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDTVNVEWLVNYLNTCGITSVIVSHDSGFLDKVCQYIIHYEGLKLRKYKGNLSEFVQKCPTAQ----SYYELGASDL--------EFQFPTPGYLEGVKTKQKAIVKVSN------------MTFQYPGT-------------------TKPQVSD-VTFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEVYTHENCRIAYIKQHAFAHIESHLDKTPSEYIQWRFQTGEDRETM 769          

HSP 2 Score: 74.7146 bits (182), Expect = 2.614e-14
Identity = 57/202 (28.22%), Postives = 92/202 (45.54%), Query Frame = 2
Query: 1295 NVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSY 1900
            N  F       ++ +     +    R  L GPNGAGKSTL++ IA+     DG       CR   Y +H  +    + S +D++     N+  +D +  KL  +G +      PI SLS G + ++  A        +LLLDEPTNHLD   ++ L + +N      ++VSHD   + +V   I       + K+ G++  +
Sbjct:  433 NCEFSLAYGAKILLNKTQLRLKRGRRYGLCGPNGAGKSTLMRSIANG--QVDGF-PTQDECRT-VYVEHDIDNTHSDMSVLDFVYSG--NVGTKDVITSKLKEFGFSDEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDTVNVEWLVNYLNTCGITSVIVSHDSGFLDKVCQYIIHYEGLKLRKYKGNLSEF 628          

HSP 3 Score: 73.1738 bits (178), Expect = 8.470e-14
Identity = 28/79 (35.44%), Postives = 51/79 (64.56%), Query Frame = 2
Query: 1637 IKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVT 1873
            I+ LS GQ+ +++ A      PH+++LDEPTN+LD +++ +L+ A+  FEGG+++++H       + DE+W    G +T
Sbjct:  894 IRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAFEGGVIIITHSAEFTKNLTDEVWAVKDGKMT 972          

HSP 4 Score: 59.3066 bits (142), Expect = 1.459e-9
Identity = 31/105 (29.52%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  773 VKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNY--DQYIRTKMESEENQMKKY 1081
            ++  SGG ++++ LA C + +P L++LDEPTN+LD ++   L K L  +   +III+HS +F   +   +  ++  K+     N+   Q    ++E +E +  K+
Sbjct:  894 IRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAFEGGVIIITHSAEFTKNLTDEVWAVKDGKMTPSGHNWVAGQGAGPRIEKKEEEGDKF 998          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Nematostella
Match: EDO37542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE5])

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 357/543 (65.75%), Postives = 433/543 (79.74%), Query Frame = 2
Query:  302 RSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQ 1930
            R+ TGVL SH  S+DV   N  ITFHG E+L D  LELN GR+YG IG NGCGKS++   +   E+P+P H D + L  E+  SDKTALQ VME D+E+ RLE+EAE L+   D E  DRL EV+ERL++LDA  AE RAAEIL GLGFT  MQQ + K FSGGWRMRISLAR LFV+P +L+LDEPTNHLDL+ACVWLE+EL +Y RIL+I+SHS+DFLNGVCTNIIHM  KKL YY GNYD Y++T+ E EENQMK+Y  EQDQ+ HMK+YIARFGHGS KLARQAQSKEK L KM  +GLT KV +DK L F F  CG + PPV+Q+Q++SF+Y  +KPLIY N++FG+DL++RVALVGPNGAGKSTLLKLI   L PT+G++RRHSH +I RYHQHL +IL+L+ S M +MMK FP IKE+++MR+ +GRYGLTG QQICP+++LSDGQRCR++FAWLA   PHMLLLDEPTNHLD+ETID+LADAIN+F+GG++LVSHDFRLI +VA EIWVC   TVT W GDI SYK  L ++I +
Sbjct:   31 RACTGVLGSHPMSKDVKIDNFSITFHGVELLTDAKLELNTGRKYGLIGLNGCGKSTMLTAIGKREIPIPEHFDIFHLTSEIEASDKTALQCVMEVDKERHRLEEEAEELSKMGD-EGHDRLTEVFERLEELDAAHAEVRAAEILHGLGFTGAMQQTQTKDFSGGWRMRISLARALFVRPTILLLDEPTNHLDLDACVWLEQELKEYKRILVIVSHSQDFLNGVCTNIIHMALKKLTYYGGNYDSYVKTREELEENQMKQYNREQDQIKHMKEYIARFGHGSAKLARQAQSKEKVLAKMKANGLTDKVVKDKVLTFYFNDCGTLAPPVVQVQHMSFQYAPDKPLIYKNVEFGLDLESRVALVGPNGAGKSTLLKLIEGLLSPTEGIVRRHSHLKICRYHQHLQDILELDMSAMKFMMKCFPEIKEQEDMRRIIGRYGLTGKQQICPMRNLSDGQRCRVVFAWLAFQTPHMLLLDEPTNHLDMETIDALADAINDFDGGMILVSHDFRLINQVAKEIWVCERQTVTPWKGDILSYKEELRRKIAK 572          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Nematostella
Match: EDO36317 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ11])

HSP 1 Score: 434.491 bits (1116), Expect = 2.367e-144
Identity = 216/535 (40.37%), Postives = 338/535 (63.18%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQD--------RLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYK 1903
            S   +S+D+   N  + +  + +L    L +  GRRYG +G NG GK++L   L+  EL V S+I    +++E+   +  AL++V+E D E+  L KE + LA    ++S D        RL ++Y RL++++A++A  RA+ IL GLGFT  MQ +  K FSGGWRMR++LAR LF KP LL+LDEPTN LDL A +WLE  L Q+   ++++SH  +FL+ V T+I+HM  +KL YY GNY+ + +T+ E   NQ ++Y+ +Q    H++ +I +F + +++ A  AQSK K L+K+    + Q V RD   +  FP C ++ PPV+Q+  V F Y  ++ +I+  +D   + ++R+A+VG NG+GK+TLLK++  ELEP  G+   H + +IG + QH  + L +    ++++   FP +   +  R +LGRYG++G     PI SLS GQ+ R++FA +    P++L+LDEPTNHLD+ETI++LA A+ +F+GG++LVSHD RL+  V +E+W+C  GTV   +G    YK
Sbjct:  103 SGTNKSQDIRIENFDLAYGNRSLLKGANLAIAFGRRYGLVGRNGIGKTTLLRTLSKRELFVASNISILYVEQEVVGDETPALESVLECDTERFNLLKEEKALAASTSSKSPDANGDKTSKRLAQIYSRLEEIEADKAPARASTILAGLGFTPKMQTQFTKEFSGGWRMRLALARALFSKPDLLLLDEPTNMLDLKAVMWLEGYLQQWPTTILVVSHDRNFLDTVTTDILHMHSQKLDYYKGNYENFQKTREEKLLNQQREYEAQQMYRQHLQAFIDKFRYNAKR-ASLAQSKIKILEKL---PVLQPVERDPPAILRFPECEKLSPPVLQLDEVMFHYSPDR-VIFSKVDISANNESRIAVVGDNGSGKTTLLKILLGELEPVKGIRHYHRNLKIGYFSQHHVDQLQMTQCAIEFLASRFPGMNT-EAYRHQLGRYGVSGELATRPIISLSGGQKSRVVFASMTMGGPNLLVLDEPTNHLDMETIEALAKALRQFKGGVVLVSHDERLVRNVCNEVWLCGQGTVRSIEGGFDMYK 631          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Nematostella
Match: EDO34786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNE4])

HSP 1 Score: 407.142 bits (1045), Expect = 8.806e-135
Identity = 213/551 (38.66%), Postives = 339/551 (61.52%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRL-EKEAEYLALQD--DTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMV--------------DSGLTQKVSRDKGLV--FSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            ++D+      I+  G+E+ ++ TL + NGRRYG +GPNG GK++L   +A  +L +P +ID  L ++++   +  A   V++AD++++ L E+E   +AL +  D  + ++L EVY  ++ + A  AE RA  IL GLGFT +MQQ+ V HFSGGWRMR+SLAR LF++P  LMLDEPTNHLDLNA +WL+  L  + + L+++SH + FL+ +CT+IIH+  +KL YY GNY Q+ +   +  + Q K +  ++ Q+  MK         S +  +QA+ K K  +                 D    + + + K  V  FSFP+   + PP++ +++V F Y  ++P+++ NIDFG+D+++R+ALVG NG GK+T LKL+   L P  G + R+   R+G Y QH  + L+L  S ++++   + N+ +    RK LGR+GL        IK LS GQ+ R+ FA +A + P +++LDEPTN+LD+E+ID+LA AINEF GG++LVSHD RLI     ++WV  +  + + +GD   Y+  ++ ++ +E
Sbjct:   23 AQDIKVEKFSISARGKELFVNATLNITNGRRYGLVGPNGMGKTTLLTHIAERKLAIPPNIDVLLCEQDVKADNSPAFDVVLKADKKRLHLLEEEKRLIALSETGDESANEKLKEVYVEMEAIGAASAESRARRILSGLGFTTEMQQRPVNHFSGGWRMRVSLARALFLEPTFLMLDEPTNHLDLNAVIWLDNYLQNWKKTLLVVSHDQYFLDSICTDIIHLDMQKLSYYRGNYAQFKKMYKQKLKEQEKAFHKQEKQLKDMK--------ASGQSKKQAEEKTKAQQGRKNKKGGKKGADAEEDDRQTVELLKKPKEYVVKFSFPNPPPLNPPILGLKDVVFGY-PDQPILFKNIDFGVDMNSRIALVGNNGVGKTTFLKLLCGNLNPLQGELIRNHRLRLGFYSQHSADQLNLEESSVEYLQSKY-NL-DYQSSRKHLGRFGLASHAHTIRIKDLSGGQKSRVAFADMALSNPDVVILDEPTNNLDIESIDALAAAINEFTGGVILVSHDARLILETECQLWVVENKEINEVEGDFDDYRQEILDKLGEE 562          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Nematostella
Match: EDO25928 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDC3])

HSP 1 Score: 79.337 bits (194), Expect = 3.678e-17
Identity = 53/182 (29.12%), Postives = 91/182 (50.00%), Query Frame = 2
Query: 1331 IYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQI--CPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEG----GLLLVSHDFRLIGRVADEIWVCN 1858
            + D++   +     V L+GPNGAGK+TL++ +   L+P  G + R +  RIG   Q L     L  S + + ++  P +  R +++  L      GA+Q+   P++S+S G+  R++ A      P +L+LDEP   +D+     L   I +       G+L+VSHD  L+    D++   N
Sbjct:    1 VLDDVQLSVKPGEIVTLIGPNGAGKTTLVRAVLGLLKPDTGSVWRKAKLRIGYMPQKLHVDATLPLSVLRF-LRLVPGVT-RTDVQAALAE---VGAEQVIDSPLQSISGGELQRVLLARALLRKPELLVLDEPVQGVDVAGQAELYRLITQLRDRHGCGVLMVSHDLHLVMSTTDQVVCLN 177          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Nematostella
Match: EDO28632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5X8])

HSP 1 Score: 77.0258 bits (188), Expect = 1.571e-15
Identity = 40/80 (50.00%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  608 EKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALL 847
            EK    L+   D  + ++L EVY  ++ + A  AE RA  IL GLGFT +MQQ+ V HFSGGWRMR+SLAR  + K  LL
Sbjct:  140 EKRLIALSETGDESANEKLKEVYVEMEAIGAASAESRARRILSGLGFTTEMQQRPVNHFSGGWRMRVSLAR--YAKAFLL 217          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Medaka
Match: abcf2b (ATP binding cassette subfamily F member 2 [Source:NCBI gene;Acc:101162792])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 379/583 (65.01%), Postives = 478/583 (81.99%), Query Frame = 2
Query:  188 HELDDEFMGSEDEEDSK-MAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            +E +D+    E+  DS  +A L  E++   L   + ++ R+VTGVL+SH  S DVH S++ +TFHGQE+L DT+LELN+GRRYG IG NG GKS L + + + E+P+P HID Y L REM PSDKTALQ VME DE+++ LEKEAE LA  +D+E + +L+E+YERL++LDA++A+ RA+ IL GLGF+  MQQK+++ FSGGWRMR++LAR LF+KP +L+LDEPTNHLDL+ACVWLE+EL  + RIL++ISHS+DFLNGVCTNIIH+  +KL YY GNYDQY++T+ E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT+KV  DK L F FP CG+IPPPVI +QNVSF+Y +N P IY N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHLTE L+L+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LADAINEFEGG++LVSHDFRLI +VA EIWVC   T+TKW+ DI +YK  L  +IE++
Sbjct:   30 NEENDQAEPQENGADSNGVANLTKELDEFEL---RKTEARAVTGVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSDKTALQCVMEVDEQRIMLEKEAERLA-HEDSECE-KLMELYERLEELDADKAQMRASRILHGLGFSPAMQQKKLRDFSGGWRMRVALARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTEKVVNDKTLSFYFPPCGKIPPPVIMVQNVSFKYSDNTPHIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWNRDILAYKEHLKSKIEKQ 607          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Medaka
Match: abcf2b (ATP binding cassette subfamily F member 2 [Source:NCBI gene;Acc:101162792])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 379/583 (65.01%), Postives = 478/583 (81.99%), Query Frame = 2
Query:  188 HELDDEFMGSEDEEDSK-MAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            +E +D+    E+  DS  +A L  E++   L   + ++ R+VTGVL+SH  S DVH S++ +TFHGQE+L DT+LELN+GRRYG IG NG GKS L + + + E+P+P HID Y L REM PSDKTALQ VME DE+++ LEKEAE LA  +D+E + +L+E+YERL++LDA++A+ RA+ IL GLGF+  MQQK+++ FSGGWRMR++LAR LF+KP +L+LDEPTNHLDL+ACVWLE+EL  + RIL++ISHS+DFLNGVCTNIIH+  +KL YY GNYDQY++T+ E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT+KV  DK L F FP CG+IPPPVI +QNVSF+Y +N P IY N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHLTE L+L+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LADAINEFEGG++LVSHDFRLI +VA EIWVC   T+TKW+ DI +YK  L  +IE++
Sbjct:   30 NEENDQAEPQENGADSNGVANLTKELDEFEL---RKTEARAVTGVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSDKTALQCVMEVDEQRIMLEKEAERLA-HEDSECE-KLMELYERLEELDADKAQMRASRILHGLGFSPAMQQKKLRDFSGGWRMRVALARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTEKVVNDKTLSFYFPPCGKIPPPVIMVQNVSFKYSDNTPHIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWNRDILAYKEHLKSKIEKQ 607          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Medaka
Match: abcf2b (ATP binding cassette subfamily F member 2 [Source:NCBI gene;Acc:101162792])

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 381/608 (62.66%), Postives = 479/608 (78.78%), Query Frame = 2
Query:  188 HELDDEFMGSEDEEDSK-MAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLI----GR---------------------VADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            +E +D+    E+  DS  +A L  E++   L   + ++ R+VTGVL+SH  S DVH S++ +TFHGQE+L DT+LELN+GRRYG IG NG GKS L + + + E+P+P HID Y L REM PSDKTALQ VME DE+++ LEKEAE LA  +D+E  ++L+E+YERL++LDA++A+ RA+ IL GLGF+  MQQK+++ FSGGWRMR++LAR LF+KP +L+LDEPTNHLDL+ACVWLE+EL  + RIL++ISHS+DFLNGVCTNIIH+  +KL YY GNYDQY++T+ E EENQMK++ WEQDQ+AHMK+YIARFGHGS KLARQAQSKEKTL+KMV SGLT+KV  DK L F FP CG+IPPPVI +QNVSF+Y +N P IY N++FGIDLDTRVALVGPNGAGKSTLLKL+  EL PTDG+IR+HSH +IGRYHQHLTE L+L+ SP+++MMK +P IKE++EMRK +GRYGLTG QQ+ PI++LSDGQ+CR+ FAWLA   PHML LDEPTNHLD+ETID+LADAINEFEGG++LVSHDFRLI    GR                     VA EIWVC   T+TKW+ DI +YK  L  +IE++
Sbjct:   30 NEENDQAEPQENGADSNGVANLTKELDEFEL---RKTEARAVTGVLASHPNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAIGHREVPIPEHIDIYHLTREMAPSDKTALQCVMEVDEQRIMLEKEAERLA-HEDSEC-EKLMELYERLEELDADKAQMRASRILHGLGFSPAMQQKKLRDFSGGWRMRVALARALFIKPFMLLLDEPTNHLDLDACVWLEEELKSFKRILVLISHSQDFLNGVCTNIIHLHQRKLKYYTGNYDQYVKTREELEENQMKRFNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMVASGLTEKVVNDKTLSFYFPPCGKIPPPVIMVQNVSFKYSDNTPHIYKNLEFGIDLDTRVALVGPNGAGKSTLLKLLMGELLPTDGMIRKHSHVKIGRYHQHLTEQLELDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCFAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVCGRSGCLQVLFLRFTFDPPHVCFQVAQEIWVCEKQTITKWNRDILAYKEHLKSKIEKQ 632          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Medaka
Match: abcf3 (ATP binding cassette subfamily F member 3 [Source:NCBI gene;Acc:101159646])

HSP 1 Score: 418.698 bits (1075), Expect = 7.303e-137
Identity = 220/546 (40.29%), Postives = 341/546 (62.45%), Query Frame = 2
Query:  323 SSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEAD--------EEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGE-IPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            S    S D+   N  I+F  + +L    L L +GRRYG IG NG GK++L  +LA+  L VP+HI    +++E+   D  ALQ+V+++D        EEKM   + A   A  D  ES  RL E+Y +L++++A++A  RA+ IL GLGF+  MQQ+  + FSGGWRMR++LAR LF +P LL+LDEPTN LD+ A VWLE  L  +   ++++SH  +FLN V T+IIH+  ++L  Y G+Y+ +++TK +  +NQ ++Y+ +     H++ +I RF + + + A Q QSK K L K+ +    + + ++  +   FP   E + PP++Q+  V F Y  ++PL +  ++   DL++R+ +VG NG GK+T+LKL+  EL P +G+ + H + +IG + QH  + LDLN   ++ ++  FP   E +E R +LG YG+TG     P+ SLS GQ+ R+ FA +    P+  +LDEPTNHLD+ETI++LA A+N+F+GG++LVSHD RLI  V  E+WVC  G V + DG    Y+  L ++ ++E
Sbjct:  183 SGKNRSYDIRIENFDISFGERCLLQGAELSLASGRRYGLIGRNGLGKTTLLKMLASRNLRVPAHISILHVEQEVAGDDTMALQSVLQSDSLREGLLNEEKMLNARIANGTA--DGMESV-RLSEIYMKLEEIEADKAPARASVILAGLGFSPRMQQQATREFSGGWRMRLALARSLFARPDLLLLDEPTNMLDVKAIVWLENYLQTWQSTILVVSHDRNFLNAVVTDIIHLHSQRLDSYRGDYENFLKTKEDRLKNQQREYEAQLQYRQHIQVFIDRFRYNANRAA-QVQSKLKLLDKLPE---LKPLEKETEVTLRFPDNFEKLSPPILQLDEVEFYYSPDQPL-FSGLNLSADLESRICIVGENGTGKTTILKLLMGELTPLNGVRQAHRNLKIGYFSQHHVDQLDLNVCSVELLLNKFPGRTE-EEYRHQLGGYGITGELATRPVASLSGGQKSRVAFAQMTMPSPNFYILDEPTNHLDMETIEALAKALNKFKGGVILVSHDERLIRSVCKELWVCEGGKVWRIDGGFDEYRDILHEQFKKE 719          
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Medaka
Match: abcf1 (ATP binding cassette subfamily F member 1 [Source:NCBI gene;Acc:101173319])

HSP 1 Score: 372.474 bits (955), Expect = 6.157e-118
Identity = 216/545 (39.63%), Postives = 339/545 (62.20%), Query Frame = 2
Query:  338 SRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLA--LQDDTES-QDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSG-----------LTQKVSRDK--GLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEI 1924
            + D+      I+ HG+E+ ++  L +  GRRYG +GPNG GK++L   +AN  L +P +ID  L ++E+   D  A+QAV++AD  +++L +E + L   L+   +S  +RL +VYE L  + A  AE +A  IL GL FT +MQ +  K FSGGWRMR+SLAR LF++P LLMLDEPTNHLDLNA +WL   L  + + L+I+SH + FL+ VCT+IIH+ ++KL YY GNY  + +  ++ ++   K+Y  ++ ++  +K      G  S K A + Q+KE   +K                 T+ + R K   + F+FP+   + PP++ + +V F Y   KPL + N+DFGID+D+R+ +VGPNG GKSTLL L+  +L PT G +R++   ++G ++Q   + L++  +  +++M++F N+  +D  RK LGR+GL        I  LS GQ+ R++FA LA   P +L+LDEPTN+LD+E+ID+L++AINE++G +++VSHD RLI      +WV    ++ + DGD   YK  +++ +
Sbjct:  274 ASDIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADDTPAVQAVLKADTRRLKLLEEEKQLQANLEKGEDSVAERLEKVYEELRVIGAAAAEAKARRILAGLSFTPEMQNRATKRFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWKKTLLIVSHDQSFLDEVCTDIIHLDNQKLYYYRGNYLTFKKMYVQKQKELQKQYDKQEKKLKDLK-----AGGKSTKQA-EKQTKEVLTRKQQKGKKKGGQDEESHEATELLKRPKEYTVKFTFPNPPPLSPPILGLHSVDFCYDSQKPL-FKNVDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTKGEMRKNHRLKVGFFNQQYADQLNMEETATEYLMRNF-NLPYQD-GRKCLGRFGLESHAHTIQISKLSGGQKARVVFAELACRQPDVLILDEPTNNLDIESIDALSEAINEYKGAVIIVSHDARLITETQCTLWVVEDRSIIQIDGDFDDYKREVLEAL 809          
BLAST of ATP-binding cassette sub-family F member 2 vs. Planmine SMEST
Match: SMESG000071613.1 (SMESG000071613.1)

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 642/643 (99.84%), Postives = 643/643 (100.00%), Query Frame = 2
Query:   32 MPSDXXXXXXXXXXXXXXXXPNGXXXXXXXXXXXXXXXXXXNGDAKDHKHTKHELDDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARRALIER 1960
            MPSDNKRAKAAAKKNNAKKRPNGVAKKEVEVVNEVEKKVLVNGDAKDHKHTKHELDDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASL+KEIEQEHARRALIER
Sbjct:    1 MPSDNKRAKAAAKKNNAKKRPNGVAKKEVEVVNEVEKKVLVNGDAKDHKHTKHELDDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLVKEIEQEHARRALIER 643          
BLAST of ATP-binding cassette sub-family F member 2 vs. Planmine SMEST
Match: SMESG000035959.1 (SMESG000035959.1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.398e-137
Identity = 214/549 (38.98%), Postives = 342/549 (62.30%), Query Frame = 2
Query:  281 SEKVSQYRSVTGVLSSHRESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVC-NHGTVTKWDGDIYSYKASLIKEI 1924
            S+ ++ Y    G+ S+     +   SN  ++F  + +L D ++ ++ GRRYGFIG NG GK+++   +A  EL +P+++   L+++E+   D  A+ +V+EAD  + RL KE E L    DT    R+ E+Y++LD +++++A  RA  IL GLGF+ +MQ    + FSGGWRMR++LAR LF +P LL+LDEPTN LD+ A +WLE  L  + + LI++SH + FL+ V T+I+ + ++K+  +  NY ++   +     NQ+K+Y+ +     H++ +I RF   + K A Q QS+ K L+K+      + V ++  +VF FPSC ++P P++Q   + F Y + + +I  N+   +   +R+ +VG NGAGK+TLLK+   ELEP  GL+R H   RIG + QH  + L+LN S ++++   FP   E +  R +LG +G+ G   + PI+SLS GQ+ R+ F  L+   P+ L+LDEPTNHLD++TI +L +AI +FEGG++LVSHD RLI  V +E+W+   +G V+  DG I  Y+  + KE+
Sbjct:  157 SKNINLYDKEDGIDSNGTVLTNFVISNFDMSFGSKMLLKDASISISIGRRYGFIGRNGLGKTTMLKAIATKELKMPANVSILLVEQEVIGDDTKAINSVLEADTVRTRLLKELEELNANKDTADGSRIPEIYQKLDLIESDKAPARACLILKGLGFSPEMQLMSTRQFSGGWRMRLALARALFSQPDLLLLDEPTNMLDMKAIIWLEMYLKTWKKSLIVVSHDQKFLDAVATDILFLSNQKIENFKCNYSEFEEARRMKLVNQLKEYESQMQYREHVQVFIDRFRTYASK-ATQVQSRIKMLEKLPK---LEPVVKEMKVVFEFPSCPKLPSPILQADELCFGYTKERTVI-KNLVISVGSHSRICIVGENGAGKTTLLKIFLKELEPQSGLLRTHKSLRIGFFSQHHVDQLNLNQSSLEFLQTKFPG-SEPEYYRGRLGSFGIVGDVALRPIQSLSGGQKSRVAFTILSMKNPNFLILDEPTNHLDMQTIGALGEAIKKFEGGVILVSHDERLINNVCEELWLVEKNGNVSIVDGGISKYREMVQKEL 699          
BLAST of ATP-binding cassette sub-family F member 2 vs. Planmine SMEST
Match: SMESG000041811.1 (SMESG000041811.1)

HSP 1 Score: 387.497 bits (994), Expect = 2.613e-126
Identity = 199/540 (36.85%), Postives = 326/540 (60.37%), Query Frame = 2
Query:  344 DVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQ-----DDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKL-----ARQAQSKEKTLKKMVDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQE 1933
            D+      I+  G+E+  +  L +  GR+YG IGPNG GK++L   +AN +L +PS+ID  L ++++   D  AL  V+++D + M L  + E L ++        E+ ++L + Y+ L+ + +  +E +A  IL GLGFT+ M  K  K FSGGWRMR+SLAR LF++P LL+LDEPTNHLDLNA +WL+  L ++ + ++I+SH + FL+ VCT+IIH+  KKL YY GNY  +    ++      KKY  +Q  +  M           ++L      +QA+S  K  ++ ++     +  ++  + F FP+  ++   ++ + NVSF Y      ++  +DF +D+++RV++VGPNG GKST LKL+  E+EPT G    +   ++G+Y+QH  + L++  +P++++ + F N++ + E R+ LGR+GL       P  SLS GQR R+ FA LA   P +L+LDEPTN+LDLE+I++L  AI ++EGG+++V+HD RLI +    +WV     + + DG+   Y+  ++  + +E
Sbjct:   56 DIKIEKFGISAAGKELFKNACLHITKGRKYGLIGPNGHGKTTLLRHIANRKLHIPSNIDLLLCEQDVVADDTIALDYVLKSDSKMMDLLSKVEKLKVEVEIDVSSNEAINKLNDTYDELNAMGSSASESKARRILAGLGFTEKMMMKPTKDFSGGWRMRVSLARALFIEPTLLLLDEPTNHLDLNAVIWLDNYLQRWKKTILIVSHDQSFLDNVCTDIIHLNRKKLDYYKGNYSMFKEMFIQKMVQDRKKYDQQQKDLKDMIKKGQSKKEAEKQLKDDLYKKQAKSSRKKEEQEIEPIELLEKPKEYQVKFDFPNPQKLNGLILSLTNVSFSYAGTNNTLFTKVDFVLDMNSRVSIVGPNGVGKSTFLKLLTGEIEPTIGERSINHRIKLGKYNQHSRDQLNMKETPVEYLRRLF-NLQYQ-EARQNLGRFGLEKHAHEIPNSSLSGGQRARVAFAELALMKPDLLILDEPTNNLDLESIEALCVAIEKYEGGVVIVTHDERLIRQTNCLLWVVEDKNINEIDGEFDDYRKEVLLALNEE 593          

HSP 2 Score: 68.5514 bits (166), Expect = 7.990e-12
Identity = 58/235 (24.68%), Postives = 97/235 (41.28%), Query Frame = 2
Query: 1331 IYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELE--PTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMK-----------------------------SFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHAR 1942
            ++ N    I    +  L+GPNG GK+TLL+ IA+     P++  +       +      L  +L  +S  MD + K                             +  +     + R+ L   G T    + P K  S G R R+  A      P +LLLDEPTNHLDL  +  L + +  ++  +L+VSHD   +  V  +I   N   +  + G+   +K   I+++ Q+  +
Sbjct:   71 LFKNACLHITKGRKYGLIGPNGHGKTTLLRHIANRKLHIPSNIDLLLCEQDVVADDTIALDYVLKSDSKMMDLLSKVEKLKVEVEIDVSSNEAINKLNDTYDELNAMGSSASESKARRILAGLGFTEKMMMKPTKDFSGGWRMRVSLARALFIEPTLLLLDEPTNHLDLNAVIWLDNYLQRWKKTILIVSHDQSFLDNVCTDIIHLNRKKLDYYKGNYSMFKEMFIQKMVQDRKK 305          
BLAST of ATP-binding cassette sub-family F member 2 vs. Planmine SMEST
Match: SMESG000049901.1 (SMESG000049901.1)

HSP 1 Score: 253.062 bits (645), Expect = 9.167e-76
Identity = 150/513 (29.24%), Postives = 272/513 (53.02%), Query Frame = 2
Query:  341 RDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKM--VDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVT 1873
            +     N+ +T   + +L D+T+ + +G+RYG IG NG GKS LF  +       P +    +++ E        ++  +  DE +  + K A+      + +++D  VEV              +  +IL G+GFT +     V + SGGWRM+ISLA  L  +P LL+LDEPTN LD     WL   L ++   L  ISH   FL+ V T+++ +++K +V+Y   Y +++R +    +N  K+ + ++ Q A + +YI       +   ++  +K + +KKM  +D  + +        ++ FP+C +I    I+   + F +   K  I+ NI   +  D+++ ++G NG GK+TLLK+    L+PT+G +  +    +G + QH  + L+++ S ++ M    PN K  +  +  L ++G+T      P++ LS GQ+ R+ F+ +    P+ L+ DEPT+HLD +  ++L DA+ +F+GG+++V+HD R++  V  ++W   + TV+
Sbjct:   44 KSFALENLNMTILEKVLLKDSTITIEHGKRYGLIGSNGSGKSILFKAIQMGLFDFPDNYTIGIVEEECLADGTKVVECFVGKDEVEDFMVKFADVKGRAVNKKNKD--VEV-------------PKLVKILDGMGFTSEKMNDHVGNLSGGWRMKISLATVLMAEPDLLLLDEPTNMLDDRTIKWLSGFLKEWKTNLFFISHDGGFLSNVATDLLSIENKTVVHYACKYYEWLRNQELDRDNVRKQIEEQKAQKAELMEYIK---KFEKTKKKEVAAKRQQIKKMPVIDESILEPRE-----IWRFPACLKIKCATIETNEMGFSFGPAKE-IFRNITLRVQPDSKICILGDNGCGKTTLLKIFMKILKPTNGNMFLNDRTNVGYFSQHYVDHLEMDKSAIEIMQIRVPNCK-LETYQSHLLKFGITSEDWNIPVRCLSSGQKSRVAFSTIYMQKPNFLIFDEPTSHLDKDGTEALEDALRKFKGGVIVVTHDGRMMSNVCKDLWYIQNRTVS 531          

HSP 2 Score: 68.5514 bits (166), Expect = 8.370e-12
Identity = 58/215 (26.98%), Postives = 96/215 (44.65%), Query Frame = 2
Query: 1370 RVALVGPNGAGKSTLLKLIASEL-----EPTDGLIRRHS--------HCRIGR--YHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSY-------KASLIKEIEQEHARRA 1948
            R  L+G NG+GKS L K I   L       T G++             C +G+      + +  D+    ++   K      E  ++ K L   G T  +    + +LS G R +I  A +    P +LLLDEPTN LD  TI  L+  + E++  L  +SHD   +  VA ++    + TV  +    Y +       + ++ K+IE++ A++A
Sbjct:   73 RYGLIGSNGSGKSILFKAIQMGLFDFPDNYTIGIVEEECLADGTKVVECFVGKDEVEDFMVKFADVKGRAVNKKNKDV----EVPKLVKILDGMGFTSEKMNDHVGNLSGGWRMKISLATVLMAEPDLLLLDEPTNMLDDRTIKWLSGFLKEWKTNLFFISHDGGFLSNVATDLLSIENKTVVHYACKYYEWLRNQELDRDNVRKQIEEQKAQKA 283          
BLAST of ATP-binding cassette sub-family F member 2 vs. Planmine SMEST
Match: SMESG000049863.1 (SMESG000049863.1)

HSP 1 Score: 252.677 bits (644), Expect = 1.376e-75
Identity = 150/513 (29.24%), Postives = 272/513 (53.02%), Query Frame = 2
Query:  341 RDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAVLANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLALQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKHFSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRILIIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKYKWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKM--VDSGLTQKVSRDKGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVALVGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVT 1873
            +     N+ +T   + +L D+T+ + +G+RYG IG NG GKS LF  +       P +    +++ E        ++  +  DE +  + K A+      + +++D  VEV              R  +IL G+GFT +     V + SGGWRM+ISLA  L  +P LL+LDEPTN LD     WL   L ++   L  ISH   FL+ V T+++ +++K +V+Y   Y +++R +    +N  K+ + ++ Q + + +YI       +   ++  +K + +KKM  +D  + +        ++ FP+C +I    I+   + F +   K  I+ NI   +  D+++ ++G NG GK+TLLK+    L+PT+G +  +    +G + QH  + L+++ S ++ M    PN K  +  +  L ++G+T      P++ LS GQ+ R+ F+ +    P+ L+ DEPT+HLD +  ++L DA+ +F+GG+++V+HD R++  V  ++W   + TV+
Sbjct:   44 KSFALENLNMTILEKVLLKDSTITIEHGKRYGLIGSNGSGKSILFKAIQMGLFDFPDNYTIGIVEEECLADGTKVVECFVGKDEVEDFMVKFADVKGRAVNKKNKD--VEV-------------PRLVKILDGMGFTVEKMNDHVGNLSGGWRMKISLATVLMAEPDLLLLDEPTNMLDDRTIKWLSGFLKEWKTNLFFISHDGGFLSNVATDLLSIENKTVVHYACKYYEWLRNQELDRDNVRKQIEEQKTQKSELMEYIK---KFEKTKKKEVAAKRQQIKKMPVIDESILEPRE-----IWRFPACLKIKCATIETNEMGFSFGPAKE-IFRNITLRVQPDSKICILGDNGCGKTTLLKIFMKILKPTNGNMFLNDRTNVGYFSQHYVDHLEMDKSAIEIMQIRVPNCK-LETYQSHLLKFGITSEDWNIPVRCLSSGQKSRVAFSTIYMQKPNFLIFDEPTSHLDKDGTEALEDALRKFKGGVIVVTHDGRMMSNVCKDLWYIQNRTVS 531          

HSP 2 Score: 65.4698 bits (158), Expect = 8.448e-11
Identity = 56/212 (26.42%), Postives = 95/212 (44.81%), Query Frame = 2
Query: 1370 RVALVGPNGAGKSTLLKLIASEL-----EPTDGLIRRHS--------HCRIGR--YHQHLTEILDLNSSPMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFAWLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGRVADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARRALIER 1960
            R  L+G NG+GKS L K I   L       T G++             C +G+      + +  D+    ++   K      E   + K L   G T  +    + +LS G R +I  A +    P +LLLDEPTN LD  TI  L+  + E++  L  +SHD   +  VA ++    + TV  +    Y +  +  +E+++++ R+ + E+
Sbjct:   73 RYGLIGSNGSGKSILFKAIQMGLFDFPDNYTIGIVEEECLADGTKVVECFVGKDEVEDFMVKFADVKGRAVNKKNKDV----EVPRLVKILDGMGFTVEKMNDHVGNLSGGWRMKISLATVLMAEPDLLLLDEPTNMLDDRTIKWLSGFLKEWKTNLFFISHDGGFLSNVATDLLSIENKTVVHYACKYYEWLRN--QELDRDNVRKQIEEQ 278          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCF25.306e-1166.01ATP binding cassette subfamily F member 2 [Source:... [more]
ABCF25.016e-1166.01ATP binding cassette subfamily F member 2 [Source:... [more]
ABCF37.952e-14240.52ATP binding cassette subfamily F member 3 [Source:... [more]
ABCF31.076e-14140.52ATP binding cassette subfamily F member 3 [Source:... [more]
ABCF14.305e-11939.16ATP binding cassette subfamily F member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf-20.000e+061.91ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
abcf-20.000e+061.91ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
abcf-11.792e-13438.16ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
abcf-34.305e-12337.48ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
abcf-34.305e-12337.48ABC transporter, class F [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG92810.000e+066.67gene:FBgn0030672 transcript:FBtr0340308[more]
CG92810.000e+066.67gene:FBgn0030672 transcript:FBtr0074057[more]
CG92810.000e+066.67gene:FBgn0030672 transcript:FBtr0074056[more]
CG93308.161e-13841.34gene:FBgn0036888 transcript:FBtr0074940[more]
CG17031.071e-13338.95gene:FBgn0030321 transcript:FBtr0343647[more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf2a0.000e+067.76ATP-binding cassette, sub-family F (GCN20), member... [more]
abcf2a0.000e+067.76ATP-binding cassette, sub-family F (GCN20), member... [more]
abcf2b0.000e+065.06ATP-binding cassette, sub-family F (GCN20), member... [more]
abcf11.798e-11739.08ATP-binding cassette, sub-family F (GCN20), member... [more]
abcf13.200e-11739.08ATP-binding cassette, sub-family F (GCN20), member... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
matn12.064e-14040.77matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
matn11.315e-13038.25matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
matn11.167e-12938.25matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
matn12.009e-12938.25matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
matn12.804e-12938.25matrilin 1 [Source:Xenbase;Acc:XB-GENE-957559][more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcf24.548e-1064.51ATP-binding cassette, sub-family F (GCN20), member... [more]
Abcf31.270e-14240.33ATP-binding cassette, sub-family F (GCN20), member... [more]
Abcf12.696e-11337.93ATP-binding cassette, sub-family F (GCN20), member... [more]
Abcf39.410e-9738.42ATP-binding cassette, sub-family F (GCN20), member... [more]
Abcf35.240e-3533.18ATP-binding cassette, sub-family F (GCN20), member... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99LE6|ABCF2_MOUSE3.181e-964.51ATP-binding cassette sub-family F member 2 OS=Mus ... [more]
sp|Q9UG63|ABCF2_HUMAN2.409e-1066.01ATP-binding cassette sub-family F member 2 OS=Homo... [more]
sp|Q2KJA2|ABCF2_BOVIN7.654e-863.31ATP-binding cassette sub-family F member 2 OS=Bos ... [more]
sp|Q9FJH6|AB1F_ARATH0.000e+062.38ABC transporter F family member 1 OS=Arabidopsis t... [more]
sp|Q8T6B7|ABCF2_DICDI0.000e+054.28ABC transporter F family member 2 OS=Dictyostelium... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EW450.000e+071.36Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FTW60.000e+071.36Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DII70.000e+071.36Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8J3260.000e+071.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FV710.000e+071.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf2b1.017e-965.10ATP-binding cassette sub-family F member 2 [Source... [more]
abcf2a0.000e+065.49ATP-binding cassette sub-family F member 2 [Source... [more]
abcf31.506e-13640.98ATP binding cassette subfamily F member 3 [Source:... [more]
abcf15.357e-11738.79ATP binding cassette subfamily F member 1 [Source:... [more]
abcf35.830e-9834.79ATP binding cassette subfamily F member 3 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf2a0.000e+064.97ATP-binding cassette, sub-family F (GCN20), member... [more]
ENSPMAT00000007174.13.273e-4744.95pep scaffold:Pmarinus_7.0:GL490431:841:5388:1 gene... [more]
ENSPMAT00000007172.16.321e-4744.44pep scaffold:Pmarinus_7.0:GL490431:841:5397:1 gene... [more]
ENSPMAT00000005077.16.414e-2450.53pep scaffold:Pmarinus_7.0:GL479589:38272:41290:-1 ... [more]
ENSPMAT00000009626.11.601e-2333.54pep scaffold:Pmarinus_7.0:GL487706:825:5638:1 gene... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARB10.000e+049.12ATPase of the ATP-binding cassette (ABC) family; i... [more]
GCN201.261e-13739.32Positive regulator of the Gcn2p kinase activity; f... [more]
NEW11.862e-4431.68ATP binding cassette protein; cosediments with pol... [more]
YEF33.206e-4028.99Translation elongation factor 3; contains two ABC ... [more]
HEF31.541e-3726.11Translational elongation factor EF-3; member of th... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375420.000e+065.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363172.367e-14440.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347868.806e-13538.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259283.678e-1729.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286321.571e-1550.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcf2b0.000e+065.01ATP binding cassette subfamily F member 2 [Source:... [more]
abcf2b0.000e+065.01ATP binding cassette subfamily F member 2 [Source:... [more]
abcf2b0.000e+062.66ATP binding cassette subfamily F member 2 [Source:... [more]
abcf37.303e-13740.29ATP binding cassette subfamily F member 3 [Source:... [more]
abcf16.157e-11839.63ATP binding cassette subfamily F member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family F member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071613.10.000e+099.84SMESG000071613.1[more]
SMESG000035959.11.398e-13738.98SMESG000035959.1[more]
SMESG000041811.12.613e-12636.85SMESG000041811.1[more]
SMESG000049901.19.167e-7629.24SMESG000049901.1[more]
SMESG000049863.11.376e-7529.24SMESG000049863.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029770 ID=SMED30029770|Name=ATP-binding cassette sub-family F member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2011bp
TGTTTAAGTCACTTTTAAATTTTGAAAATCAATGCCCTCTGATAATAAAC
GTGCAAAAGCAGCTGCTAAGAAAAATAATGCCAAGAAACGTCCAAATGGT
GTTGCCAAAAAGGAAGTTGAGGTTGTAAATGAAGTTGAAAAAAAAGTTTT
AGTAAACGGAGATGCTAAAGATCATAAACATACAAAACATGAATTGGATG
ATGAATTTATGGGTAGTGAAGATGAAGAAGATTCAAAAATGGCCGAATTA
ATAAACGAAATCGAAAGTTTAAATTTATGCAGTGAGAAAGTTTCCCAGTA
TAGAAGTGTTACTGGTGTTTTATCCTCCCACAGAGAATCAAGAGACGTTC
ATTTTTCAAACGTTTGTATCACCTTTCATGGCCAAGAAATTTTACTTGAC
ACAACGTTGGAATTAAATAATGGTCGACGATATGGATTTATTGGACCTAA
TGGCTGTGGAAAATCTAGTCTATTCGCTGTTTTGGCCAATACTGAACTTC
CCGTACCATCTCACATTGATCATTATTTATTGCAACGAGAAATGCCACCA
TCAGACAAAACCGCATTACAAGCCGTAATGGAAGCTGATGAAGAAAAGAT
GAGATTAGAGAAAGAAGCTGAGTATTTAGCTTTACAAGATGATACTGAAT
CTCAGGATCGACTTGTCGAAGTTTACGAAAGATTAGATGATTTGGACGCA
GAAAGAGCTGAAAAACGAGCTGCTGAAATTTTGTTTGGTTTAGGATTTAC
TAAGGATATGCAGCAAAAAGAAGTTAAGCATTTTAGCGGTGGTTGGAGAA
TGAGAATTTCATTAGCAAGGTGTTTATTCGTTAAACCTGCGCTTTTGATG
TTAGACGAGCCTACTAACCATCTTGATTTGAATGCCTGTGTTTGGTTGGA
AAAAGAACTGAGTCAGTACAGTCGTATTTTAATTATTATTTCCCACTCTG
AAGATTTCCTTAATGGTGTATGCACAAATATTATTCACATGCAACATAAA
AAATTGGTTTATTACAACGGAAACTATGATCAGTATATAAGAACTAAAAT
GGAAAGTGAAGAGAATCAAATGAAAAAATATAAATGGGAACAGGATCAGA
TGGCACATATGAAAGATTATATTGCACGTTTTGGTCACGGTAGTCGGAAA
TTAGCAAGACAAGCTCAGAGTAAAGAAAAGACATTAAAGAAAATGGTTGA
TAGTGGTTTGACTCAAAAAGTTTCACGAGATAAAGGTTTAGTATTTTCAT
TTCCAAGCTGTGGAGAAATCCCCCCGCCTGTGATACAGATTCAAAATGTC
AGTTTCAGATATCATGAAAATAAGCCTTTAATTTATGACAACATTGATTT
CGGAATTGATTTGGATACTCGGGTCGCTCTCGTCGGACCAAATGGGGCTG
GGAAATCAACTTTGTTGAAATTGATTGCATCAGAACTTGAACCGACTGAC
GGTTTAATCAGGCGTCATTCTCACTGTAGAATCGGTAGATATCATCAACA
TCTCACGGAAATTCTCGATTTGAATAGTTCACCGATGGATTGGATGATGA
AATCTTTCCCTAATATAAAAGAGAGAGACGAAATGAGAAAAAAACTTGGT
CGGTATGGTTTGACTGGGGCTCAACAGATCTGTCCAATCAAATCTTTGTC
CGATGGCCAACGTTGTAGAATTATATTTGCCTGGTTAGCTGAAACTTGTC
CCCATATGTTGCTTCTTGACGAACCGACAAATCATTTGGATTTGGAAACG
ATTGATTCTCTTGCAGACGCCATTAATGAATTCGAAGGAGGTCTGCTGCT
TGTTAGTCACGATTTCCGACTGATTGGTCGCGTTGCTGATGAAATCTGGG
TCTGCAATCATGGAACCGTAACCAAATGGGACGGAGATATTTACAGTTAC
AAGGCTTCCCTGATTAAGGAAATTGAACAAGAGCACGCTCGTCGTGCATT
GATTGAGCGATAAGGAGGAGCATTGAAAATTTTATTAATAAAAAACTTGA
TAGAAAAAAAA
back to top

protein sequence of SMED30029770-orf-1

>SMED30029770-orf-1 ID=SMED30029770-orf-1|Name=SMED30029770-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=644bp
MPSDNKRAKAAAKKNNAKKRPNGVAKKEVEVVNEVEKKVLVNGDAKDHKH
TKHELDDEFMGSEDEEDSKMAELINEIESLNLCSEKVSQYRSVTGVLSSH
RESRDVHFSNVCITFHGQEILLDTTLELNNGRRYGFIGPNGCGKSSLFAV
LANTELPVPSHIDHYLLQREMPPSDKTALQAVMEADEEKMRLEKEAEYLA
LQDDTESQDRLVEVYERLDDLDAERAEKRAAEILFGLGFTKDMQQKEVKH
FSGGWRMRISLARCLFVKPALLMLDEPTNHLDLNACVWLEKELSQYSRIL
IIISHSEDFLNGVCTNIIHMQHKKLVYYNGNYDQYIRTKMESEENQMKKY
KWEQDQMAHMKDYIARFGHGSRKLARQAQSKEKTLKKMVDSGLTQKVSRD
KGLVFSFPSCGEIPPPVIQIQNVSFRYHENKPLIYDNIDFGIDLDTRVAL
VGPNGAGKSTLLKLIASELEPTDGLIRRHSHCRIGRYHQHLTEILDLNSS
PMDWMMKSFPNIKERDEMRKKLGRYGLTGAQQICPIKSLSDGQRCRIIFA
WLAETCPHMLLLDEPTNHLDLETIDSLADAINEFEGGLLLVSHDFRLIGR
VADEIWVCNHGTVTKWDGDIYSYKASLIKEIEQEHARRALIER*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003593AAA+_ATPase
IPR003439ABC_transporter-like
IPR027417P-loop_NTPase
IPR032781ABC_tran_Xtn
IPR017871ABC_transporter_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 182..202
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 105..372
e-value: 5.1E-52
score: 179.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 380..641
e-value: 5.1E-48
score: 165.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availablePANTHERPTHR19211ATP-BINDING TRANSPORT PROTEIN-RELATEDcoord: 4..635
NoneNo IPR availablePANTHERPTHR19211:SF15ATP-BINDING CASSETTE SUB-FAMILY F MEMBER 2coord: 4..635
NoneNo IPR availableCDDcd03221ABCF_EF-3coord: 418..612
e-value: 4.27323E-51
score: 171.478
NoneNo IPR availableCDDcd03221ABCF_EF-3coord: 106..324
e-value: 1.03368E-39
score: 140.276
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 444..612
e-value: 2.7E-10
score: 50.2
coord: 130..326
e-value: 0.0027
score: 26.9
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 435..567
e-value: 1.0E-19
score: 71.4
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 123..279
e-value: 5.8E-22
score: 78.7
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 106..347
score: 15.106
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 418..635
score: 14.479
IPR032781ABC-transporter extension domainPFAMPF12848ABC_tran_Xtncoord: 318..390
e-value: 3.9E-20
score: 71.7
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 251..265
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 405..616
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 103..349