histone H1

Overview
Namehistone H1 (AGS78024.1)
Smed IDSMED30029763
Length (bp)827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of histone H1 (SMED30029763) t-SNE clustered cells

Violin plots show distribution of expression levels for histone H1 (SMED30029763) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of histone H1 (SMED30029763) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for histone H1 (SMED30029763) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029763

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30029763SMESG000024348.1 SMESG000010800.1 SmedASXL_006919SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029763SMESG000024348.1 SMESG000010800.1 Contig42256uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029763SMESG000024348.1 SMESG000010800.1 Contig42256newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029763SMESG000043404.1 SMESG000024348.1 SMESG000010800.1 Contig20491newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029763SMESG000043404.1 SMESG000024348.1 SMESG000010800.1 Contig20491uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v6_601_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30029763SMESG000024348.1 SMESG000010800.1 dd_Smed_v4_601_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029763SMESG000024348.1 SMESG000010800.1 KC916779smed_ncbi_20200123PMID:24903754
Rouhana et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
chromatoid bodySMED30029763SMESG000024348.1 SMESG000010800.1 KC916779smed_ncbi_20200123PMID:24903754
Rouhana et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of histone H1 vs. Ensembl Human
Match: H1-8 (H1.8 linker histone [Source:HGNC Symbol;Acc:HGNC:18463])

HSP 1 Score: 55.8398 bits (133), Expect = 2.077e-8
Identity = 27/76 (35.53%), Postives = 50/76 (65.79%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIR-VGNKGKGASGSFKL 352
            HPP + M+  A+++ + R G S+  IK +I   Y  +++ ++   L++AL+ G+ +G+L R + +K +GA+GSFKL
Sbjct:   52 HPPVLRMVLEALQAGEQRRGTSVAAIKLYILHKYPTVDVLRFKYLLKQALATGMRRGLLARPLNSKARGATGSFKL 127          
BLAST of histone H1 vs. Ensembl Human
Match: HP1BP3 (heterochromatin protein 1 binding protein 3 [Source:HGNC Symbol;Acc:HGNC:24973])

HSP 1 Score: 50.8322 bits (120), Expect = 7.459e-7
Identity = 29/72 (40.28%), Postives = 47/72 (65.28%), Query Frame = 2
Query:  137 PAMDMI-KAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSF 346
            P MD I   AIK+   ++G S++ I+K+I   Y ++ +++ G  L++AL   + +GV+ +V  KGKGASGSF
Sbjct:  121 PKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQV--KGKGASGSF 190          
BLAST of histone H1 vs. Ensembl Human
Match: HP1BP3 (heterochromatin protein 1 binding protein 3 [Source:HGNC Symbol;Acc:HGNC:24973])

HSP 1 Score: 50.8322 bits (120), Expect = 1.477e-6
Identity = 29/72 (40.28%), Postives = 47/72 (65.28%), Query Frame = 2
Query:  137 PAMDMI-KAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSF 346
            P MD I   AIK+   ++G S++ I+K+I   Y ++ +++ G  L++AL   + +GV+ +V  KGKGASGSF
Sbjct:  159 PKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQV--KGKGASGSF 228          
BLAST of histone H1 vs. Ensembl Human
Match: HP1BP3 (heterochromatin protein 1 binding protein 3 [Source:HGNC Symbol;Acc:HGNC:24973])

HSP 1 Score: 50.8322 bits (120), Expect = 1.477e-6
Identity = 29/72 (40.28%), Postives = 47/72 (65.28%), Query Frame = 2
Query:  137 PAMDMI-KAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSF 346
            P MD I   AIK+   ++G S++ I+K+I   Y ++ +++ G  L++AL   + +GV+ +V  KGKGASGSF
Sbjct:  159 PKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQV--KGKGASGSF 228          
BLAST of histone H1 vs. Ensembl Human
Match: HP1BP3 (heterochromatin protein 1 binding protein 3 [Source:HGNC Symbol;Acc:HGNC:24973])

HSP 1 Score: 50.0618 bits (118), Expect = 1.901e-6
Identity = 29/72 (40.28%), Postives = 47/72 (65.28%), Query Frame = 2
Query:  137 PAMDMI-KAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSF 346
            P MD I   AIK+   ++G S++ I+K+I   Y ++ +++ G  L++AL   + +GV+ +V  KGKGASGSF
Sbjct:    7 PKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQV--KGKGASGSF 76          
BLAST of histone H1 vs. Ensembl Celegans
Match: his-24 (Histone H1.1 [Source:UniProtKB/Swiss-Prot;Acc:P10771])

HSP 1 Score: 60.4622 bits (145), Expect = 7.653e-11
Identity = 34/77 (44.16%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNI--NIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLP 355
            HPP ++MIK AIK  +DR G S   I KFI QNY +  N+ +    LR+AL  GV    L++    G GA+G F++P
Sbjct:   38 HPPYINMIKEAIKQLKDRKGASKQAILKFISQNYKLGDNVIQINAHLRQALKRGVTSKALVQAA--GSGANGRFRVP 112          
BLAST of histone H1 vs. Ensembl Celegans
Match: hil-2 (Histone H1.2 [Source:UniProtKB/Swiss-Prot;Acc:P15796])

HSP 1 Score: 56.9954 bits (136), Expect = 1.270e-9
Identity = 35/84 (41.67%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNI--NIDKYGPFLRRALSHGVEKGVLIR-VGNKGKGASGSFKLPSKKDAS 373
            HPP ++M+ AAI S ++R G S I I K+I  NY +   + K    LR AL+ GV    L++ VGN   GASG F++  K  A+
Sbjct:   38 HPPFINMVTAAISSLKERKGSSKIAILKYITANYKVGDQLTKINSRLRAALNKGVASKALVQSVGN---GASGRFRVAEKAAAT 118          
BLAST of histone H1 vs. Ensembl Celegans
Match: hil-6 (Putative histone H1.6 [Source:UniProtKB/Swiss-Prot;Acc:O16277])

HSP 1 Score: 55.0694 bits (131), Expect = 5.256e-9
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNI--NIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKDAS 373
            HPP ++M+ AAI S ++R G S I I K+I  NY +   + K    LR AL  GV    L++    G GA+G F++  K  A+
Sbjct:   35 HPPFINMVTAAISSLKERKGSSKIAILKYITANYKLGDQVKKINSNLRSALKKGVASKALVQ--TVGTGATGRFRVAEKTAAT 115          
BLAST of histone H1 vs. Ensembl Celegans
Match: hil-1 (Histone H1.X [Source:UniProtKB/Swiss-Prot;Acc:Q18336])

HSP 1 Score: 54.6842 bits (130), Expect = 1.039e-8
Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNI--NIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            +HP  MDMIK AI++  + TG S   I K+I QNY++  N+ K    LR  L   V+ G + +   +G GA+GSF++
Sbjct:   36 HHPSYMDMIKGAIQAIDNGTGSSKAAILKYIAQNYHVGENLPKVNNHLRSVLKKAVDSGDIEQT--RGHGATGSFRM 110          
BLAST of histone H1 vs. Ensembl Celegans
Match: hil-3 (Histone H1.3 [Source:UniProtKB/Swiss-Prot;Acc:Q19743])

HSP 1 Score: 53.9138 bits (128), Expect = 1.450e-8
Identity = 31/76 (40.79%), Postives = 45/76 (59.21%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNI--NIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            HPP ++M+ AAI   ++R G S I I K+I +NYN+   I K    LR  L+ GV    L++  + G GASG F++
Sbjct:   38 HPPYINMVTAAINGLKERKGSSKIAILKYITKNYNVGDQIIKINARLRDTLNKGVVSKALVQ--SVGTGASGRFRV 111          
BLAST of histone H1 vs. Ensembl Fly
Match: His1:CG33807 (gene:FBgn0053807 transcript:FBtr0091811)

HSP 1 Score: 78.9518 bits (193), Expect = 5.627e-17
Identity = 37/77 (48.05%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  122 TPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            TP+HPP   M+ A+IK+ ++R G SL+ IKK+I   Y  +  K  PF+++ L   V  G LI+   KGKGASGSFKL
Sbjct:   43 TPSHPPTQQMVDASIKNLEERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQ--TKGKGASGSFKL 117          
BLAST of histone H1 vs. Ensembl Fly
Match: His1:CG33804 (gene:FBgn0053804 transcript:FBtr0091808)

HSP 1 Score: 78.1814 bits (191), Expect = 9.760e-17
Identity = 37/77 (48.05%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  122 TPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            TP+HPP   M+ A+IK+ ++R G SL+ IKK+I   Y  +  K  PF+++ L   V  G LI+   KGKGASGSFKL
Sbjct:   43 TPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQ--TKGKGASGSFKL 117          
BLAST of histone H1 vs. Ensembl Fly
Match: His1:CG31617 (gene:FBgn0051617 transcript:FBtr0085892)

HSP 1 Score: 78.1814 bits (191), Expect = 9.760e-17
Identity = 37/77 (48.05%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  122 TPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            TP+HPP   M+ A+IK+ ++R G SL+ IKK+I   Y  +  K  PF+++ L   V  G LI+   KGKGASGSFKL
Sbjct:   43 TPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQ--TKGKGASGSFKL 117          
BLAST of histone H1 vs. Ensembl Fly
Match: His1:CG33846 (gene:FBgn0053846 transcript:FBtr0091850)

HSP 1 Score: 78.1814 bits (191), Expect = 9.760e-17
Identity = 37/77 (48.05%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  122 TPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            TP+HPP   M+ A+IK+ ++R G SL+ IKK+I   Y  +  K  PF+++ L   V  G LI+   KGKGASGSFKL
Sbjct:   43 TPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQ--TKGKGASGSFKL 117          
BLAST of histone H1 vs. Ensembl Fly
Match: His1:CG33843 (gene:FBgn0053843 transcript:FBtr0091847)

HSP 1 Score: 78.1814 bits (191), Expect = 9.760e-17
Identity = 37/77 (48.05%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  122 TPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            TP+HPP   M+ A+IK+ ++R G SL+ IKK+I   Y  +  K  PF+++ L   V  G LI+   KGKGASGSFKL
Sbjct:   43 TPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQ--TKGKGASGSFKL 117          
BLAST of histone H1 vs. Ensembl Zebrafish
Match: h1m (linker histone H1M [Source:ZFIN;Acc:ZDB-GENE-030131-5614])

HSP 1 Score: 55.4546 bits (132), Expect = 1.381e-8
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINID----KYGPFLRRALSHGVEKGVLIRVGNKGK--GASGSFKL 352
            HP  M+M+K A+K    R G+S   I+ +I++ Y   +D    KY   +RRAL+ G++ GV +R  N G   GA G F++
Sbjct:   45 HPSTMEMVKEALKELDSRKGVSAQAIRGYIKEKY-TTVDETRLKY--MVRRALNKGMDTGVFVRPANSGSTTGAQGRFRI 121          
BLAST of histone H1 vs. Ensembl Xenopus
Match: h1-8 (H1.8 linker histone [Source:NCBI gene;Acc:549145])

HSP 1 Score: 51.6026 bits (122), Expect = 3.848e-7
Identity = 28/79 (35.44%), Postives = 48/79 (60.76%), Query Frame = 2
Query:  122 TPNHPPAMDMIKAAIKSSQDRTGMSLILIK-KFIQQNYNINIDKYGPFLRRALSHGVEKGVLIR-VGNKGKGASGSFKL 352
            T +HPP + M+  A+K + +R G S+  I+ + +  +  ++  +    LR AL+ G+EKG+LIR + +   GA+G FKL
Sbjct:   35 TQSHPPTLAMVVEALKKNTERKGTSVQAIRTRILAAHPTVDPLRLKFLLRTALNKGLEKGILIRPLNSSATGATGRFKL 113          
BLAST of histone H1 vs. Ensembl Xenopus
Match: h1-8 (H1.8 linker histone [Source:NCBI gene;Acc:549145])

HSP 1 Score: 51.6026 bits (122), Expect = 5.185e-7
Identity = 28/79 (35.44%), Postives = 48/79 (60.76%), Query Frame = 2
Query:  122 TPNHPPAMDMIKAAIKSSQDRTGMSLILIK-KFIQQNYNINIDKYGPFLRRALSHGVEKGVLIR-VGNKGKGASGSFKL 352
            T +HPP + M+  A+K + +R G S+  I+ + +  +  ++  +    LR AL+ G+EKG+LIR + +   GA+G FKL
Sbjct:   90 TQSHPPTLAMVVEALKKNTERKGTSVQAIRTRILAAHPTVDPLRLKFLLRTALNKGLEKGILIRPLNSSATGATGRFKL 168          
BLAST of histone H1 vs. Ensembl Mouse
Match: H1f8 (H1.8 linker histone [Source:MGI Symbol;Acc:MGI:2176207])

HSP 1 Score: 56.9954 bits (136), Expect = 5.725e-9
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVG-NKGKGASGSFKL 352
            +P  + M+  A+K+ + R G S++ IK +IQ  Y  ++  ++   L++AL  GV +G+L R   +K KGA+GSFKL
Sbjct:   46 NPTMLHMVLEALKAREARQGTSVVAIKVYIQHKYPTVDTTRFKYLLKQALETGVRRGLLTRPAHSKAKGATGSFKL 121          
BLAST of histone H1 vs. Ensembl Mouse
Match: H1f8 (H1.8 linker histone [Source:MGI Symbol;Acc:MGI:2176207])

HSP 1 Score: 56.225 bits (134), Expect = 6.565e-9
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVG-NKGKGASGSFKL 352
            +P  + M+  A+K+ + R G S++ IK +IQ  Y  ++  ++   L++AL  GV +G+L R   +K KGA+GSFKL
Sbjct:   46 NPTMLHMVLEALKAREARQGTSVVAIKVYIQHKYPTVDTTRFKYLLKQALETGVRRGLLTRPAHSKAKGATGSFKL 121          
BLAST of histone H1 vs. Ensembl Mouse
Match: H1f8 (H1.8 linker histone [Source:MGI Symbol;Acc:MGI:2176207])

HSP 1 Score: 56.225 bits (134), Expect = 7.328e-9
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVG-NKGKGASGSFKL 352
            +P  + M+  A+K+ + R G S++ IK +IQ  Y  ++  ++   L++AL  GV +G+L R   +K KGA+GSFKL
Sbjct:   46 NPTMLHMVLEALKAREARQGTSVVAIKVYIQHKYPTVDTTRFKYLLKQALETGVRRGLLTRPAHSKAKGATGSFKL 121          
BLAST of histone H1 vs. Ensembl Mouse
Match: Hp1bp3 (heterochromatin protein 1, binding protein 3 [Source:MGI Symbol;Acc:MGI:109369])

HSP 1 Score: 53.5286 bits (127), Expect = 3.615e-8
Identity = 31/72 (43.06%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  137 PAMDMI-KAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSF 346
            P MD I   AIK+S  +TG S++ I+K+I   Y ++ +++ G  L++AL   + +GV+ +V  KGKGASGSF
Sbjct:  123 PKMDAILTEAIKASFQKTGASVVAIRKYIIHKYPSLGLERRGYLLKQALKRELNRGVIRQV--KGKGASGSF 192          
BLAST of histone H1 vs. Ensembl Mouse
Match: Hp1bp3 (heterochromatin protein 1, binding protein 3 [Source:MGI Symbol;Acc:MGI:109369])

HSP 1 Score: 53.1434 bits (126), Expect = 1.442e-7
Identity = 31/72 (43.06%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  137 PAMDMI-KAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSF 346
            P MD I   AIK+S  +TG S++ I+K+I   Y ++ +++ G  L++AL   + +GV+ +V  KGKGASGSF
Sbjct:  123 PKMDAILTEAIKASFQKTGASVVAIRKYIIHKYPSLGLERRGYLLKQALKRELNRGVIRQV--KGKGASGSF 192          
BLAST of histone H1 vs. UniProt/SwissProt
Match: sp|P07796|H1G_STRPU (Histone H1-gamma, late OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 8.984e-19
Identity = 41/81 (50.62%), Postives = 55/81 (67.90%), Query Frame = 2
Query:  125 PNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKD 367
            P HPP+  M+ AA+ + ++R G S   IKK+I  NY +++ K GPF+RRAL  GV  G L++   KGKGASGSFKL  KK+
Sbjct:   16 PAHPPSSQMVVAAVTALKERGGSSTQAIKKYIAANYTVDMTKQGPFIRRALVKGVASGALVQ--TKGKGASGSFKLGKKKE 94          
BLAST of histone H1 vs. UniProt/SwissProt
Match: sp|P15869|H1B_STRPU (Histone H1-beta, late embryonic OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.078e-17
Identity = 41/81 (50.62%), Postives = 58/81 (71.60%), Query Frame = 2
Query:  125 PNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKD 367
            P HP + +M+ AAI + ++R G S   I+K+I++NY ++I K   F++RAL  GVEKG L++V  KGKGASGSFKL  KK+
Sbjct:   16 PAHPSSSEMVLAAITALKERGGSSAQAIRKYIEKNYTVDIKKQAIFIKRALITGVEKGTLVQV--KGKGASGSFKLGKKKE 94          
BLAST of histone H1 vs. UniProt/SwissProt
Match: sp|P19375|H1E_STRPU (Histone H1, early embryonic OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.283e-17
Identity = 38/74 (51.35%), Postives = 52/74 (70.27%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            HPPA +M+  AI   +DR G SL  IKK+I  N+++ +D+   F++RAL  GVEKG L++   KGKGASGSFK+
Sbjct:   18 HPPAAEMVATAITELKDRNGSSLQAIKKYIATNFDVQMDRQLLFIKRALKSGVEKGKLVQT--KGKGASGSFKV 89          
BLAST of histone H1 vs. UniProt/SwissProt
Match: sp|P21895|H1_CHITH (Histone H1 OS=Chironomus thummi thummi OX=7155 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.338e-16
Identity = 39/77 (50.65%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPS 358
             HPP  DMI  AIK+ ++R G S+  IKKF+   Y ++ DK  PF+++ L   VEKG L++   KGKGASGSFKLP+
Sbjct:   38 THPPVSDMIVNAIKTLKERGGSSVQAIKKFLVAQYKVDTDKLSPFIKKYLKSAVEKGQLLQ--TKGKGASGSFKLPA 112          
BLAST of histone H1 vs. UniProt/SwissProt
Match: sp|P40278|H1E_CHITE (Histone H1E OS=Chironomus tentans OX=7153 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.558e-16
Identity = 37/77 (48.05%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  125 PNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLP 355
            P HPP  +M+  AI + ++R G SLI IKKF+   Y ++++K  PF+++ L   V KG L++   KGKGASGSFKLP
Sbjct:   49 PTHPPVSEMVVNAITTLKERGGSSLIAIKKFVAAQYKVDVEKLVPFIKKFLKASVAKGTLLQA--KGKGASGSFKLP 123          
BLAST of histone H1 vs. TrEMBL
Match: S5VL05 (Histone H1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.992e-63
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 2
Query:  122 TPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKDASKTDSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQAEKRKSITPKKVVKVDAHKS 634
            TPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKDASKTDSLEKVSKKPAPKKLIKKPMKKTEKKVVAKKPIKKVEKKAEEKKDEKVDKVDDKKVVKKSPVKRQAEKRKSITPKKVVKVDAHKS
Sbjct:   23 TPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKDASKTDSLEKVSKKPAPKKLIKKPMKKTEKKVVAKKPIKKVEKKAEEKKDEKVDKVDDKKVVKKSPVKRQAEKRKSITPKKVVKVDAHKS 193          
BLAST of histone H1 vs. TrEMBL
Match: A0A4S2L4U2 (H15 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009888 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.102e-26
Identity = 48/79 (60.76%), Postives = 63/79 (79.75%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKK 364
            NHPP +DM+KA+I +++DR G SL  IKKFI  NY ++++K GP +RR + H VEKG+L+RVGNKGKGASGSFK+  KK
Sbjct:   24 NHPPVIDMVKASINAAKDRKGTSLPTIKKFIAANYKVDVEKLGPHIRRGIVHAVEKGILVRVGNKGKGASGSFKVAEKK 102          
BLAST of histone H1 vs. TrEMBL
Match: A0A1S8WTV8 (Linker histone H1 and H5 family protein OS=Opisthorchis viverrini OX=6198 GN=X801_06323 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 6.469e-26
Identity = 48/79 (60.76%), Postives = 63/79 (79.75%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKK 364
            NHPP +DM+KA+I +++DR G SL  IKKFI  NY ++++K GP +RR + H VEKG+L+RVGNKGKGASGSFK+  KK
Sbjct:   24 NHPPVIDMVKASINAAKDRKGTSLPTIKKFIAANYKVDVEKLGPHIRRGIVHAVEKGILVRVGNKGKGASGSFKVAEKK 102          
BLAST of histone H1 vs. TrEMBL
Match: A0A504YH67 (Histone deacetylase OS=Fasciola gigantica OX=46835 GN=FGIG_05707 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.794e-25
Identity = 49/78 (62.82%), Postives = 61/78 (78.21%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSK 361
             HPP +DM+KAAI +++DR G SL  IKKFI  NY ++++K GP +RR + H VEKGVL+RVGNKGKGASGSFKL  K
Sbjct:   22 THPPVIDMVKAAITAAKDRKGTSLPSIKKFIAANYKVDVEKLGPHIRRGIVHAVEKGVLVRVGNKGKGASGSFKLGEK 99          
BLAST of histone H1 vs. TrEMBL
Match: A0A2H1BWU2 (Histone deacetylase OS=Fasciola hepatica OX=6192 GN=D915_009817 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.794e-25
Identity = 49/78 (62.82%), Postives = 61/78 (78.21%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSK 361
             HPP +DM+KAAI +++DR G SL  IKKFI  NY ++++K GP +RR + H VEKGVL+RVGNKGKGASGSFKL  K
Sbjct:   22 THPPVIDMVKAAITAAKDRKGTSLPSIKKFIAANYKVDVEKLGPHIRRGIVHAVEKGVLVRVGNKGKGASGSFKLGEK 99          
BLAST of histone H1 vs. Ensembl Cavefish
Match: ENSAMXT00000009754.2 (protein B4 [Source:NCBI gene;Acc:103022710])

HSP 1 Score: 52.7582 bits (125), Expect = 9.919e-8
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  125 PNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNY-NINIDKYGPFLRRALSHGVEKGVLIRVG-NKGKGASGSFKL 352
            P HP  MDM+K A+     R G+S   I+ FI++ +  ++  +    +R+AL+ G+E G L+R   +   GA G F+L
Sbjct:   45 PTHPSTMDMLKEALMELDSRKGVSAQAIRTFIKEKHPTVDETRLKLMVRKALAKGLESGALVRPAKSTSTGAQGRFRL 122          
BLAST of histone H1 vs. Ensembl Cavefish
Match: h1-0 (histone H1.0-B [Source:NCBI gene;Acc:103026561])

HSP 1 Score: 46.9802 bits (110), Expect = 5.768e-6
Identity = 31/75 (41.33%), Postives = 42/75 (56.00%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLP 355
            HP   DMIKAAI + + R G S   I+K+++ +Y +  D     ++ AL   V  G+L     KG GASGSFKL 
Sbjct:   24 HPKYSDMIKAAIVADKSRGGASRQSIQKYVKSHYKVG-DNADSQIKLALKRLVASGLLRH--TKGIGASGSFKLA 95          
BLAST of histone H1 vs. Ensembl Nematostella
Match: EDO35464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLB2])

HSP 1 Score: 55.0694 bits (131), Expect = 2.947e-10
Identity = 33/75 (44.00%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
             HP   +MI AAI S +DR G S   I+K+I+ NY +  +  G  L+ AL   V  G +++   KG GASGSFKL
Sbjct:    5 EHPKYSEMIAAAISSLKDRNGSSRQAIEKYIKANYKVG-ESVGVHLKMALKRAVAGGSILQ--TKGVGASGSFKL 76          
BLAST of histone H1 vs. Ensembl Nematostella
Match: EDO48286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJM2])

HSP 1 Score: 52.373 bits (124), Expect = 1.783e-8
Identity = 33/74 (44.59%), Postives = 44/74 (59.46%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            HP   DM+ AAI + ++R G S   I+K+I+ NY +  D  G  L+ AL    +KG L+    KG GASGSFKL
Sbjct:   19 HPKYSDMVVAAIGALKERNGSSRQAIEKYIKGNYKVG-DGVGVHLKLALKRMSDKGKLVH--TKGVGASGSFKL 89          
BLAST of histone H1 vs. Ensembl Nematostella
Match: EDO37223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGC7])

HSP 1 Score: 49.2914 bits (116), Expect = 4.705e-8
Identity = 29/74 (39.19%), Postives = 43/74 (58.11%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL 352
            HP    M++ AIK   +R G S   I K++Q N+++  D     ++ +L  GV+ G L+R    G+GASGSFKL
Sbjct:    1 HPKYNFMVEEAIKRLHERGGSSRQKIVKYVQANFDVG-DNSEKLVKASLKKGVDSGRLVRT--SGQGASGSFKL 71          
BLAST of histone H1 vs. Ensembl Nematostella
Match: EDO36730 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHX6])

HSP 1 Score: 46.9802 bits (110), Expect = 2.258e-7
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGA 334
             HP   +M+ AAI + ++R G S   I+K+I+ NY +  DK G  L+ AL    EKG L+    KG GA
Sbjct:    7 EHPKYTEMVAAAIGALKERGGSSRQAIEKYIKANYKVG-DKVGAQLKMALKRMSEKGALVH--TKGTGA 72          
BLAST of histone H1 vs. Ensembl Nematostella
Match: EDO27655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHX9])

HSP 1 Score: 46.595 bits (109), Expect = 2.372e-7
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = 2
Query:  128 NHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGA 334
             HP   +M+ AAI + ++R G S   I+K+I+ NY +  DK G  L+ AL    EKG L+    KG GA
Sbjct:    7 EHPKYTEMVAAAIGALKERGGSSRQAIEKYIKANYKVG-DKVGTQLKMALKRMSEKGALVH--TKGTGA 72          
BLAST of histone H1 vs. Ensembl Medaka
Match: h1-0 (histone H1.0-B [Source:NCBI gene;Acc:101162715])

HSP 1 Score: 48.9062 bits (115), Expect = 1.190e-6
Identity = 32/79 (40.51%), Postives = 44/79 (55.70%), Query Frame = 2
Query:  131 HPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKD 367
            HP   DMIKAAI     R+G S   I+K++++NY +  D     ++ AL   V  G+L     KG GASGSF+L   +D
Sbjct:   23 HPKYSDMIKAAIVHDASRSGASRQSIQKYVRKNYKVG-DNADVQIKMALKRLVASGMLRH--TKGIGASGSFRLTKPED 98          
BLAST of histone H1 vs. Planmine SMEST
Match: SMESG000024348.1 (SMESG000024348.1)

HSP 1 Score: 209.534 bits (532), Expect = 1.784e-67
Identity = 196/196 (100.00%), Postives = 196/196 (100.00%), Query Frame = 2
Query:   47 MSDIXXXXXXXXXXXXXXXXXXXXXTPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKDASKTDSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQAEKRKSITPKKVVKVDAHKS 634
            MSDIKPKADVKPKSDAKSKPAKAKSTPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKDASKTDSLEKVSKKPAPKKLIKKPMKKTEKKVVAKKPIKKVEKKAEEKKDEKVDKVDDKKVVKKSPVKRQAEKRKSITPKKVVKVDAHKS
Sbjct:    1 MSDIKPKADVKPKSDAKSKPAKAKSTPNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKDASKTDSLEKVSKKPAPKKLIKKPMKKTEKKVVAKKPIKKVEKKAEEKKDEKVDKVDDKKVVKKSPVKRQAEKRKSITPKKVVKVDAHKS 196          
BLAST of histone H1 vs. Planmine SMEST
Match: SMESG000018415.1 (SMESG000018415.1)

HSP 1 Score: 103.99 bits (258), Expect = 9.050e-27
Identity = 47/88 (53.41%), Postives = 69/88 (78.41%), Query Frame = 2
Query:  125 PNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKLPSKKDASKTDSL 388
            P+HPPA+DM+K+AI +++ R G+SL LIKK++   + I+I+KYGPFLRR++  GVEKG+L+R+GN  KG+SGSFKL      SK +++
Sbjct:   19 PSHPPAIDMVKSAILAAKSRKGLSLSLIKKYLIDTHKIDIEKYGPFLRRSIVAGVEKGILVRMGN-SKGSSGSFKLAPADKVSKKETI 105          
BLAST of histone H1 vs. Planmine SMEST
Match: SMESG000018375.1 (SMESG000018375.1)

HSP 1 Score: 105.916 bits (263), Expect = 1.811e-25
Identity = 51/86 (59.30%), Postives = 69/86 (80.23%), Query Frame = 2
Query:  125 PNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL-PSKKDASKT 379
            P+HPPA+DM+KAAI++++ R G+SL +IKK++ + + I+I KYGPFLRRA++  VEKG+LIR GN  KGASGSFKL P  K +SK 
Sbjct:   15 PSHPPAIDMVKAAIEAAKSRKGLSLSMIKKYLSETHKIDIAKYGPFLRRAITAAVEKGILIRTGN-AKGASGSFKLAPILKSSSKV 99          
BLAST of histone H1 vs. Planmine SMEST
Match: SMESG000018375.1 (SMESG000018375.1)

HSP 1 Score: 105.531 bits (262), Expect = 2.083e-25
Identity = 51/86 (59.30%), Postives = 69/86 (80.23%), Query Frame = 2
Query:  125 PNHPPAMDMIKAAIKSSQDRTGMSLILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSFKL-PSKKDASKT 379
            P+HPPA+DM+KAAI++++ R G+SL +IKK++ + + I+I KYGPFLRRA++  VEKG+LIR GN  KGASGSFKL P  K +SK 
Sbjct:   15 PSHPPAIDMVKAAIEAAKSRKGLSLSMIKKYLSETHKIDIAKYGPFLRRAITAAVEKGILIRTGN-AKGASGSFKLAPILKSSSKV 99          
The following BLAST results are available for this feature:
BLAST of histone H1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H1-82.077e-835.53H1.8 linker histone [Source:HGNC Symbol;Acc:HGNC:1... [more]
HP1BP37.459e-740.28heterochromatin protein 1 binding protein 3 [Sourc... [more]
HP1BP31.477e-640.28heterochromatin protein 1 binding protein 3 [Sourc... [more]
HP1BP31.477e-640.28heterochromatin protein 1 binding protein 3 [Sourc... [more]
HP1BP31.901e-640.28heterochromatin protein 1 binding protein 3 [Sourc... [more]
back to top
BLAST of histone H1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-247.653e-1144.16Histone H1.1 [Source:UniProtKB/Swiss-Prot;Acc:P10... [more]
hil-21.270e-941.67Histone H1.2 [Source:UniProtKB/Swiss-Prot;Acc:P15... [more]
hil-65.256e-938.55Putative histone H1.6 [Source:UniProtKB/Swiss-Pro... [more]
hil-11.039e-840.26Histone H1.X [Source:UniProtKB/Swiss-Prot;Acc:Q18... [more]
hil-31.450e-840.79Histone H1.3 [Source:UniProtKB/Swiss-Prot;Acc:Q19... [more]
back to top
BLAST of histone H1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His1:CG338075.627e-1748.05gene:FBgn0053807 transcript:FBtr0091811[more]
His1:CG338049.760e-1748.05gene:FBgn0053804 transcript:FBtr0091808[more]
His1:CG316179.760e-1748.05gene:FBgn0051617 transcript:FBtr0085892[more]
His1:CG338469.760e-1748.05gene:FBgn0053846 transcript:FBtr0091850[more]
His1:CG338439.760e-1748.05gene:FBgn0053843 transcript:FBtr0091847[more]
back to top
BLAST of histone H1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
h1m1.381e-837.50linker histone H1M [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
back to top
BLAST of histone H1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
h1-83.848e-735.44H1.8 linker histone [Source:NCBI gene;Acc:549145][more]
h1-85.185e-735.44H1.8 linker histone [Source:NCBI gene;Acc:549145][more]
back to top
BLAST of histone H1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H1f85.725e-938.16H1.8 linker histone [Source:MGI Symbol;Acc:MGI:217... [more]
H1f86.565e-938.16H1.8 linker histone [Source:MGI Symbol;Acc:MGI:217... [more]
H1f87.328e-938.16H1.8 linker histone [Source:MGI Symbol;Acc:MGI:217... [more]
Hp1bp33.615e-843.06heterochromatin protein 1, binding protein 3 [Sour... [more]
Hp1bp31.442e-743.06heterochromatin protein 1, binding protein 3 [Sour... [more]
back to top
BLAST of histone H1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P07796|H1G_STRPU8.984e-1950.62Histone H1-gamma, late OS=Strongylocentrotus purpu... [more]
sp|P15869|H1B_STRPU1.078e-1750.62Histone H1-beta, late embryonic OS=Strongylocentro... [more]
sp|P19375|H1E_STRPU5.283e-1751.35Histone H1, early embryonic OS=Strongylocentrotus ... [more]
sp|P21895|H1_CHITH1.338e-1650.65Histone H1 OS=Chironomus thummi thummi OX=7155 PE=... [more]
sp|P40278|H1E_CHITE2.558e-1648.05Histone H1E OS=Chironomus tentans OX=7153 PE=3 SV=... [more]
back to top
BLAST of histone H1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5VL051.992e-63100.00Histone H1 (Fragment) OS=Schmidtea mediterranea OX... [more]
A0A4S2L4U22.102e-2660.76H15 domain-containing protein OS=Opisthorchis feli... [more]
A0A1S8WTV86.469e-2660.76Linker histone H1 and H5 family protein OS=Opistho... [more]
A0A504YH672.794e-2562.82Histone deacetylase OS=Fasciola gigantica OX=46835... [more]
A0A2H1BWU22.794e-2562.82Histone deacetylase OS=Fasciola hepatica OX=6192 G... [more]
back to top
BLAST of histone H1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000009754.29.919e-834.62protein B4 [Source:NCBI gene;Acc:103022710][more]
h1-05.768e-641.33histone H1.0-B [Source:NCBI gene;Acc:103026561][more]
back to top
BLAST of histone H1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone H1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of histone H1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354642.947e-1044.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482861.783e-844.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372234.705e-839.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367302.258e-740.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276552.372e-740.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of histone H1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
h1-01.190e-640.51histone H1.0-B [Source:NCBI gene;Acc:101162715][more]
back to top
BLAST of histone H1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000024348.11.784e-67100.00SMESG000024348.1[more]
SMESG000018415.19.050e-2753.41SMESG000018415.1[more]
SMESG000018375.11.811e-2559.30SMESG000018375.1[more]
SMESG000018375.12.083e-2559.30SMESG000018375.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029763
GenBankAGS78024.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029763 ID=SMED30029763|Name=histone H1|organism=Schmidtea mediterranea sexual|type=transcript|length=827bp
GAAATATAAAATTAAATCAACATAATTTTGCTTTATTTATAACATTATGA
GTGATATAAAGCCAAAAGCAGATGTGAAACCGAAGAGTGATGCAAAATCG
AAGCCTGCGAAAGCAAAATCAACACCGAATCATCCTCCAGCTATGGATAT
GATCAAAGCAGCGATTAAATCAAGCCAGGATCGCACAGGGATGTCGTTGA
TTTTAATTAAAAAATTTATTCAACAAAATTATAACATCAATATCGATAAG
TACGGTCCGTTTTTGCGTCGTGCGCTTAGTCATGGAGTTGAGAAAGGAGT
TTTGATTCGCGTTGGCAACAAAGGAAAAGGTGCTTCAGGAAGCTTTAAGC
TGCCATCTAAGAAGGATGCCAGCAAAACAGATTCACTTGAAAAGGTCTCA
AAGAAGCCAGCACCAAAAAAGCTGATAAAGAAACCTATGAAGAAAACAGA
GAAAAAAGTTGTTGCTAAAAAGCCTATTAAGAAAGTCGAAAAGAAGGCAG
AAGAGAAGAAAGACGAGAAAGTTGATAAAGTCGATGATAAGAAAGTAGTT
AAGAAGTCGCCTGTAAAAAGACAAGCCGAAAAAAGAAAATCGATAACACC
GAAAAAAGTTGTTAAGGTTGATGCACATAAATCCAAAATTGCTAAAGCTA
AAGCAACTCCAAAAAAGGTTGCTCCGAAAAAAACTCCGAAAAAAGCGCCT
GTTAAAGCAAAGAAGTAAATTTTATAATTGAGAATGCTAACGGCCCTCTT
TAGGGCCACATATGTTGATTGTGCTGTAAATGTTGTACATAAATGTAAAT
ATATTTCATGGTTTAATAAAGATTGGC
back to top

protein sequence of SMED30029763-orf-1

>SMED30029763-orf-1 ID=SMED30029763-orf-1|Name=SMED30029763-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=224bp
MSDIKPKADVKPKSDAKSKPAKAKSTPNHPPAMDMIKAAIKSSQDRTGMS
LILIKKFIQQNYNINIDKYGPFLRRALSHGVEKGVLIRVGNKGKGASGSF
KLPSKKDASKTDSLEKVSKKPAPKKLIKKPMKKTEKKVVAKKPIKKVEKK
AEEKKDEKVDKVDDKKVVKKSPVKRQAEKRKSITPKKVVKVDAHKSKIAK
AKATPKKVAPKKTPKKAPVKAKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0000786nucleosome
GO:0005634nucleus
GO:0005694chromosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000429neoblast
PLANA:0002020chromatoid body
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR005819Histone_H5
IPR005818Histone_H1/H5_H15
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0006334nucleosome assembly
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 144..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..121
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 92..223
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 141..199
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..33
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 122..140
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 200..223
NoneNo IPR availablePANTHERPTHR11467HISTONE H1coord: 12..222
NoneNo IPR availablePANTHERPTHR11467:SF112HISTONE H5coord: 12..222
IPR005819Histone H5PRINTSPR00624HISTONEH5coord: 15..36
score: 24.75
coord: 119..133
score: 35.56
coord: 177..196
score: 25.56
coord: 86..110
score: 39.11
IPR005818Linker histone H1/H5, domain H15SMARTSM00526h15plus2coord: 26..92
e-value: 2.5E-23
score: 93.5
IPR005818Linker histone H1/H5, domain H15PFAMPF00538Linker_histonecoord: 29..102
e-value: 6.9E-25
score: 87.2
IPR005818Linker histone H1/H5, domain H15PROSITEPS51504H15coord: 28..104
score: 26.981
IPR005818Linker histone H1/H5, domain H15CDDcd00073H15coord: 26..111
e-value: 1.56648E-19
score: 77.6615
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 21..108
e-value: 1.6E-26
score: 93.9
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 24..108