lhx1-5-1

Overview
Namelhx1-5-1 (AGS83409.1)
Smed IDSMED30029761
Length (bp)2556
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of lhx1-5-1 (SMED30029761) t-SNE clustered cells

Violin plots show distribution of expression levels for lhx1-5-1 (SMED30029761) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of lhx1-5-1 (SMED30029761) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for lhx1-5-1 (SMED30029761) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029761

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029761SMESG000043039.1 SMESG000016568.1 dd_Smed_v4_11521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029761SMESG000043039.1 SMESG000016568.1 dd_Smed_v4_11521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029761SMESG000043039.1 SMESG000016568.1 dd_Smed_v4_11521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029761SMESG000043039.1 SMESG000016568.1 dd_Smed_v4_11521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30029761SMESG000043039.1 SMESG000016568.1 dd_Smed_v4_11521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30029761SMESG000043039.1 SMESG000016568.1 KF134112.1smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
body wall musculatureSMED30029761SMESG000043039.1 SMESG000016568.1 dd_Smed_v4_11521_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory cellSMED30029761SMESG000043039.1 SMESG000016568.1 KF134112smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
ventral region of the whole animalSMED30029761SMESG000043039.1 SMESG000016568.1 KF134112smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30029761SMESG000043039.1 SMESG000016568.1 KF134112smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
cholinergic neuronSMED30029761SMESG000043039.1 SMESG000016568.1 KF134112smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
GABAergic neuronSMED30029761SMESG000043039.1 SMESG000016568.1 KF134112smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
serotonergic neuronSMED30029761SMESG000043039.1 SMESG000016568.1 KF134112smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of lhx1-5-1 vs. Ensembl Human
Match: LHX5 (LIM homeobox 5 [Source:HGNC Symbol;Acc:HGNC:14216])

HSP 1 Score: 145.206 bits (365), Expect = 6.208e-37
Identity = 74/190 (38.95%), Postives = 113/190 (59.47%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENF--NILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WH++C++C +C   LSE+CF R+GKL+C  D+ +R   KC+ C   I P+DLVR +R S VFHL CF C+VC+KQLSTG+E  +++  + VC++D+       S+ L +   +  +   + ++  +   + Q D     N++  D ETA NEN   N  TK   P   +K
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLS-----SSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIK 188          

HSP 2 Score: 139.428 bits (350), Expect = 6.454e-35
Identity = 65/71 (91.55%), Postives = 70/71 (98.59%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            NSGTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. Ensembl Human
Match: LHX1 (LIM homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6593])

HSP 1 Score: 140.198 bits (352), Expect = 3.699e-35
Identity = 70/190 (36.84%), Postives = 111/190 (58.42%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNEN--FNILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WHV+C++C +C   L+E+CF R+GKL+C  D+ +    KC+ C   I P+DLVR +R S VFHL CF C++C+KQLSTG+E  +++  + VC+ED+       S++  +N  H +   ++ ++  +    +Q D     + +  D E   NEN   N+  K   P   +K
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYL----SNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIK 188          

HSP 2 Score: 135.576 bits (340), Expect = 1.343e-33
Identity = 63/71 (88.73%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. Ensembl Human
Match: LHX1 (LIM homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6593])

HSP 1 Score: 140.198 bits (352), Expect = 3.699e-35
Identity = 70/190 (36.84%), Postives = 111/190 (58.42%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNEN--FNILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WHV+C++C +C   L+E+CF R+GKL+C  D+ +    KC+ C   I P+DLVR +R S VFHL CF C++C+KQLSTG+E  +++  + VC+ED+       S++  +N  H +   ++ ++  +    +Q D     + +  D E   NEN   N+  K   P   +K
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYL----SNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIK 188          

HSP 2 Score: 135.576 bits (340), Expect = 1.343e-33
Identity = 63/71 (88.73%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. Ensembl Human
Match: LHX4 (LIM homeobox 4 [Source:HGNC Symbol;Acc:HGNC:21734])

HSP 1 Score: 139.428 bits (350), Expect = 5.760e-35
Identity = 53/123 (43.09%), Postives = 87/123 (70.73%), Query Frame = 1
Query:  397 INPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +  +P C  C++ I+D+++  + D+ WH  CL+CADC + L++RCF R G ++C +D+ KR   KC+ C   I PT +VR ++D  V+HL CF C++C++QL+TGDE+ L+E+ R VC+ED++
Sbjct:   24 MQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQD-FVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYE 145          

HSP 2 Score: 102.064 bits (253), Expect = 2.053e-22
Identity = 48/92 (52.17%), Postives = 64/92 (69.57%), Query Frame = 1
Query: 1408 NGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
             G E    +D + VC  +     Q+ +S    + PRTTI AKQL+TLK A+  +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  126 TGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 217          
BLAST of lhx1-5-1 vs. Ensembl Human
Match: LHX3 (LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595])

HSP 1 Score: 135.191 bits (339), Expect = 1.532e-33
Identity = 55/120 (45.83%), Postives = 81/120 (67.50%), Query Frame = 1
Query:  406 VPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +P C  C + I+DR++    D+ WH +CL+C+DC  PL+ERCF R   ++C  D+ KR   KC+ C   I PT +VR ++D  V+HL CF CVVC +QL+TGDE+ L+E+ R VC+ D++
Sbjct:   17 IPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQD-FVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYE 135          

HSP 2 Score: 103.99 bits (258), Expect = 3.913e-23
Identity = 49/93 (52.69%), Postives = 65/93 (69.89%), Query Frame = 1
Query: 1405 GNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
              G E    +D + VC  +     Q     T +R PRTTI AKQL+TLK+A++ +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  115 ATGDEFYLMEDSRLVCKADYETAKQREAEATAKR-PRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 206          
BLAST of lhx1-5-1 vs. Ensembl Celegans
Match: lin-11 (pep chromosome:WBcel235:I:10248256:10255327:1 gene:WBGene00003000.1 transcript:ZC247.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-11)

HSP 1 Score: 127.102 bits (318), Expect = 4.258e-31
Identity = 55/121 (45.45%), Postives = 76/121 (62.81%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFK 777
            C +C++PI+DRY+  +  K WH  CLRC DC  P+S  CF RDG + C  D+ +R S +C+ C   +   DLVR +RD  VFH++CF C VC + L TGD+  ++E  R VC+ DFQ   K
Sbjct:   68 CAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMSMTCFSRDGLILCKTDFSRRYSQRCAGCDGKLEKEDLVRRARD-KVFHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDFQTATK 187          

HSP 2 Score: 122.479 bits (306), Expect = 1.514e-29
Identity = 65/111 (58.56%), Postives = 79/111 (71.17%), Query Frame = 1
Query: 1366 ECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            EC    EE +++     ++   DD +  C  ++ + + S     KRRGPRTTIKAKQL+TLK AF+ATPKPTRH+REQLA +TGL MRVIQVWFQNRRSKERRMKQL   G
Sbjct:  203 ECNSDVEEDNVD---ACDEVGLDDGEGDCGKDNSDDSNSA----KRRGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQNRRSKERRMKQLRFGG 306          
BLAST of lhx1-5-1 vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 102.064 bits (253), Expect = 1.384e-23
Identity = 72/175 (41.14%), Postives = 90/175 (51.43%), Query Frame = 1
Query: 1201 GIKGNPNESHPVDSQLLT--------PEQNEKLPRTSSSFDKEPELCSLEDDLK-----SSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQL 1686
            G   +P E   VD  ++T        P+ ++  P    S    P  CS E+ +       SFS+A        ++E D    N    SF D     C  +SR          KRRGPRTTIK  QLD L   FS TPKP++H R +LA +TGL+MRVIQVWFQNRRSKERR+K L
Sbjct:   79 GRHLSPGEQILVDDTMMTVSCMSHYPPQMDDNAPGAIGSAVDIPS-CSTENPIAPYPIDESFSSAFQ-----VKKEVDAYGYNFEHYSFSD----FCDDDSRM--------LKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRSKERRLKHL 235          

HSP 2 Score: 71.2478 bits (173), Expect = 3.132e-13
Identity = 30/82 (36.59%), Postives = 53/82 (64.63%), Query Frame = 1
Query:  475 WHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSA-KCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDE 717
            +H  C++C  C+ PL+E+CF ++G+++CS+ Y K  S  +C+ C   + PTD+V   +   VFH++C  C +C + LS G++
Sbjct:    6 YHENCVKCTICESPLAEKCFWKNGRIYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQ 87          
BLAST of lhx1-5-1 vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 102.449 bits (254), Expect = 1.816e-23
Identity = 72/175 (41.14%), Postives = 90/175 (51.43%), Query Frame = 1
Query: 1201 GIKGNPNESHPVDSQLLT--------PEQNEKLPRTSSSFDKEPELCSLEDDLK-----SSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQL 1686
            G   +P E   VD  ++T        P+ ++  P    S    P  CS E+ +       SFS+A   +     +E D    N    SF D     C  +SR          KRRGPRTTIK  QLD L   FS TPKP++H R +LA +TGL+MRVIQVWFQNRRSKERR+K L
Sbjct:  122 GRHLSPGEQILVDDTMMTVSCMSHYPPQMDDNAPGAIGSAVDIPS-CSTENPIAPYPIDESFSSAFQVK-----KEVDAYGYNFEHYSFSD----FCDDDSR--------MLKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRSKERRLKHL 278          

HSP 2 Score: 85.8853 bits (211), Expect = 6.696e-18
Identity = 36/102 (35.29%), Postives = 65/102 (63.73%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSA-KCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDE 717
            C  C+  I DRY++ + ++ +H  C++C  C+ PL+E+CF ++G+++CS+ Y K  S  +C+ C   + PTD+V   +   VFH++C  C +C + LS G++
Sbjct:   29 CNCCNEQIYDRYIYRMDNRSYHENCVKCTICESPLAEKCFWKNGRIYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQ 130          
BLAST of lhx1-5-1 vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 102.064 bits (253), Expect = 1.842e-23
Identity = 72/175 (41.14%), Postives = 90/175 (51.43%), Query Frame = 1
Query: 1201 GIKGNPNESHPVDSQLLT--------PEQNEKLPRTSSSFDKEPELCSLEDDLK-----SSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQL 1686
            G   +P E   VD  ++T        P+ ++  P    S    P  CS E+ +       SFS+A        ++E D    N    SF D     C  +SR          KRRGPRTTIK  QLD L   FS TPKP++H R +LA +TGL+MRVIQVWFQNRRSKERR+K L
Sbjct:  105 GRHLSPGEQILVDDTMMTVSCMSHYPPQMDDNAPGAIGSAVDIPS-CSTENPIAPYPIDESFSSAFQ-----VKKEVDAYGYNFEHYSFSD----FCDDDSR--------MLKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRSKERRLKHL 261          

HSP 2 Score: 71.633 bits (174), Expect = 3.392e-13
Identity = 30/82 (36.59%), Postives = 53/82 (64.63%), Query Frame = 1
Query:  475 WHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSA-KCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDE 717
            +H  C++C  C+ PL+E+CF ++G+++CS+ Y K  S  +C+ C   + PTD+V   +   VFH++C  C +C + LS G++
Sbjct:   32 YHENCVKCTICESPLAEKCFWKNGRIYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQ 113          
BLAST of lhx1-5-1 vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 98.5969 bits (244), Expect = 5.921e-22
Identity = 49/135 (36.30%), Postives = 75/135 (55.56%), Query Frame = 1
Query:  406 VPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCK 810
            +  CT C   I D++  +I  + +H  CL+C+ C+ PLS +CF +D   +C   Y + +  KC+ C   I  TD VR +R+  V+HL CF C  C +QLSTG+EY L E    +C++ F  + +  S +  Q  K
Sbjct:   95 IVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPLSNKCFYKDKTFYCKGCYFRELGPKCASCDRTIQATDWVRRARN-YVYHLACFSCNQCKRQLSTGEEYALQEG-NLLCKQHFLELVEGDSGVSSQKAK 227          

HSP 2 Score: 53.9138 bits (128), Expect = 2.490e-7
Identity = 30/78 (38.46%), Postives = 41/78 (52.56%), Query Frame = 1
Query: 1456 TESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLS 1689
             E   G  S  + TKR   RTT    QL  L+  F+    P     E++A  TGL+ RV QVWFQN R+++++  Q S
Sbjct:  215 VEGDSGVSSQKAKTKR--VRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKKWHQKS 290          
BLAST of lhx1-5-1 vs. Ensembl Fly
Match: Lim1 (gene:FBgn0026411 transcript:FBtr0071279)

HSP 1 Score: 132.109 bits (331), Expect = 4.130e-32
Identity = 52/116 (44.83%), Postives = 81/116 (69.83%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF 762
            C  C++PI+D++L N+ ++ WH  C+RC +C  PL+++CF R+ KL+C  D+ +R   KCS C   I P+DLVR  RD  VFHL CF C +C KQLSTG++  +L++ + +C++D+
Sbjct:   27 CAGCNKPILDKFLLNVLERAWHASCVRCCECLQPLTDKCFSRESKLYCRNDFFRRYGTKCSGCGQGIAPSDLVRKPRD-KVFHLNCFTCCICRKQLSTGEQLYVLDDNKFICKDDY 141          

HSP 2 Score: 123.635 bits (309), Expect = 3.183e-29
Identity = 55/69 (79.71%), Postives = 65/69 (94.20%), Query Frame = 1
Query: 1492 GTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            G+KRRGPRTTIKAKQL+ LK AF+ TPKPTRH+REQLA++TGL MRVIQVWFQN+RSKERRMKQ+++MG
Sbjct:  244 GSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRMKQITSMG 312          
BLAST of lhx1-5-1 vs. Ensembl Fly
Match: Lim1 (gene:FBgn0026411 transcript:FBtr0331732)

HSP 1 Score: 125.946 bits (315), Expect = 4.315e-31
Identity = 55/69 (79.71%), Postives = 65/69 (94.20%), Query Frame = 1
Query: 1492 GTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            G+KRRGPRTTIKAKQL+ LK AF+ TPKPTRH+REQLA++TGL MRVIQVWFQN+RSKERRMKQ+++MG
Sbjct:   86 GSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRMKQITSMG 154          
BLAST of lhx1-5-1 vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0081169)

HSP 1 Score: 128.257 bits (321), Expect = 8.587e-31
Identity = 56/149 (37.58%), Postives = 97/149 (65.10%), Query Frame = 1
Query:  328 NHLL---NSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            NHL    + P P +L  ++ + N+     +P C  C   I+DR++  + ++ WH +CL+C++C   L+++CF R+G+LFC +D+ KR   KCS C   I PT +VR ++D +V+HL+CF C +C + L+TGDE+ L+E+ + +C+ D++
Sbjct:   91 NHLAVDQDDPNP-ELVLALISRNRALEATIPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQD-NVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYE 237          

HSP 2 Score: 104.375 bits (259), Expect = 5.583e-23
Identity = 52/100 (52.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query: 1411 GSEQSFQDDQQSVCHTESRE---------GAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
            G E    +D++ +C  +  E         G+  G+   KR  PRTTI AKQL+TLK A++ +PKP RHVREQL+QDTGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  219 GDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKR--PRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK 316          
BLAST of lhx1-5-1 vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309832)

HSP 1 Score: 128.257 bits (321), Expect = 8.587e-31
Identity = 56/149 (37.58%), Postives = 97/149 (65.10%), Query Frame = 1
Query:  328 NHLL---NSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            NHL    + P P +L  ++ + N+     +P C  C   I+DR++  + ++ WH +CL+C++C   L+++CF R+G+LFC +D+ KR   KCS C   I PT +VR ++D +V+HL+CF C +C + L+TGDE+ L+E+ + +C+ D++
Sbjct:   91 NHLAVDQDDPNP-ELVLALISRNRALEATIPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQD-NVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYE 237          

HSP 2 Score: 104.375 bits (259), Expect = 5.583e-23
Identity = 52/100 (52.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query: 1411 GSEQSFQDDQQSVCHTESRE---------GAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
            G E    +D++ +C  +  E         G+  G+   KR  PRTTI AKQL+TLK A++ +PKP RHVREQL+QDTGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  219 GDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKR--PRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK 316          
BLAST of lhx1-5-1 vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309833)

HSP 1 Score: 128.257 bits (321), Expect = 8.587e-31
Identity = 56/149 (37.58%), Postives = 97/149 (65.10%), Query Frame = 1
Query:  328 NHLL---NSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            NHL    + P P +L  ++ + N+     +P C  C   I+DR++  + ++ WH +CL+C++C   L+++CF R+G+LFC +D+ KR   KCS C   I PT +VR ++D +V+HL+CF C +C + L+TGDE+ L+E+ + +C+ D++
Sbjct:   91 NHLAVDQDDPNP-ELVLALISRNRALEATIPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQD-NVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYE 237          

HSP 2 Score: 104.375 bits (259), Expect = 5.583e-23
Identity = 52/100 (52.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query: 1411 GSEQSFQDDQQSVCHTESRE---------GAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
            G E    +D++ +C  +  E         G+  G+   KR  PRTTI AKQL+TLK A++ +PKP RHVREQL+QDTGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  219 GDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKR--PRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKK 316          
BLAST of lhx1-5-1 vs. Ensembl Zebrafish
Match: lhx5 (LIM homeobox 5 [Source:NCBI gene;Acc:30465])

HSP 1 Score: 142.124 bits (357), Expect = 4.919e-36
Identity = 68/161 (42.24%), Postives = 100/161 (62.11%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF--QHIFKE-------------MSNILPQNCKHDSNKINNETIKDE 852
            C  C RPI+DR+L N+ D+ WH +C++C +C+  L+E+CF RDGKL+C  D+ +R   KC+ CL  I P+DLVR +R S VFHL CF C+VC+KQLSTG+E  +++  + VC+ED+      KE             +S  LP   + D+ + +N T  D+
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHAKCVQCCECNCNLTEKCFSRDGKLYCKIDFFRRFGTKCAGCLQGISPSDLVRRAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKEDYLSASAIKEVNLNSVSSCTDRSLSPDLPDQIQDDTKETDNSTSSDK 164          

HSP 2 Score: 132.494 bits (332), Expect = 9.068e-33
Identity = 63/70 (90.00%), Postives = 67/70 (95.71%), Query Frame = 1
Query: 1489 SGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            S TKRRGPRTTIKAKQL+TLKAAF ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  176 SCTKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. Ensembl Zebrafish
Match: lhx1b (LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-116])

HSP 1 Score: 140.198 bits (352), Expect = 2.006e-35
Identity = 56/116 (48.28%), Postives = 83/116 (71.55%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF 762
            C  C RPI+DR+L ++ D+ WH +C++C DC   L++RCF R+G+L+C  D+ +R   KC  C   I P+DLVR +R S VFHL CF C++C+KQLSTG+E  +L+ ++ VC+ED+
Sbjct:    4 CAGCERPILDRFLLSVLDRAWHAKCVQCCDCKCSLTDRCFSREGRLYCKNDFFRRYGTKCGGCAQGISPSDLVRKAR-SKVFHLNCFTCIMCNKQLSTGEELYILDEYKFVCKEDY 118          

HSP 2 Score: 137.502 bits (345), Expect = 1.851e-34
Identity = 86/151 (56.95%), Postives = 102/151 (67.55%), Query Frame = 1
Query: 1375 IKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMNNPNFHGYFGD 1827
            +  E QD  D     +S     +  C+ E+ E     N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+GARR  F  + R     R  G D M P   ++M N +F  ++GD
Sbjct:  140 LSPESQDPQDDYKDSESGPMSDKETCNNENDEQ----NLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHMFFRSPRRM---RALG-DRMEP--GELMANGHF-SFYGD 279          
BLAST of lhx1-5-1 vs. Ensembl Zebrafish
Match: lhx1b (LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-116])

HSP 1 Score: 140.198 bits (352), Expect = 2.006e-35
Identity = 56/116 (48.28%), Postives = 83/116 (71.55%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF 762
            C  C RPI+DR+L ++ D+ WH +C++C DC   L++RCF R+G+L+C  D+ +R   KC  C   I P+DLVR +R S VFHL CF C++C+KQLSTG+E  +L+ ++ VC+ED+
Sbjct:    4 CAGCERPILDRFLLSVLDRAWHAKCVQCCDCKCSLTDRCFSREGRLYCKNDFFRRYGTKCGGCAQGISPSDLVRKAR-SKVFHLNCFTCIMCNKQLSTGEELYILDEYKFVCKEDY 118          

HSP 2 Score: 137.502 bits (345), Expect = 1.851e-34
Identity = 86/151 (56.95%), Postives = 102/151 (67.55%), Query Frame = 1
Query: 1375 IKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMNNPNFHGYFGD 1827
            +  E QD  D     +S     +  C+ E+ E     N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+GARR  F  + R     R  G D M P   ++M N +F  ++GD
Sbjct:  140 LSPESQDPQDDYKDSESGPMSDKETCNNENDEQ----NLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHMFFRSPRRM---RALG-DRMEP--GELMANGHF-SFYGD 279          
BLAST of lhx1-5-1 vs. Ensembl Zebrafish
Match: lhx4 (LIM homeobox 4 [Source:ZFIN;Acc:ZDB-GENE-060728-1])

HSP 1 Score: 137.887 bits (346), Expect = 1.126e-34
Identity = 54/123 (43.90%), Postives = 86/123 (69.92%), Query Frame = 1
Query:  397 INPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +  +P C  CS+ I+D+++  + D+ WH +CL+CADC   L+++CF R G ++C +D+ KR   KC+ C   I PT +VR ++D  V+HL CF CV+C +QL+TGDE+ L+E+ R VC+ED++
Sbjct:   27 LQQIPQCAGCSQHILDKFILKVLDRHWHSKCLKCADCHALLADKCFSRAGNVYCKEDFFKRFGTKCASCQQGIPPTQVVRKAQD-FVYHLHCFACVMCSRQLATGDEFYLMEDGRLVCKEDYE 148          

HSP 2 Score: 105.531 bits (262), Expect = 8.553e-24
Identity = 49/92 (53.26%), Postives = 66/92 (71.74%), Query Frame = 1
Query: 1408 NGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
             G E    +D + VC  +     Q+ +S T  + PRTTI AKQL+TLK+A+  +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  129 TGDEFYLMEDGRLVCKEDYETAKQNDDSETGAKRPRTTITAKQLETLKSAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 220          
BLAST of lhx1-5-1 vs. Ensembl Zebrafish
Match: lhx1a (LIM homeobox 1a [Source:NCBI gene;Acc:30463])

HSP 1 Score: 137.887 bits (346), Expect = 1.667e-34
Identity = 77/197 (39.09%), Postives = 115/197 (58.38%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMI-------LSNTSKPDLETARNEN--FNILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WH++C++C +C   L+E+CF R+GKL+C  D+ +R   KC+ C   I P DLVR +R S VFHL CF C++C+KQLSTG+E  +++  + VC++D+      +SN    N K DSN ++     D  L  + +D +        ++N S  D ET  NEN   N+  K   P   +K
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPNDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKDDY------LSNT---NGK-DSNLLSVTACSDPSLSPDSQDQLQDDVKDAEIANLS--DKETGNNENDDQNLGGKRRGPRTTIK 187          

HSP 2 Score: 134.806 bits (338), Expect = 1.681e-33
Identity = 63/71 (88.73%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  174 NLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 244          
BLAST of lhx1-5-1 vs. Ensembl Xenopus
Match: klf2 (Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-485035])

HSP 1 Score: 140.584 bits (353), Expect = 2.677e-35
Identity = 79/193 (40.93%), Postives = 115/193 (59.59%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHI--FKEMSNILPQNCKHDSNKIN-NETIKDEPLISNQKDLMILSNTSKPDLETARNENF--NILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WHV+C++C +C   L+E+CF R+GKL+C  D+ +R   KC+ C   I P+DLVR +R+  VFHL CF C+VC+KQLSTG+E  +++  + VC+ED+      KE S     +C   S   +  + I+DE   S + D     +++  D ETA NEN   N  TK   P   +K
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKTDFFRRFGTKCAGCSLGISPSDLVRKARN-KVFHLNCFTCMVCNKQLSTGEELYIIDENKFVCKEDYASASSLKESSLNSVSSCTDRSLSPDLQDPIQDE---SKETD-----HSTSSDKETANNENEEQNSGTKRRGPRTTIK 188          

HSP 2 Score: 140.198 bits (352), Expect = 3.420e-35
Identity = 71/97 (73.20%), Postives = 81/97 (83.51%), Query Frame = 1
Query: 1426 FQDDQQSVCHTES--REGA----QSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
             QD+ +   H+ S  +E A    +  NSGTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  149 IQDESKETDHSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 139.043 bits (349), Expect = 9.079e-35
Identity = 57/116 (49.14%), Postives = 84/116 (72.41%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF 762
            C  C RPI+DR+L N+ D+ WHV+C++C +C   L+E+CF R+GKL+C  D+ +R   KC+ C   I P+DLVR +R S VFHL CF C++C+KQLSTG+E  +++  + VC+ED+
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDY 118          

HSP 2 Score: 135.576 bits (340), Expect = 1.397e-33
Identity = 72/123 (58.54%), Postives = 90/123 (73.17%), Query Frame = 1
Query: 1336 KSSFSAASSPECGIKEEEQD--LNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            ++SF + +  +  +  E QD   +D   SE +   D+++  +    +     N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  131 ENSFISVTGSDPSLSPESQDPLQDDAKDSESANISDKEAGVNENDDQ-----NLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 248          
BLAST of lhx1-5-1 vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 135.191 bits (339), Expect = 1.574e-33
Identity = 63/71 (88.73%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  171 NLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 241          

HSP 2 Score: 130.183 bits (326), Expect = 7.087e-32
Identity = 70/189 (37.04%), Postives = 109/189 (57.67%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDE-YCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WHV+C++C +C   L+E+CF R+GKL+C  D+ +R   KC+ C   I P+DLVR +R S VFHL CF C++C+KQLSTG+E Y + EN    C+  +      + +++  +C   S    ++    +PL  + KD    +N S  +     N++ N+  K   P   +K
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVYCKLFWAGPSSPLVSVI--DCSDPSLSPESQ----DPLQDDAKDSES-ANISDKEAGVNENDDQNLGAKRRGPRTTIK 184          
BLAST of lhx1-5-1 vs. Ensembl Xenopus
Match: clpb (ClpB homolog, mitochondrial AAA ATPase chaperonin [Source:Xenbase;Acc:XB-GENE-994913])

HSP 1 Score: 133.265 bits (334), Expect = 4.901e-33
Identity = 52/123 (42.28%), Postives = 85/123 (69.11%), Query Frame = 1
Query:  397 INPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +  +P C+ C+  I+D+++  + D+ WH  CL+C +C +PL+ERCF R G ++C +D+ K    KC+ C   I PT +VR ++D  V+HL CF C++C +QL+TGDE+ L+E+ R VC+ED++
Sbjct:   24 MQQIPRCSGCNEHILDKFILKVLDRHWHSACLKCCECQVPLAERCFYRAGNVYCKEDFFKCFGTKCTACQQGIPPTQVVRKAQD-FVYHLHCFSCIICSRQLATGDEFYLMEDGRLVCKEDYE 145          

HSP 2 Score: 102.449 bits (254), Expect = 1.019e-22
Identity = 48/93 (51.61%), Postives = 64/93 (68.82%), Query Frame = 1
Query: 1405 GNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
              G E    +D + VC  +     Q+ +S    + PRTTI AKQL+TLK A+  +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  125 ATGDEFYLMEDGRLVCKEDYETAKQNDDSEGGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 217          
BLAST of lhx1-5-1 vs. Ensembl Xenopus
Match: clpb (ClpB homolog, mitochondrial AAA ATPase chaperonin [Source:Xenbase;Acc:XB-GENE-994913])

HSP 1 Score: 133.265 bits (334), Expect = 5.408e-32
Identity = 55/130 (42.31%), Postives = 88/130 (67.69%), Query Frame = 1
Query:  376 NNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            N  NK  +  +P C+ C+  I+D+++  + D+ WH  CL+C +C +PL+ERCF R G ++C +D+ K    KC+ C   I PT +VR ++D  V+HL CF C++C +QL+TGDE+ L+E+ R VC+ED++
Sbjct:  178 NRVNKR-LAEIPRCSGCNEHILDKFILKVLDRHWHSACLKCCECQVPLAERCFYRAGNVYCKEDFFKCFGTKCTACQQGIPPTQVVRKAQD-FVYHLHCFSCIICSRQLATGDEFYLMEDGRLVCKEDYE 305          

HSP 2 Score: 103.219 bits (256), Expect = 2.517e-22
Identity = 48/93 (51.61%), Postives = 64/93 (68.82%), Query Frame = 1
Query: 1405 GNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
              G E    +D + VC  +     Q+ +S    + PRTTI AKQL+TLK A+  +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  285 ATGDEFYLMEDGRLVCKEDYETAKQNDDSEGGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 377          
BLAST of lhx1-5-1 vs. Ensembl Mouse
Match: Lhx5 (LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:107792])

HSP 1 Score: 144.436 bits (363), Expect = 9.343e-37
Identity = 74/190 (38.95%), Postives = 112/190 (58.95%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENF--NILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WH++C++C +C   LSE+CF R+GKL+C  D+ +R   KC+ C   I P+DLVR +R S VFHL CF C+VC+KQLSTG+E  +++  + VC++D+       S+ L +   +  +   + ++  +     Q D     N++  D ETA NEN   N  TK   P   +K
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLS-----SSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIK 188          

HSP 2 Score: 139.428 bits (350), Expect = 4.188e-35
Identity = 65/71 (91.55%), Postives = 70/71 (98.59%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            NSGTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. Ensembl Mouse
Match: Lhx1 (LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:99783])

HSP 1 Score: 138.658 bits (348), Expect = 1.510e-35
Identity = 63/71 (88.73%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:   84 NLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 154          
BLAST of lhx1-5-1 vs. Ensembl Mouse
Match: Lhx1 (LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:99783])

HSP 1 Score: 139.813 bits (351), Expect = 3.368e-35
Identity = 70/190 (36.84%), Postives = 111/190 (58.42%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNEN--FNILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WHV+C++C +C   L+E+CF R+GKL+C  D+ +    KC+ C   I P+DLVR +R S VFHL CF C++C+KQLSTG+E  +++  + VC+ED+       S++  +N  H +   ++ ++  +    +Q D     + +  D E   NEN   N+  K   P   +K
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYL----SNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKRRGPRTTIK 188          

HSP 2 Score: 135.576 bits (340), Expect = 9.305e-34
Identity = 63/71 (88.73%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. Ensembl Mouse
Match: Lhx4 (LIM homeobox protein 4 [Source:MGI Symbol;Acc:MGI:101776])

HSP 1 Score: 139.043 bits (349), Expect = 4.265e-35
Identity = 53/123 (43.09%), Postives = 87/123 (70.73%), Query Frame = 1
Query:  397 INPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +  +P C  C++ I+D+++  + D+ WH  CL+CADC + L++RCF R G ++C +D+ KR   KC+ C   I PT +VR ++D  V+HL CF C++C++QL+TGDE+ L+E+ R VC+ED++
Sbjct:   24 MQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQD-FVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYE 145          

HSP 2 Score: 102.064 bits (253), Expect = 1.423e-22
Identity = 48/92 (52.17%), Postives = 64/92 (69.57%), Query Frame = 1
Query: 1408 NGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
             G E    +D + VC  +     Q+ +S    + PRTTI AKQL+TLK A+  +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  126 TGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 217          
BLAST of lhx1-5-1 vs. Ensembl Mouse
Match: Lhx3 (LIM homeobox protein 3 [Source:MGI Symbol;Acc:MGI:102673])

HSP 1 Score: 135.961 bits (341), Expect = 6.060e-34
Identity = 55/120 (45.83%), Postives = 82/120 (68.33%), Query Frame = 1
Query:  406 VPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +P C  C + I+DR++    D+ WH +CL+C+DC +PL+ERCF R   ++C  D+ KR   KC+ C   I PT +VR ++D  V+HL CF CVVC +QL+TGDE+ L+E+ R VC+ D++
Sbjct:   33 IPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQD-FVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYE 151          

HSP 2 Score: 104.375 bits (259), Expect = 2.780e-23
Identity = 49/93 (52.69%), Postives = 65/93 (69.89%), Query Frame = 1
Query: 1405 GNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
              G E    +D + VC  +     Q     T +R PRTTI AKQL+TLK+A++ +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  131 ATGDEFYLMEDSRLVCKADYETAKQREAEATAKR-PRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 222          
BLAST of lhx1-5-1 vs. UniProt/SwissProt
Match: sp|Q9H2C1|LHX5_HUMAN (LIM/homeobox protein Lhx5 OS=Homo sapiens OX=9606 GN=LHX5 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.981e-36
Identity = 74/190 (38.95%), Postives = 113/190 (59.47%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENF--NILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WH++C++C +C   LSE+CF R+GKL+C  D+ +R   KC+ C   I P+DLVR +R S VFHL CF C+VC+KQLSTG+E  +++  + VC++D+       S+ L +   +  +   + ++  +   + Q D     N++  D ETA NEN   N  TK   P   +K
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLS-----SSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIK 188          

HSP 2 Score: 139.428 bits (350), Expect = 3.100e-34
Identity = 65/71 (91.55%), Postives = 70/71 (98.59%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            NSGTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. UniProt/SwissProt
Match: sp|P61376|LHX5_RAT (LIM/homeobox protein Lhx5 OS=Rattus norvegicus OX=10116 GN=Lhx5 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 6.535e-36
Identity = 74/190 (38.95%), Postives = 112/190 (58.95%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENF--NILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WH++C++C +C   LSE+CF R+GKL+C  D+ +R   KC+ C   I P+DLVR +R S VFHL CF C+VC+KQLSTG+E  +++  + VC++D+       S+ L +   +  +   + ++  +     Q D     N++  D ETA NEN   N  TK   P   +K
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLS-----SSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIK 188          

HSP 2 Score: 139.428 bits (350), Expect = 2.929e-34
Identity = 65/71 (91.55%), Postives = 70/71 (98.59%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            NSGTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. UniProt/SwissProt
Match: sp|P61375|LHX5_MOUSE (LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090 GN=Lhx5 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 6.535e-36
Identity = 74/190 (38.95%), Postives = 112/190 (58.95%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENF--NILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WH++C++C +C   LSE+CF R+GKL+C  D+ +R   KC+ C   I P+DLVR +R S VFHL CF C+VC+KQLSTG+E  +++  + VC++D+       S+ L +   +  +   + ++  +     Q D     N++  D ETA NEN   N  TK   P   +K
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLS-----SSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIK 188          

HSP 2 Score: 139.428 bits (350), Expect = 2.929e-34
Identity = 65/71 (91.55%), Postives = 70/71 (98.59%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            NSGTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. UniProt/SwissProt
Match: sp|P53411|LHX1_CHICK (LIM/homeobox protein Lhx1 OS=Gallus gallus OX=9031 GN=LHX1 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.774e-35
Identity = 72/190 (37.89%), Postives = 112/190 (58.95%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNEN--FNILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WHV+C++C +C   L+E+CF R+GKL+C  D+ +    KC+ C   I P+DLVR +R S VFHL CF C++C+KQLSTG+E  +++  + VC+ED+ +     SN   +N  H +   ++ ++  +    +Q D     + +  D ET  NEN   N+  K   P   +K
Sbjct:    4 CAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLN----NSNTAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKETGSNENDDQNLGAKRRGPRTTIK 188          

HSP 2 Score: 135.576 bits (340), Expect = 7.563e-33
Identity = 63/71 (88.73%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  175 NLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. UniProt/SwissProt
Match: sp|P52889|LHX5_DANRE (LIM/homeobox protein Lhx5 OS=Danio rerio OX=7955 GN=lhx5 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.713e-35
Identity = 68/161 (42.24%), Postives = 100/161 (62.11%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF--QHIFKE-------------MSNILPQNCKHDSNKINNETIKDE 852
            C  C RPI+DR+L N+ D+ WH +C++C +C+  L+E+CF RDGKL+C  D+ +R   KC+ CL  I P+DLVR +R S VFHL CF C+VC+KQLSTG+E  +++  + VC+ED+      KE             +S  LP   + D+ + +N T  D+
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHAKCVQCCECNCNLTEKCFSRDGKLYCKIDFFRRFGTKCAGCLQGISPSDLVRRAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKEDYLSASAIKEVNLNSVSSCTDRSLSPDLPDQIQDDTKETDNSTSSDK 164          

HSP 2 Score: 132.494 bits (332), Expect = 6.845e-32
Identity = 63/70 (90.00%), Postives = 67/70 (95.71%), Query Frame = 1
Query: 1489 SGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            S TKRRGPRTTIKAKQL+TLKAAF ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  176 SCTKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. TrEMBL
Match: S5WMY9 (Lhx1-5-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1250.34 bits (3234), Expect = 0.000e+0
Identity = 663/664 (99.85%), Postives = 663/664 (99.85%), Query Frame = 1
Query:  301 MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQXXXXXXXXXXXXXXXXXXXXXXERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTXXXXXXXXXXXXXXXXVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW 2292
            MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKI NETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW
Sbjct:    1 MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKITNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW 664          
BLAST of lhx1-5-1 vs. TrEMBL
Match: A0A3R7GSZ8 (LIM/homeobox protein Lhx5 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Lhx5 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.536e-37
Identity = 99/179 (55.31%), Postives = 122/179 (68.16%), Query Frame = 1
Query: 1393 DLNDGNGSEQSF--QDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTA-QMMNNPNFHGYFGD-NPDFCNAI-AALGGSFQSGNNYPIGHPALH 1914
            DL    GS Q+    D     C      G  +G +GTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRHVRE LAQ+TGL+MRVIQVWFQNRRSKERRMKQL+A+G RR F+RN RR+R +    G  ++  + A +++ NP++HGY  + NPDF N I AA+  SF S    P+     H
Sbjct:  329 DLPASEGSSQASVGSDSGTGQCMGGQLSGCGTG-AGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHVRETLAQETGLSMRVIQVWFQNRRSKERRMKQLNALGPRRSFYRNPRRLRGIRASLGSTELNNEAALELITNPSYHGYLVENNPDFYNVIAAAVAVSFNSSGPIPLASVNYH 506          
BLAST of lhx1-5-1 vs. TrEMBL
Match: A0A4S2LFV7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009163 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 6.221e-37
Identity = 99/179 (55.31%), Postives = 121/179 (67.60%), Query Frame = 1
Query: 1393 DLNDGNGSEQS--FQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTA-QMMNNPNFHGYFGD-NPDFCNAI-AALGGSFQSGNNYPIGHPALH 1914
            DL    GS Q+    D     C      G  +G +GTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRHVRE LAQ+TGL+MRVIQVWFQNRRSKERRMKQL+A+G RR F+RN RR+R +    G  ++  + A +++ NP +HGY  + NPDF N I AA+  SF S    P+     H
Sbjct:  652 DLPASEGSSQASVGSDSGTGQCMAGQLSGCGTG-AGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHVRETLAQETGLSMRVIQVWFQNRRSKERRMKQLNALGPRRSFYRNPRRLRGIRASLGSAELNNEAALELITNPTYHGYLVENNPDFYNVIAAAVAVSFNSSGPIPLASVNYH 829          

HSP 2 Score: 104.76 bits (260), Expect = 4.791e-19
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  397 INPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPV-CREDF 762
            +N    CT C   I+D + H + D+ WH  CLRC  C I L +RC+ ++G+++C  D+ ++   +C+ C   I  ++LV  +R SS+FH  CF C +C  Q   GD+ CL    + V C+E +
Sbjct:  103 VNDTVRCTGCRSLILDPFYHRVVDQSWHQACLRCFACGILLLDRCYTKEGQMYCRADFMRQYGPRCTACRKTIQASELVHFAR-SSIFHAACFRCNICDHQFIAGDQLCLARGDQYVICQEHY 224          
BLAST of lhx1-5-1 vs. TrEMBL
Match: A0A210PXD7 (LIM/homeobox protein Lhx1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16479 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.342e-36
Identity = 86/121 (71.07%), Postives = 100/121 (82.64%), Query Frame = 1
Query: 1468 EGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDN 1830
            EG+ +  +G KRRGPRTTIKAKQL+ LK+AF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+GARR FFRN RRMR+L  G  P ++  D ++MM  P F GYF DN
Sbjct:  161 EGSANSTAGAKRRGPRTTIKAKQLEVLKSAFNATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHFFRNPRRMRALRTGMSPSEL--DESEMMGGPGF-GYFSDN 278          
BLAST of lhx1-5-1 vs. TrEMBL
Match: A0A504Y8M3 (LIM/homeobox protein Lhx1 OS=Fasciola gigantica OX=46835 GN=FGIG_05265 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.739e-36
Identity = 93/135 (68.89%), Postives = 110/135 (81.48%), Query Frame = 1
Query: 1498 KRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTA-QMMNNPNFHGYFGD-NPDFCNAIAALGGSFQSGNNYPI 1896
            KRRGPRTTIKAKQLDTLKAAF+ATPKPTRHVRE LAQ+TGL+MRVIQVWFQNRRSKERRMKQL+A+GARRPF+RN RR+R L  G G  D+  + A ++M+NP +HGY  + NPDF N IAA   +   G+N P+
Sbjct:  833 KRRGPRTTIKAKQLDTLKAAFAATPKPTRHVRESLAQETGLSMRVIQVWFQNRRSKERRMKQLNALGARRPFYRNPRRLRGLRPGLGAPDLSTEAAVELMSNPAYHGYLVESNPDFYNVIAAAAVAVSFGSNGPM 967          

HSP 2 Score: 111.309 bits (277), Expect = 4.950e-21
Identity = 48/120 (40.00%), Postives = 75/120 (62.50%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPV-CREDFQHI 771
            C  C++ I D++  ++AD+FWH  CLRC  C I LSERC+ R+G+LFC  D+ K    +C  C   I   +LV+  R+ S+FH++CF C +C + L+TGD++ L  + + V C E +  +
Sbjct:  201 CIGCNQAIRDQFYCHMADQFWHQACLRCFTCGILLSERCYSREGQLFCRDDFIKHYGPRCMTCRKSIQTLELVQSVRN-SLFHMRCFKCAICERPLTTGDQFYLARDDKSVICHEHYSPV 319          
BLAST of lhx1-5-1 vs. Ensembl Cavefish
Match: lhx1b (LIM/homeobox protein Lhx1-like [Source:NCBI gene;Acc:103026395])

HSP 1 Score: 143.665 bits (361), Expect = 1.294e-36
Identity = 66/150 (44.00%), Postives = 97/150 (64.67%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLIS 864
            C  C RPI+DR+L N+ D+ WH +C++C DC   L+E+CF R+G+L+C  D+ +R   KC+ C  +I PTDLVR +R+  VFHL CF C++C+KQLSTG+E  +LE  + +C+ED+       SN  P     DS +++  T   EP +S
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHTKCVQCCDCKCNLTEKCFSREGRLYCRTDFFRRFGTKCAGCSQVISPTDLVRRARN-KVFHLNCFTCIMCNKQLSTGEELYILEESKFLCKEDY------FSNNSPLK---DSTQLSAVTACSEPSLS 143          

HSP 2 Score: 139.813 bits (351), Expect = 2.549e-35
Identity = 74/120 (61.67%), Postives = 90/120 (75.00%), Query Frame = 1
Query: 1339 SSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            S+ +A S P   +  + QD+++     ++ Q   +    TE+ E      SGTKRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  132 SAVTACSEPS--LSPDPQDVHEDGKDSEAGQLSDKETGSTENDEQ----TSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of lhx1-5-1 vs. Ensembl Cavefish
Match: LHX3 (LIM homeobox 3 [Source:NCBI gene;Acc:103029891])

HSP 1 Score: 141.739 bits (356), Expect = 6.436e-36
Identity = 56/120 (46.67%), Postives = 84/120 (70.00%), Query Frame = 1
Query:  406 VPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +P C  CS+PI+DR++  + D+ WH +CL+C+DC   LSE+CF R   ++C +D+ KR   KC+ C   I PT +VR ++D  V+HL CF C+VC +QL+TGDEY L+E+ R VC+ D++
Sbjct:   25 IPVCAGCSQPIVDRFILKVLDRHWHSKCLKCSDCQSQLSEKCFTRGDSVYCKEDFFKRFGTKCAACQQGIPPTQVVRRAQD-FVYHLHCFACIVCKRQLATGDEYYLMEDSRLVCKADYE 143          

HSP 2 Score: 102.449 bits (254), Expect = 8.907e-23
Identity = 49/93 (52.69%), Postives = 64/93 (68.82%), Query Frame = 1
Query: 1405 GNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
              G E    +D + VC  +     Q     T +R PRTTI AKQL+TLK A++ +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  123 ATGDEYYLMEDSRLVCKADYETAKQREADSTAKR-PRTTITAKQLETLKNAYNNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 214          
BLAST of lhx1-5-1 vs. Ensembl Cavefish
Match: lhx5 (LIM/homeobox protein Lhx5 [Source:NCBI gene;Acc:103047421])

HSP 1 Score: 140.969 bits (354), Expect = 9.038e-36
Identity = 65/168 (38.69%), Postives = 100/168 (59.52%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIF--------------KEMSNILPQNCKHDSNKINNETIKDEPLISNQKD 876
            C  C+RPI+DR+L N+ D+ WH +C++C +C   L+ERCF R+GKL+C +D+ +R   KC+ CL  I P DLVR +R   VFHL CF C  C+KQLSTG+E  +++  + VC+ED+                  + +S  LP+    D+ + +N T  D+   +N+ +
Sbjct:    4 CAGCARPILDRFLLNVLDRAWHAECVQCCECGRALTERCFSREGKLYCREDFIRRFGTKCAGCLQGISPGDLVRRAR-GKVFHLNCFTCAACNKQLSTGEELYVIDENKFVCKEDYTGTSIREVNLNSVSSCTDRSLSPDLPEPGPDDTKETDNSTCSDKDTNNNENE 170          

HSP 2 Score: 130.568 bits (327), Expect = 3.614e-32
Identity = 61/67 (91.04%), Postives = 65/67 (97.01%), Query Frame = 1
Query: 1498 KRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            KRRGPRTTIKAKQL+TLKAAF ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  177 KRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 243          
BLAST of lhx1-5-1 vs. Ensembl Cavefish
Match: lhx1a (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:103025442])

HSP 1 Score: 137.502 bits (345), Expect = 2.762e-35
Identity = 72/119 (60.50%), Postives = 86/119 (72.27%), Query Frame = 1
Query: 1342 SFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            S +A S P      ++   +D   SE +   D+++  +      A   N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:   40 SVTACSDPSLSPDSQDPLQDDVKDSEIAALSDKEAPSNE-----ADDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 153          
BLAST of lhx1-5-1 vs. Ensembl Cavefish
Match: lhx1a (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:103025442])

HSP 1 Score: 135.961 bits (341), Expect = 5.676e-34
Identity = 55/116 (47.41%), Postives = 83/116 (71.55%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF 762
            C  C RPI+DR+L N+ D+ WH++C++C +C   L+E+CF R+GKL+C  D+ +R   KC+ C   I P DLVR +R S VFHL CF C++C+KQLSTG+E  +++  + VC++D+
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPNDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKDDY 118          

HSP 2 Score: 135.191 bits (339), Expect = 9.693e-34
Identity = 72/119 (60.50%), Postives = 86/119 (72.27%), Query Frame = 1
Query: 1342 SFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            S +A S P      ++   +D   SE +   D+++  +      A   N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  131 SVTACSDPSLSPDSQDPLQDDVKDSEIAALSDKEAPSNE-----ADDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 244          
BLAST of lhx1-5-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009847.1 (pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 gene:ENSPMAG00000008904.1 transcript:ENSPMAT00000009847.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 2.157e-34
Identity = 60/67 (89.55%), Postives = 66/67 (98.51%), Query Frame = 1
Query: 1498 KRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            KRRGPRTTIKAKQL+TL+AAF+ATPKP+RHVREQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:   26 KRRGPRTTIKAKQLETLRAAFAATPKPSRHVREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 92          
BLAST of lhx1-5-1 vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 74.3294 bits (181), Expect = 8.610e-16
Identity = 49/148 (33.11%), Postives = 65/148 (43.92%), Query Frame = 1
Query:  364 TSSINNFNKPFINPVP----------TCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSE---RCFERDGKLFCSKDYRKRVS--AKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF 762
            TSS     +P   PV            C  C +PI DRYL    ++FWH  CL C  C   L E   R + + G+  C +DY +       C+ C   I   ++    RD  V+HL+CF C  C K    GD Y LL N   +C +D 
Sbjct:    3 TSSSRKTTEPAEEPVDEVLRMPPMMLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRD-KVYHLECFKCAACQKHFCVGDRY-LLVNSDIICEQDI 148          
BLAST of lhx1-5-1 vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 73.1738 bits (178), Expect = 3.128e-15
Identity = 38/112 (33.93%), Postives = 56/112 (50.00%), Query Frame = 1
Query:  400 NPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSE---RCFERDGKLFCSKDYRKRV--SAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEY 720
             P   C  C   I DR+L    D +WH +CL+C+ C   L +    C+ R G + C  DY +    S  C+ C   I  ++LV  ++  +V+HLKCF C  C  +L  GD +
Sbjct:   13 GPPKRCAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYTRQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKTQ-GNVYHLKCFACATCRTRLVPGDRF 123          
BLAST of lhx1-5-1 vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 72.7886 bits (177), Expect = 3.193e-15
Identity = 43/122 (35.25%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  412 TCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSE---RCFERDGKLFCSKDYRKRVS--AKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF 762
             C  C +PI DRYL    ++FWH  CL C  C   L E   R + + G+  C +DY +       C+ C   I   ++    RD  V+HL+CF C  C K    GD Y LL N   +C +D 
Sbjct:   28 MCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRD-KVYHLECFKCAACQKHFCVGDRY-LLVNSDIICEQDI 147          
BLAST of lhx1-5-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011272.1 (pep scaffold:Pmarinus_7.0:GL495005:1654:1833:1 gene:ENSPMAG00000010245.1 transcript:ENSPMAT00000011272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.550e-13
Identity = 22/55 (40.00%), Postives = 39/55 (70.91%), Query Frame = 1
Query:  406 VPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDY 570
            +P C  C++ I+DR++  + D+ WH +CL+C DC   +S++CF RDG ++C +D+
Sbjct:    4 IPQCAGCNQHILDRFILKVLDRAWHSKCLKCCDCQAQMSDKCFYRDGSVYCKEDF 58          
BLAST of lhx1-5-1 vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 52.373 bits (124), Expect = 2.299e-7
Identity = 23/77 (29.87%), Postives = 41/77 (53.25%), Query Frame = 1
Query: 1453 HTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
            HT     + + +    +R  RT  K + LD LK  F   P P+   R++++   G+  + +++WFQNRR+K R+ + 
Sbjct:   61 HTNDMSASSNASDSGPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH 137          
BLAST of lhx1-5-1 vs. Ensembl Yeast
Match: PXL1 (Protein that localizes to sites of polarized growth; required for selection and/or maintenance of polarized growth sites, may modulate signaling by the GTPases Cdc42p and Rho1p; contains LIM domains and has similarity to metazoan paxillin; relocalizes from bud neck to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000001798])

HSP 1 Score: 47.7506 bits (112), Expect = 6.496e-6
Identity = 31/133 (23.31%), Postives = 56/133 (42.11%), Query Frame = 1
Query:  415 CTSCSRPIIDRYL----HNIADKFWHVQCLRCADCDIPLSER--CFERDGKLFCSKDYRKRVSAKCSLCLNII----LPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVC-REDFQHIFKE 780
            C +C   +  + +     N     WH +C +C +C I  ++   C+    + +C K Y +   + C +C N I    L  D V        FH+ C  C +C   ++  ++Y +     P+C   D + + KE
Sbjct:  556 CRACGLEVTGKRMFSKKENELSGQWHRECFKCIECGIKFNKHVPCYILGDEPYCQKHYHEENHSICKVCSNFIEGECLENDKVER------FHVDCLNCFLCKTAIT--NDYYIFNGEIPLCGNHDMEALLKE 680          
BLAST of lhx1-5-1 vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 47.3654 bits (111), Expect = 6.567e-6
Identity = 41/157 (26.11%), Postives = 76/157 (48.41%), Query Frame = 1
Query: 1219 NESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASS---PECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMK 1680
            +ESH  ++ LLTP  ++K         ++  + S ++D+ +  SAA S   P    KE+ +       S+++F   +  +            N+   RR  R T  +++L  L+A F   P P++  R +LA+   +T + +Q+WFQN+R   +R +
Sbjct:  103 DESH--ENLLLTPLNSKK---------RDYSVSSKKNDILTPLSAAKSIIIPSAS-KEKRRAFAFITHSQETFPKKEPKI-----------DNAPLARRKRRRT-SSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQR 235          
BLAST of lhx1-5-1 vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 127.872 bits (320), Expect = 1.662e-33
Identity = 54/121 (44.63%), Postives = 76/121 (62.81%), Query Frame = 1
Query:  406 VPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQH 768
            V  C  C  PI D++L  + D  WH QC++C+DC  PL+ERCF R+GKLFC  D+ +R   KCS C   I P D+VR ++   VFH+ CF C  C +Q++TGDE   + +   +CR+D+ H
Sbjct:    2 VQQCAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTERCFSREGKLFCKTDFYRRYGTKCSGCDQGISPNDMVRRAK-HLVFHVDCFVCSYCKRQITTGDELYYIGDGSFICRDDYYH 121          

HSP 2 Score: 111.694 bits (278), Expect = 7.237e-28
Identity = 50/64 (78.12%), Postives = 60/64 (93.75%), Query Frame = 1
Query: 1492 GTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
             +KRRGPRTTIKAKQL+ LK+ F+ATPKP+R++RE+LAQ+TGL MRVIQVWFQNRRSKERR+KQ
Sbjct:  150 ASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQNRRSKERRLKQ 213          
BLAST of lhx1-5-1 vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 98.5969 bits (244), Expect = 4.968e-23
Identity = 48/130 (36.92%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  409 PTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSER--CFERDGKLFCSKDYRKRVSA-KCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSN 789
              C  C   I++R+     D+ WH  CL+C+DC++ L     CF +DG + C +DY +R S  KCS C   I   +LV  +RD  V+H+ CF C  C + L+TG EY  +   R  C+ED++ + +E S 
Sbjct:    7 AVCAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFSKDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARD-QVYHVNCFACDRCKRMLATG-EYFGMRGIRIYCKEDYEELLREESR 134          

HSP 2 Score: 55.0694 bits (131), Expect = 3.545e-8
Identity = 30/65 (46.15%), Postives = 39/65 (60.00%), Query Frame = 1
Query: 1480 SGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERR 1674
            +G  G  +R  RT+ K  QL  +K  F+    P     +QL+Q TGLT RV+QVWFQN R+K RR
Sbjct:  175 TGADGRPKR-VRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQNARAKFRR 238          
BLAST of lhx1-5-1 vs. Ensembl Nematostella
Match: EDO34370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK5])

HSP 1 Score: 96.6709 bits (239), Expect = 6.367e-22
Identity = 58/188 (30.85%), Postives = 92/188 (48.94%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSER--CFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCR-------------EDFQHIFK------EMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLE 915
            C  C   I+DRYL  ++ + WH +CL+C  C   L     C+ +DGK++C  DY ++   KC+ C   I   D VR +++  V+HL CF C  C +QLSTG+E+  L++   +C+              D+Q +F       +  N L    +H + ++     +D+  I  Q +  I SN    DLE
Sbjct:   28 CVGCEAKIVDRYLVKVSGRAWHTKCLKCCLCSDELGREATCYTKDGKIYCKADYARQFGTKCARCGRSIHANDWVRRAKN-CVYHLACFACDNCKRQLSTGEEF-ALKDGHVLCKLHYLEALDTSPAERDYQEVFSPDVDGDDSPNSLKSG-RHKAKRVRTTFTEDQLQIL-QANFNIDSNPDGQDLE 211          

HSP 2 Score: 51.2174 bits (121), Expect = 7.672e-7
Identity = 28/66 (42.42%), Postives = 39/66 (59.09%), Query Frame = 1
Query: 1477 QSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERR 1674
            +SG    KR   RTT    QL  L+A F+    P     E++AQ TGL+ RV QVWFQN R+++++
Sbjct:  174 KSGRHKAKR--VRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQVWFQNSRARQKK 237          
BLAST of lhx1-5-1 vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 94.7449 bits (234), Expect = 4.163e-21
Identity = 48/130 (36.92%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  406 VPTCTSCSRPIIDRYLHNIA-DKFWHVQCLRCADCDIPLSERC--FERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMS 786
            V  C  C   I D+Y+  +A D  WH  CL+CADC + L E+C  F R+GK +C +DY +    KC+ C       D V  +R+  ++H+ CF CV C +QL  GDE+ L E+    C+ D + + K  +
Sbjct:   14 VSMCVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGKTYCKRDYVRLFGTKCAKCSLNFSKNDFVMRARNK-IYHIDCFRCVACSRQLVPGDEFALREDGL-FCKADHEIVEKATA 141          

HSP 2 Score: 62.003 bits (149), Expect = 3.019e-10
Identity = 26/54 (48.15%), Postives = 40/54 (74.07%), Query Frame = 1
Query: 1513 RTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERR 1674
            RT +  KQL TL+  ++A P+P   ++EQL + TGL+ RVI+VWFQN+R K+++
Sbjct:  184 RTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQNKRCKDKK 237          
BLAST of lhx1-5-1 vs. Ensembl Nematostella
Match: EDO37316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG43])

HSP 1 Score: 88.1965 bits (217), Expect = 1.760e-20
Identity = 47/134 (35.07%), Postives = 70/134 (52.24%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSE---RCFERDGKLFCSKDYRKRV--SAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQ 801
            C  C   IIDR+L    D++WHV CL+C+ C+  L E    C+ + G + C  DY +    S  C++C  +I  T+LV       V+HL CF C  CH QL  GD + ++ N R  C  D  ++ K+  ++  Q
Sbjct:   19 CAGCGEKIIDRFLLLALDQYWHVNCLKCSCCEARLGEIGTSCYSKGGMILCKTDYVRLYGNSGACAVCAKLIPATELVMKVL-GKVYHLHCFTCTTCHNQLVPGDRFHVV-NGRLFCENDDPNLLKQQLHVTKQ 150          
BLAST of lhx1-5-1 vs. Ensembl Medaka
Match: lhx1b (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:101155626])

HSP 1 Score: 146.747 bits (369), Expect = 1.058e-37
Identity = 61/117 (52.14%), Postives = 87/117 (74.36%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            CTSC +PI+DR+L  + D+ WHV+C++C +C   L+E+CF RDG+L+C  D+ +R   KC  C   ILP+DLVR ++ S VFHL CF CV+C+KQLSTG+E  +L+ F+ VC+ED+Q
Sbjct:    4 CTSCEKPILDRFLLKVLDRPWHVKCVQCCECKCSLTEKCFSRDGRLYCKNDFFRRFGTKCGGCSQGILPSDLVRRAK-SKVFHLNCFTCVMCNKQLSTGEELYILDEFKFVCKEDYQ 119          

HSP 2 Score: 129.413 bits (324), Expect = 9.025e-32
Identity = 69/124 (55.65%), Postives = 86/124 (69.35%), Query Frame = 1
Query: 1324 EDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAM 1695
            +D +  S +  S P   +  + QD  D     +S     +  C  ++ E +  G    KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQL+++TGL MRVIQVWFQNRRSKERRMKQLSA+
Sbjct:  124 KDTILLSVTTCSEPS--LSPDSQDPQDDGKDSESGHLSDKDACGNDNDEQSAVG----KRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLSRETGLNMRVIQVWFQNRRSKERRMKQLSAL 241          
BLAST of lhx1-5-1 vs. Ensembl Medaka
Match: lhx5 (LIM homeobox 5 [Source:NCBI gene;Acc:101166400])

HSP 1 Score: 143.665 bits (361), Expect = 1.145e-36
Identity = 60/116 (51.72%), Postives = 84/116 (72.41%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDF 762
            C  C RPI+DR+L N+ D+ WH +C++C DC+  L+E+CF RDGKL+C  D+ +R   KC+ CL  I P DLVR +R S VFHL CF C+VC+KQLSTG+E  +++  + VC+ED+
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHAKCVQCCDCNCNLTEKCFSRDGKLYCKMDFFRRFGTKCAGCLQGISPNDLVRKAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKEDY 119          

HSP 2 Score: 139.043 bits (349), Expect = 4.463e-35
Identity = 76/118 (64.41%), Postives = 86/118 (72.88%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMN----NPNFHGYFGD 1827
            NSG KRRGPRTTIKAKQL+TLKAAF ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+GARR  F             GP  M P   ++ +     P  +GY+G+
Sbjct:  175 NSGAKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFR-----------GPRRMRPLGGRLEDPDILGPGAYGYYGE 281          
BLAST of lhx1-5-1 vs. Ensembl Medaka
Match: lhx4 (LIM homeobox 4 [Source:NCBI gene;Acc:101165225])

HSP 1 Score: 138.272 bits (347), Expect = 7.420e-35
Identity = 53/123 (43.09%), Postives = 86/123 (69.92%), Query Frame = 1
Query:  397 INPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +  +P C  CS+ I+D+++  + D+ WH +CL+CADC  PL+++CF R G ++C +D+ KR   KC+ C   I PT +VR ++D  V+HL CF C++C +QL+TGDE+ L+E+ R VC+ D++
Sbjct:   25 LQQIPQCAGCSQHILDKFILKVLDRHWHSKCLKCADCQTPLADKCFSRAGSVYCKEDFFKRFGTKCASCQQGIPPTQVVRKAQD-FVYHLHCFACIMCSRQLATGDEFYLMEDGRLVCKVDYE 146          

HSP 2 Score: 104.76 bits (260), Expect = 1.441e-23
Identity = 52/94 (55.32%), Postives = 68/94 (72.34%), Query Frame = 1
Query: 1408 NGSEQSFQDDQQSVCHTESREGAQSGNS--GTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
             G E    +D + VC  +     Q+ +S  GTKR  PRTTI AKQL+TLK+A+  +PKP RHVREQL+ +TGL MRV+QVWFQNRR+KE+R+K+
Sbjct:  127 TGDEFYLMEDGRLVCKVDYETAKQNDDSEAGTKR--PRTTITAKQLETLKSAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKK 218          
BLAST of lhx1-5-1 vs. Ensembl Medaka
Match: lhx1a (LIM homeobox 1 [Source:NCBI gene;Acc:100049230])

HSP 1 Score: 137.887 bits (346), Expect = 1.470e-34
Identity = 74/197 (37.56%), Postives = 112/197 (56.85%), Query Frame = 1
Query:  415 CTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLM----ILSNT---SKPDLETARNEN--FNILTKSHSPTNLLK 978
            C  C RPI+DR+L N+ D+ WHV+C++C +C   L+E+CF R+G+L+C  D+ +R   KC  C   I P DLVR +R S VFHL CF C++C+KQLSTG+E  +++  + VC+ED+          L  +   D+N ++     D  L  + +D +    +L +T   +  D ET  NEN   N+  K   P   +K
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGRLYCKNDFFRRFGTKCGGCSQGISPNDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDY----------LSNSSVKDTNLLSVTACSDPSLSPDSQDPLQDDVVLKDTEIAALSDKETVNNENDDQNLGGKRRGPRTTIK 189          

HSP 2 Score: 134.806 bits (338), Expect = 1.468e-33
Identity = 63/71 (88.73%), Postives = 68/71 (95.77%), Query Frame = 1
Query: 1486 NSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            N G KRRGPRTTIKAKQL+TLKAAF+ATPKPTRH+REQLAQ+TGL MRVIQVWFQNRRSKERRMKQLSA+G
Sbjct:  176 NLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 246          
BLAST of lhx1-5-1 vs. Ensembl Medaka
Match: lhx3 (LIM homeobox 3 [Source:NCBI gene;Acc:100144365])

HSP 1 Score: 132.88 bits (333), Expect = 5.972e-33
Identity = 52/121 (42.98%), Postives = 83/121 (68.60%), Query Frame = 1
Query:  406 VPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKD-YRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            +P C  C++ I+DR++  + D+ WH +CL+C+DC   L+E+CF R   ++C  D +++R   KC+ C   I PT +VR ++D  V+HL CF C+VC +QL+TGDEY L+E+ R VC+ D++
Sbjct:   27 IPVCAGCNQHIVDRFILKVLDRHWHGKCLKCSDCQAQLAEKCFSRGDSVYCKDDFFKRRFGTKCAACQQGIPPTQVVRRAQD-FVYHLHCFACIVCKRQLATGDEYYLMEDSRLVCKTDYE 146          

HSP 2 Score: 92.4337 bits (228), Expect = 1.952e-19
Identity = 48/91 (52.75%), Postives = 63/91 (69.23%), Query Frame = 1
Query: 1411 GSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQ 1683
            G E    +D + VC T+     Q     T +R PRTTI AKQL+TLK A++ +PKP RHVREQL+ +TGL MRV+Q  FQNRR+KE+R+K+
Sbjct:  128 GDEYYLMEDSRLVCKTDYETAKQREADSTAKR-PRTTITAKQLETLKNAYNNSPKPARHVREQLSSETGLDMRVVQ--FQNRRAKEKRLKK 215          
BLAST of lhx1-5-1 vs. Planmine SMEST
Match: SMESG000043039.1 (SMESG000043039.1)

HSP 1 Score: 1253.81 bits (3243), Expect = 0.000e+0
Identity = 656/659 (99.54%), Postives = 658/659 (99.85%), Query Frame = 1
Query:  301 MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQXXXXXXXXXXXXXXXXXXXXXXERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTXXXXXXXXXXXXXXXXVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMV 2277
            MKDSNNNIKNHLLNSPIPVKLTSSI+NFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKI NETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPM+
Sbjct:    1 MKDSNNNIKNHLLNSPIPVKLTSSIHNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKITNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMI 659          
BLAST of lhx1-5-1 vs. Planmine SMEST
Match: SMESG000016568.1 (SMESG000016568.1)

HSP 1 Score: 1251.11 bits (3236), Expect = 0.000e+0
Identity = 657/659 (99.70%), Postives = 658/659 (99.85%), Query Frame = 1
Query:  301 MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQXXXXXXXXXXXXXXXXXXXXXXERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTXXXXXXXXXXXXXXXXVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMV 2277
            MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKI NETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPM+
Sbjct:    1 MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKITNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMI 659          
BLAST of lhx1-5-1 vs. Planmine SMEST
Match: SMESG000016568.1 (SMESG000016568.1)

HSP 1 Score: 1250.34 bits (3234), Expect = 0.000e+0
Identity = 663/664 (99.85%), Postives = 663/664 (99.85%), Query Frame = 1
Query:  301 MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQXXXXXXXXXXXXXXXXXXXXXXERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTXXXXXXXXXXXXXXXXVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW 2292
            MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKI NETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW
Sbjct:    1 MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKITNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW 664          
BLAST of lhx1-5-1 vs. Planmine SMEST
Match: SMESG000043039.1 (SMESG000043039.1)

HSP 1 Score: 1248.03 bits (3228), Expect = 0.000e+0
Identity = 662/664 (99.70%), Postives = 663/664 (99.85%), Query Frame = 1
Query:  301 MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQXXXXXXXXXXXXXXXXXXXXXXERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGXXXXXXXXXXXXXSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTXXXXXXXXXXXXXXXXVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW 2292
            MKDSNNNIKNHLLNSPIPVKLTSSI+NFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKI NETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW
Sbjct:    1 MKDSNNNIKNHLLNSPIPVKLTSSIHNFNKPFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKITNETIKDEPLISNQKDLMILSNTSKPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISNDSNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFIGIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFSAASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNNPNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGLPGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSNNCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPSLQFVQAPMVGMESW 664          
BLAST of lhx1-5-1 vs. Planmine SMEST
Match: SMESG000071273.1 (SMESG000071273.1)

HSP 1 Score: 125.946 bits (315), Expect = 1.555e-30
Identity = 53/154 (34.42%), Postives = 100/154 (64.94%), Query Frame = 1
Query:  313 NNNIKNHLLNSPIPVKLTSSINNFNK---PFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQ 765
            ++N ++ L+ SPI  +  +S++N       F N +  C +C  PI+DR +  +    WHV+CL C DC IPL ++C+ +  ++FC +D+ +R   +C+ C  +I  ++++R +++ +++HL+CF C+ CH+QL+TG+E+ LL + + +CR DF+
Sbjct:   10 DSNFQSELI-SPIDYQTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQN-NIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFE 161          

HSP 2 Score: 95.1301 bits (235), Expect = 2.320e-20
Identity = 45/74 (60.81%), Postives = 55/74 (74.32%), Query Frame = 1
Query: 1477 QSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMG 1698
            Q  + G KR  PRTTI AKQL+ LK  +S + KP RHVREQL+  TGL MRV+QVWFQNRR+KE+RMK+ +  G
Sbjct:  168 QELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRG 239          
The following BLAST results are available for this feature:
BLAST of lhx1-5-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHX56.208e-3738.95LIM homeobox 5 [Source:HGNC Symbol;Acc:HGNC:14216][more]
LHX13.699e-3536.84LIM homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6593][more]
LHX13.699e-3536.84LIM homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6593][more]
LHX45.760e-3543.09LIM homeobox 4 [Source:HGNC Symbol;Acc:HGNC:21734][more]
LHX31.532e-3345.83LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595][more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-114.258e-3145.45pep chromosome:WBcel235:I:10248256:10255327:1 gene... [more]
mec-31.384e-2341.14Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
mec-31.816e-2341.14Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
mec-31.842e-2341.14Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
lim-45.921e-2236.30LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lim14.130e-3244.83gene:FBgn0026411 transcript:FBtr0071279[more]
Lim14.315e-3179.71gene:FBgn0026411 transcript:FBtr0331732[more]
Lim38.587e-3137.58gene:FBgn0002023 transcript:FBtr0081169[more]
Lim38.587e-3137.58gene:FBgn0002023 transcript:FBtr0309832[more]
Lim38.587e-3137.58gene:FBgn0002023 transcript:FBtr0309833[more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx54.919e-3642.24LIM homeobox 5 [Source:NCBI gene;Acc:30465][more]
lhx1b2.006e-3548.28LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
lhx1b2.006e-3548.28LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
lhx41.126e-3443.90LIM homeobox 4 [Source:ZFIN;Acc:ZDB-GENE-060728-1][more]
lhx1a1.667e-3439.09LIM homeobox 1a [Source:NCBI gene;Acc:30463][more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klf22.677e-3540.93Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-... [more]
gfm29.079e-3549.14G elongation factor, mitochondrial 2 [Source:Xenba... [more]
gfm21.574e-3388.73G elongation factor, mitochondrial 2 [Source:Xenba... [more]
clpb4.901e-3342.28ClpB homolog, mitochondrial AAA ATPase chaperonin ... [more]
clpb5.408e-3242.31ClpB homolog, mitochondrial AAA ATPase chaperonin ... [more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lhx59.343e-3738.95LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx11.510e-3588.73LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx13.368e-3536.84LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx44.265e-3543.09LIM homeobox protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx36.060e-3445.83LIM homeobox protein 3 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of lhx1-5-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H2C1|LHX5_HUMAN2.981e-3638.95LIM/homeobox protein Lhx5 OS=Homo sapiens OX=9606 ... [more]
sp|P61376|LHX5_RAT6.535e-3638.95LIM/homeobox protein Lhx5 OS=Rattus norvegicus OX=... [more]
sp|P61375|LHX5_MOUSE6.535e-3638.95LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090... [more]
sp|P53411|LHX1_CHICK2.774e-3537.89LIM/homeobox protein Lhx1 OS=Gallus gallus OX=9031... [more]
sp|P52889|LHX5_DANRE3.713e-3542.24LIM/homeobox protein Lhx5 OS=Danio rerio OX=7955 G... [more]
back to top
BLAST of lhx1-5-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5WMY90.000e+099.85Lhx1-5-1 OS=Schmidtea mediterranea OX=79327 PE=2 S... [more]
A0A3R7GSZ81.536e-3755.31LIM/homeobox protein Lhx5 (Fragment) OS=Clonorchis... [more]
A0A4S2LFV76.221e-3755.31Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A210PXD71.342e-3671.07LIM/homeobox protein Lhx1 OS=Mizuhopecten yessoens... [more]
A0A504Y8M31.739e-3668.89LIM/homeobox protein Lhx1 OS=Fasciola gigantica OX... [more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx1b1.294e-3644.00LIM/homeobox protein Lhx1-like [Source:NCBI gene;A... [more]
LHX36.436e-3646.67LIM homeobox 3 [Source:NCBI gene;Acc:103029891][more]
lhx59.038e-3638.69LIM/homeobox protein Lhx5 [Source:NCBI gene;Acc:10... [more]
lhx1a2.762e-3560.50LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
lhx1a5.676e-3447.41LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009847.12.157e-3489.55pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 ge... [more]
lmo28.610e-1633.11LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo4b3.128e-1533.93LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
lmo23.193e-1535.25LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
ENSPMAT00000011272.11.550e-1340.00pep scaffold:Pmarinus_7.0:GL495005:1654:1833:1 gen... [more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PHO22.299e-729.87Homeobox transcription factor; regulatory targets ... [more]
PXL16.496e-623.31Protein that localizes to sites of polarized growt... [more]
YOX16.567e-626.11Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
LHX11.662e-3344.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433544.968e-2336.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343706.367e-2230.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460734.163e-2136.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373161.760e-2035.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of lhx1-5-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx1b1.058e-3752.14LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
lhx51.145e-3651.72LIM homeobox 5 [Source:NCBI gene;Acc:101166400][more]
lhx47.420e-3543.09LIM homeobox 4 [Source:NCBI gene;Acc:101165225][more]
lhx1a1.470e-3437.56LIM homeobox 1 [Source:NCBI gene;Acc:100049230][more]
lhx35.972e-3342.98LIM homeobox 3 [Source:NCBI gene;Acc:100144365][more]
back to top
BLAST of lhx1-5-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043039.10.000e+099.54SMESG000043039.1[more]
SMESG000016568.10.000e+099.70SMESG000016568.1[more]
SMESG000016568.10.000e+099.85SMESG000016568.1[more]
SMESG000043039.10.000e+099.70SMESG000043039.1[more]
SMESG000071273.11.555e-3034.42SMESG000071273.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029761
GenBankAGS83409.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029761 ID=SMED30029761|Name=lhx1-5-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2556bp
ATCAACACAATTTTTTTTATCAAACCAAAATTCCAGAAATCGGAATTACC
AATCTCAAATATAAGTATCTATCATTCCACCGAACAGTTATTCAACTTTA
GCCATTTATTTTATTCTGATTAAAAAATATTCTTTACCTTAAGACGCAAA
TATGATGTTTCTATTTGCATATTAATTTTGCTCGGCTATTGACCTTTCAC
AATCAAAATTTGTTTTCACAACGCTTTCGTCTCGTGGCATTTGCTATATC
AGTGATTTTGTTTGTTTAAACTGGTGCATACTCCACCTGACAATCCAGCA
ATGAAAGATTCAAATAACAATATCAAAAACCATTTGTTGAATTCACCAAT
CCCTGTCAAATTAACCTCATCAATCAATAATTTCAACAAACCTTTCATTA
ATCCTGTGCCAACTTGTACGAGTTGCAGTCGACCGATCATTGATCGATAT
CTACACAATATTGCTGACAAATTCTGGCATGTTCAATGTTTGCGTTGTGC
AGATTGTGATATTCCATTATCGGAAAGGTGTTTTGAACGAGATGGTAAAC
TCTTTTGTTCAAAAGACTATCGAAAGAGAGTATCAGCAAAATGTTCTCTG
TGCCTCAACATCATTTTACCCACAGATTTAGTTCGTCACAGTAGAGATTC
ATCGGTTTTTCATCTCAAATGCTTTTTCTGTGTTGTTTGCCACAAACAAT
TATCGACTGGAGATGAATATTGTTTGTTGGAAAATTTCCGACCGGTTTGT
CGAGAAGATTTCCAACATATTTTCAAAGAAATGTCTAATATTTTACCACA
AAATTGTAAACACGACTCCAACAAAATCAATAATGAAACTATTAAAGATG
AGCCCCTTATTTCTAATCAAAAAGATTTGATGATACTTTCAAATACTTCT
AAACCTGATCTAGAAACGGCACGAAATGAAAACTTCAACATTCTCACGAA
AAGTCACAGTCCAACAAATTTACTTAAGCCCCATTCGAAATTTCCATTCA
CAGATATATCAACTTACCAACAGACCTGTCTGAATCGCATTTCCAATGAT
TCCAACTCTAATTCTTGCCAAGATACCACAAATGATATCAATTCTAATAT
TAACGGAAATAATAATTCAAATACAAGTAACTCAGATGAACGCCGATTTC
CCGAAAATCGGAATGATTTAACTTCCACACAACAATACAATGATTTCATT
GGAATCAAGGGAAACCCAAATGAAAGTCATCCCGTAGACAGTCAACTATT
GACACCAGAACAAAATGAAAAATTACCAAGAACCTCCAGCTCTTTCGACA
AAGAACCTGAACTGTGTAGTTTAGAAGATGATTTAAAATCATCATTTTCT
GCAGCTTCATCTCCGGAATGTGGAATCAAAGAAGAAGAACAAGATTTGAA
CGATGGTAATGGATCAGAACAAAGCTTTCAAGATGATCAACAGTCCGTGT
GTCATACAGAATCGAGAGAAGGTGCCCAATCAGGAAATAGTGGAACAAAA
CGCCGAGGTCCCCGTACGACAATAAAAGCAAAACAACTCGATACTTTGAA
AGCAGCATTTTCCGCAACACCTAAACCAACGAGACATGTTCGAGAACAAC
TTGCACAAGATACCGGACTGACAATGAGAGTAATTCAAGTATGGTTTCAA
AATCGCAGAAGCAAAGAAAGACGAATGAAACAACTAAGTGCAATGGGAGC
CCGTCGTCCTTTTTTCAGAAATGCTCGAAGAATGAGAAGTTTAAGTCGAG
GTTTCGGTCCAGATGATATGGGACCCGACACTGCTCAAATGATGAACAAT
CCCAATTTTCATGGATATTTTGGTGATAACCCAGACTTTTGCAATGCAAT
AGCGGCTTTAGGAGGTTCATTTCAGTCAGGAAATAATTATCCTATTGGTC
ATCCAGCGTTACATCGAGATTTCTTTTTGTCTAATACCAATCCTGGCCTG
CCAGGTCTTCAACCTTCATTTCTAACAATAAATCAGCCAACCTCAATTCC
AAGCTCAATTCATATGTCCTCTTCGGATAACAATCAGTCAGTTCTTGTTC
CAGGTCAAATGGAAAATAGTTTCAACTCTACAGATCAATTTAATTCTAAT
AACTGCACATCTCCTGAAGTAATTTATTCTCAGCCAAATTTTAGTTCCAT
GTCCCCTCATAATATTGTTTCGGGGCCAGGCTATATTTGCGCCCAACAAA
TTAGTTCTGTATGTGCTAGTGGACCACAATCACTTCAAAACATACCCTCA
CTTCAATTTGTCCAAGCTCCAATGGTTGGAATGGAATCCTGGTAGTAGAT
GATATAAAAAAGAAACAAATTATTTGATTTTAATTGATTTTTTCTTCTGT
TTTATCGATATAATGTACAAAGCTGTTTTTGGAAGAATTATCATTGACCA
TTATTACCATCGACTTTTGATTGTCTACTATAGAATCCAAATTGAAAGAT
TTGTTGACAGTTGATCTCAATGTTTTCTATATCCGTTCGCAGGTGTTATT
CAAATTATTTAAAATTCAAAGTGTTATAATTAATAAAATATAATTTAACA
TTAAAA
back to top

protein sequence of SMED30029761-orf-1

>SMED30029761-orf-1 ID=SMED30029761-orf-1|Name=SMED30029761-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=665bp
MKDSNNNIKNHLLNSPIPVKLTSSINNFNKPFINPVPTCTSCSRPIIDRY
LHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSL
CLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVC
REDFQHIFKEMSNILPQNCKHDSNKINNETIKDEPLISNQKDLMILSNTS
KPDLETARNENFNILTKSHSPTNLLKPHSKFPFTDISTYQQTCLNRISND
SNSNSCQDTTNDINSNINGNNNSNTSNSDERRFPENRNDLTSTQQYNDFI
GIKGNPNESHPVDSQLLTPEQNEKLPRTSSSFDKEPELCSLEDDLKSSFS
AASSPECGIKEEEQDLNDGNGSEQSFQDDQQSVCHTESREGAQSGNSGTK
RRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQ
NRRSKERRMKQLSAMGARRPFFRNARRMRSLSRGFGPDDMGPDTAQMMNN
PNFHGYFGDNPDFCNAIAALGGSFQSGNNYPIGHPALHRDFFLSNTNPGL
PGLQPSFLTINQPTSIPSSIHMSSSDNNQSVLVPGQMENSFNSTDQFNSN
NCTSPEVIYSQPNFSSMSPHNIVSGPGYICAQQISSVCASGPQSLQNIPS
LQFVQAPMVGMESW*
back to top
Aliases
The feature 'lhx1-5-1' has the following synonyms
Synonym
lhx1-5-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000105secretory cell
PLANA:0000143ventral region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000420parapharyngeal region
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000481serotonergic neuron
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 38..89
e-value: 5.7E-15
score: 65.7
coord: 97..153
e-value: 6.7E-6
score: 35.6
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 39..93
e-value: 8.2E-14
score: 51.6
coord: 98..156
e-value: 1.7E-9
score: 37.8
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 98..134
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 39..73
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 97..160
score: 9.257
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 37..96
score: 14.127
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 401..463
e-value: 3.2E-22
score: 89.8
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 402..458
e-value: 1.8E-19
score: 69.3
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 399..459
score: 18.528
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 402..460
e-value: 9.17694E-20
score: 81.1356
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 6..158
e-value: 7.0E-39
score: 135.3
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 376..459
e-value: 1.8E-22
score: 81.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 363..407
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 251..282
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 317..337
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 251..279
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 369..403
NoneNo IPR availablePANTHERPTHR24208FAMILY NOT NAMEDcoord: 37..496
NoneNo IPR availablePANTHERPTHR24208:SF105DLIM1coord: 37..496
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 36..63
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 65..130
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 434..457
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 397..463