slc26a-5

Overview
Nameslc26a-5 (AKN21609.1)
Smed IDSMED30029757
Length (bp)2172
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc26a-5 (SMED30029757) t-SNE clustered cells

Violin plots show distribution of expression levels for slc26a-5 (SMED30029757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc26a-5 (SMED30029757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc26a-5 (SMED30029757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029757SMESG000052053.1 SmedASXL_007625SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029757SMESG000052053.1 SMESG000052030.1 SmedASXL_007624SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30029757SMESG000052053.1 SMESG000052030.1 dd_Smed_v4_12144_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029757SMESG000052053.1 SMESG000052030.1 dd_Smed_v6_12144_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029757SMESG000052053.1 dd_Smed_v6_16869_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30029757SMESG000052053.1 SMESG000052030.1 SMED30029757smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30029757SMESG000052053.1 SMESG000052030.1 DN297767ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
proximal tubuleSMED30029757SMESG000052053.1 SMESG000052030.1 Smed-slc26a-5smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc26a-5 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 187.578 bits (475), Expect = 4.482e-93
Identity = 114/339 (33.63%), Postives = 205/339 (60.47%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINS----AEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A GL N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ +   L +KTG++P      R K ++K      N N  N+    A+A  D     +  E + +V +      S    E+        +  ++++D + VN++D+V ++ L  I   Y  +GI ++LAG + ++   LT+++F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLG 712          

HSP 2 Score: 176.022 bits (445), Expect = 4.482e-93
Identity = 112/349 (32.09%), Postives = 196/349 (56.16%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E +  T  Y VERPI+S+  L  R + +D++  ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + PI GLY+SF+P ++Y   GTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    YNV +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          
BLAST of slc26a-5 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 185.267 bits (469), Expect = 2.191e-92
Identity = 113/341 (33.14%), Postives = 204/341 (59.82%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPR-----RIKPLKKELTVEKNINQINSA------EATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A GL N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ +   L +KTG++P      R K ++K      N N  N+       +A  D     +  E + +V +      S    E+        +  ++++D + VN++D+V ++ L  I   Y  +GI ++LAG + ++   LT+++F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKATQDAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLG 714          

HSP 2 Score: 176.022 bits (445), Expect = 2.191e-92
Identity = 112/349 (32.09%), Postives = 196/349 (56.16%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E +  T  Y VERPI+S+  L  R + +D++  ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + PI GLY+SF+P ++Y   GTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    YNV +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          
BLAST of slc26a-5 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 185.267 bits (469), Expect = 2.191e-92
Identity = 113/341 (33.14%), Postives = 204/341 (59.82%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPR-----RIKPLKKELTVEKNINQINSA------EATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A GL N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ +   L +KTG++P      R K ++K      N N  N+       +A  D     +  E + +V +      S    E+        +  ++++D + VN++D+V ++ L  I   Y  +GI ++LAG + ++   LT+++F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKATQDAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLG 714          

HSP 2 Score: 176.022 bits (445), Expect = 2.191e-92
Identity = 112/349 (32.09%), Postives = 196/349 (56.16%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E +  T  Y VERPI+S+  L  R + +D++  ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + PI GLY+SF+P ++Y   GTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    YNV +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          
BLAST of slc26a-5 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 176.407 bits (446), Expect = 1.598e-88
Identity = 112/349 (32.09%), Postives = 196/349 (56.16%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E +  T  Y VERPI+S+  L  R + +D++  ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + PI GLY+SF+P ++Y   GTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    YNV +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          

HSP 2 Score: 171.785 bits (434), Expect = 1.598e-88
Identity = 105/312 (33.65%), Postives = 187/312 (59.94%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINS----AEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRK 2070
            EL+A GL N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ +   L +KTG++P      R K ++K      N N  N+    A+A  D     +  E + +V +      S    E+        +  ++++D + VN++D+V ++ L  I   Y  +GI ++LAG +  I++
Sbjct:  374 ELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAFIQR 685          
BLAST of slc26a-5 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 175.637 bits (444), Expect = 3.271e-85
Identity = 112/349 (32.09%), Postives = 196/349 (56.16%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E +  T  Y VERPI+S+  L  R + +D++  ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + PI GLY+SF+P ++Y   GTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    YNV +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          

HSP 2 Score: 161.384 bits (407), Expect = 3.271e-85
Identity = 100/339 (29.50%), Postives = 180/339 (53.10%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINS----AEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A GL N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFE                        +P           +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ +   L +KTG++P      R K ++K      N N  N+    A+A  D     +  E + +V +      S    E+        +  ++++D + VN++D+V ++ L  I   Y  +GI ++LAG + ++   LT+++F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFE-----------------------SLPQ---------TIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLG 680          
BLAST of slc26a-5 vs. Ensembl Celegans
Match: sulp-5 (SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:O17951])

HSP 1 Score: 149.058 bits (375), Expect = 6.954e-70
Identity = 107/300 (35.67%), Postives = 172/300 (57.33%), Query Frame = 2
Query:  263 NFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDD---TKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYK-IKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXX--XXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDAL 1144
            NF+  ++++ P    +  +     L  D V GIT+ V  IPQG+AY +L+  +PI GLY S +P  +YI FGTS+H SLGTF+++AL++ + + RE  I +          N + TL   D+   + +++S A  L  G+ Q  MG  +L  +  Y++D +I GFTT SA+HV++SQ  ++ G + + ++SG G L   VY    N+ +  +    I+L  +++L    EY+NPI+K+K+K   PI  +L+ VI+ T+       +  YNV IV  IP GLP   +P+ ++ PRV  DA+
Sbjct:   77 NFKIFLLNLFPIFGWLPKYDWKNSLTSDVVGGITVGVLQIPQGIAYAILSRQDPIVGLYTSIYPVFLYIFFGTSKHASLGTFAVVALMTGLAVEREAFIPS---------DNLNSTLLPGDEALPSPIEVSCALVLGVGLIQFLMGVFRLQFLTTYLSDQLIAGFTTGSAVHVLVSQFKELFGLRGLVKHSGPGYLIRNVYDTVTNLPKANFMCCAISLATMILLHCGKEYINPIMKRKMKSNIPIPWELVAVIISTIFVALIDANELYNVKIVNKIPTGLPELSLPNPNLIPRVLPDAI 367          

HSP 2 Score: 135.961 bits (341), Expect = 6.954e-70
Identity = 102/325 (31.38%), Postives = 169/325 (52.00%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTD------ETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDA 2139
            EL A   + I GSFF    ++  L R+ V V+ G+K+QVAT  SC+ +L V L+ G   E++P  VLS+IIV++LKSML ++ ++  ++KLSK D  +WMV+F ATV ++V  GL+    F+L T I+R Q P+  LL  +  TD + + + ++  +   GI IF++DAP+ F N E F+ K  +K   + ++      E    K  N    ++ T +        T++ +H    +   +               +  VID S   ++D + +  L+E++S  RK  +Q++ A     +R+M  K  F +       Y T+ DA
Sbjct:  397 ELYALSFTAIGGSFFPTFPTSIGLGRTMVGVESGVKTQVATFFSCLFVLSVSLYFGRFLETLPMCVLSAIIVIALKSMLWKLRDLKGIWKLSKIDCCIWMVAFFATVLVDVSEGLLIAIFFALFTTILREQYPKWHLLANVKDTDEFSDTQQYQETIFYKGICIFKFDAPLLFHNVECFK-KCIEKVYDEWKK----SSEFNFVKEPNAGKGSKFTFEGMHRIAPITEIPLHPGINRDPIL--------------PRHFVIDCSGFTFIDLMGVSALKEVFSDLRKKRVQVYFASTKVPVREMFEKCSFFDFVSKENFYPTLRDA 702          
BLAST of slc26a-5 vs. Ensembl Celegans
Match: sulp-6 (SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:O45016])

HSP 1 Score: 168.318 bits (425), Expect = 1.177e-63
Identity = 114/328 (34.76%), Postives = 190/328 (57.93%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATII-SCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKP------LKKELTVEKNINQINSAEATTDETTQLRIHENNTKV-DFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAI 2142
            E  A GL +   SFF C     +L R+ + V+ G KSQ++T+I S VL++FV        + +P  VL+SI+VV++K + +QI    +L KLS  D+ ++  +F++ + LNV +GL+ G +F LLT+++R Q   S LLGR+ GT+ YR + ++++A +IPGIKIFR+D+P+YF N+E F  K+++  GL+P  ++        KK+   EK        + T  E T+L +  +  KV D    E    P+ +      I+ID S++ YVD +    L+++Y+ Y+ +GI +  A  N  +R+    S+F E+     M+V++ DA+
Sbjct:  400 EWFALGLMHTTSSFFGCFAGGSSLGRTMMQVKCGTKSQLSTLITSIVLIIFVCGGAVGCIQHLPKPVLASIVVVAMKDLFIQIFTCFALRKLSFVDYLIFAATFISVIVLNVNFGLLIGVVFELLTVVLRSQWADSSLLGRITGTNHYRRLGLYETANDIPGIKIFRFDSPIYFGNSEMFVRKIHQACGLNPLIVRGELETENKKKDARKEKEEEDAEIPKETEKE-TKLEVTTHQAKVLDEKHAEPEPNPADQYERLTHIIIDCSTIIYVDLMGQGALKDVYNDYKTIGISVLFANTNEHVRQNFETSQFFEEVPRGRMFVSVSDAV 726          

HSP 2 Score: 95.5153 bits (236), Expect = 1.177e-63
Identity = 82/296 (27.70%), Postives = 168/296 (56.76%), Query Frame = 2
Query:  320 YQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALL--SSVPLLREYQISNVTMMNN-SIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAV----NIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTV-ISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            +++ FL+ DF+ G+ + V  +PQ +AYG+L G+ P  GL      P++Y LFGTS+H S G F+I++L+  + V    +   +N T+ +N  +         ++D   + I+ + TLL G+FQ+  G    G +  +++D ++ G  + +A+HV+ SQ+  +   +I       E P++  +F +     + +  + +++I+++CVV+L + T  ++P + KK+   FP++L++V+  T+ + Y  + + ++ +P VG +  G+P P+IP +     +   A+ + I+ FV++ +L
Sbjct:   92 WKSNFLV-DFLGGLMVSVLSVPQSLAYGMLVGVPPSYGLITGIIGPIIYALFGTSKHSSPGAFAIVSLMVGTVVESFGDVGSTNGTIDSNVDLLCCRENKPRVSDGDAIGIAASVTLLVGLFQILFGLLNAGLLAVWLSDQLVQGLISGAAVHVLTSQLKSM--TRISNVPPTSE-PFQNVVFYMCFFKQMPDVDYASIIISVICVVLLLISTLVIDPWLCKKVPVKFPMELVLVVSMTLTVHYTRNTAYEFQIPTVGQVTSGIPAPVIPPMRNAFGMMGSAMSIAIISFVIHISL 383          
BLAST of slc26a-5 vs. Ensembl Celegans
Match: sulp-6 (SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:O45016])

HSP 1 Score: 168.318 bits (425), Expect = 1.177e-63
Identity = 114/328 (34.76%), Postives = 190/328 (57.93%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATII-SCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKP------LKKELTVEKNINQINSAEATTDETTQLRIHENNTKV-DFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAI 2142
            E  A GL +   SFF C     +L R+ + V+ G KSQ++T+I S VL++FV        + +P  VL+SI+VV++K + +QI    +L KLS  D+ ++  +F++ + LNV +GL+ G +F LLT+++R Q   S LLGR+ GT+ YR + ++++A +IPGIKIFR+D+P+YF N+E F  K+++  GL+P  ++        KK+   EK        + T  E T+L +  +  KV D    E    P+ +      I+ID S++ YVD +    L+++Y+ Y+ +GI +  A  N  +R+    S+F E+     M+V++ DA+
Sbjct:  400 EWFALGLMHTTSSFFGCFAGGSSLGRTMMQVKCGTKSQLSTLITSIVLIIFVCGGAVGCIQHLPKPVLASIVVVAMKDLFIQIFTCFALRKLSFVDYLIFAATFISVIVLNVNFGLLIGVVFELLTVVLRSQWADSSLLGRITGTNHYRRLGLYETANDIPGIKIFRFDSPIYFGNSEMFVRKIHQACGLNPLIVRGELETENKKKDARKEKEEEDAEIPKETEKE-TKLEVTTHQAKVLDEKHAEPEPNPADQYERLTHIIIDCSTIIYVDLMGQGALKDVYNDYKTIGISVLFANTNEHVRQNFETSQFFEEVPRGRMFVSVSDAV 726          

HSP 2 Score: 95.5153 bits (236), Expect = 1.177e-63
Identity = 82/296 (27.70%), Postives = 168/296 (56.76%), Query Frame = 2
Query:  320 YQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALL--SSVPLLREYQISNVTMMNN-SIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAV----NIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTV-ISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            +++ FL+ DF+ G+ + V  +PQ +AYG+L G+ P  GL      P++Y LFGTS+H S G F+I++L+  + V    +   +N T+ +N  +         ++D   + I+ + TLL G+FQ+  G    G +  +++D ++ G  + +A+HV+ SQ+  +   +I       E P++  +F +     + +  + +++I+++CVV+L + T  ++P + KK+   FP++L++V+  T+ + Y  + + ++ +P VG +  G+P P+IP +     +   A+ + I+ FV++ +L
Sbjct:   92 WKSNFLV-DFLGGLMVSVLSVPQSLAYGMLVGVPPSYGLITGIIGPIIYALFGTSKHSSPGAFAIVSLMVGTVVESFGDVGSTNGTIDSNVDLLCCRENKPRVSDGDAIGIAASVTLLVGLFQILFGLLNAGLLAVWLSDQLVQGLISGAAVHVLTSQLKSM--TRISNVPPTSE-PFQNVVFYMCFFKQMPDVDYASIIISVICVVLLLISTLVIDPWLCKKVPVKFPMELVLVVSMTLTVHYTRNTAYEFQIPTVGQVTSGIPAPVIPPMRNAFGMMGSAMSIAIISFVIHISL 383          
BLAST of slc26a-5 vs. Ensembl Celegans
Match: sulp-4 (Anion transporter SULP-4; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EEA7])

HSP 1 Score: 133.65 bits (335), Expect = 1.327e-61
Identity = 102/303 (33.66%), Postives = 172/303 (56.77%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKL----QISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYK-IKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXX--XXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSALN*WRTVYQILSVRFSF 1231
            D + GIT+ V  +PQG+AY LLA    INGLY S FPPL+Y+LFGTSRH SLGTF++++L++ + + +        +   + Y  SS      D  KL    ++S A T+  G+    MG  +L  +  Y++D +I GFT  S++HV++SQ+  +LG + + R+SG   L   +Y   ++I      +  I++V +++L    E++NP IK+K K   PI  +L++VIL TV         +  V +V  IP G+P   +P   + P+V  DA+ + +V      +++ W ++ ++L+ R+++
Sbjct:  113 DIIGGITVGVMQVPQGIAYALLAKQPAINGLYTSLFPPLIYMLFGTSRHASLGTFAVVSLMTGLSVEK--------LAAPTDYDPSSFNETDIDLVKLPSPTEVSCAITITMGLILFVMGVLRLQFLTTYLSDQVIAGFTVGSSVHVLVSQLKTLLGIRGLPRHSGPFYLFRHLYDLVMSITRANPVSCGISIVSIIVLHFGKEFINPFIKRKTKSNIPIPWELVIVILSTVFVAVTGVDTEAKVQVVNKIPVGVPNFSLPSFYLIPQVLPDAISITVV------SISVWLSISKMLAKRYNY 401          

HSP 2 Score: 123.635 bits (309), Expect = 1.327e-61
Identity = 86/303 (28.38%), Postives = 154/303 (50.83%), Query Frame = 1
Query: 1240 SAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISD---TKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDA 2139
            ++ +L+R+ V V  G  +Q++   S +++  V++F+G L E++P + LS+II V+L+ M  +  ++  L+K+SK DF +W+VS ++T+ L+V  GL+    F+L T I+R Q P+  LL  + GT  +R+ + +   V   GI IFR+DAP+ F N E F+              K ++K  T  +  ++        +     ++  ++  +D    +         S    ++  VID S   ++D + +  L+EI+S  RK GI ++ A     +R+M  K  F         Y T+ DA
Sbjct:  427 NSCSLSRTLVAVGAGCTTQLSIFFSSLIVFSVVIFLGTLLETLPMAALSAIICVALQGMFRKFADLIDLWKVSKIDFTIWVVSCVSTILLDVSTGLIISVCFALFTTILREQYPKWHLLASVKGTQDFRDAERYGETVYFKGICIFRFDAPLLFHNVECFK--------------KSIEKAYTEWQKSHEFYVLREERETILNTKLDGSDESIDGKMFQTAQSTLNTHSPDILSRHFVIDCSGFTFIDLMGVSALKEIFSDMRKRGILVYFANAKAPVREMFEKCHFFNFVSKENFYPTMRDA 715          
BLAST of slc26a-5 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 157.147 bits (396), Expect = 6.315e-61
Identity = 111/332 (33.43%), Postives = 190/332 (57.23%), Query Frame = 2
Query:  197 NEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIY-DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLR---EYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVG--FVMN 1174
            ++D +    C  F++K++ K I     ++  LP        YQ K   + D +AG+T+ + H+PQGMAY  LAG+ P+ G+Y+SFF   +Y+ FGT+RH+S+G F++ +++     LR   +  ISN + +N S+Y              L  + A TLL G+ Q+ MG  +LG +  Y++D+++ GFTT +A+HV  SQ++++ G K+ R+ G+G +        +++    +  + I++  ++ L L   Y+NPI+KK    P P++L++VI G VIS  F+   +Y+V  V  IP+G P P IP ++  P +  DA+ + +V   FVM+
Sbjct:   12 DQDIVEKKECSPFRKKLQ-KYIP----ILEWLPN-------YQWKDHFHGDVIAGLTVGIMHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAPDIPISNSSDINPSVYPLGEYV------DPLVFTSALTLLVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGILFLDLGRTYINPIVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVYEIPRGFPLPSIPRLNFLPALLSDAIPIAVVCYMFVMS 325          

HSP 2 Score: 97.4413 bits (241), Expect = 6.315e-61
Identity = 95/327 (29.05%), Postives = 153/327 (46.79%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNP--QSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSILL 2157
            EL A G+++ + SFF       +L+RS+V    G  +Q+ TI S  L+L V+L +GP  E +P  +L+ I++VSLKS+ MQ+ E+P LY++SK+DF +W+V+ L+T+F +V  GLV    FSL T+++R Q P   + L    P  ++  N+KI K A              ++FAN   FQ  + +  G  P    PL  E T                                                  I++D SSV ++D + +  L +++    KLG+ +F  G    +  +L+     E+ LS +   T   +I S L+
Sbjct:  343 ELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFMQVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPSFSTVLHDETPRQNVPENVKIVKFA------------GSLHFANVTAFQDDMGEAIGKLPEE-DPLIDERT--------------------------------------------------IILDASSVAFIDIMGVDALRDVFKDALKLGVHVFYCGLPEDVLSVLSND---ENFLSVVPPSTFFPSIDSCLI 603          
BLAST of slc26a-5 vs. Ensembl Fly
Match: Prestin (gene:FBgn0036770 transcript:FBtr0075153)

HSP 1 Score: 152.525 bits (384), Expect = 4.216e-65
Identity = 112/378 (29.63%), Postives = 197/378 (52.12%), Query Frame = 2
Query:  158 RPIYSYENLHRDYNEDEITFNLC------RSFKQKMK--FKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSS------VPLLREYQI---------SNVT-------MMNNSIYTNS------------SKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            +P YS   +HRD    E+           +S    ++  +++ NF  +   ++P    +  +   + L  D +AG T+ + +IP GMAYG+LAG+   NGLY + FP L Y+  GTS+H+S+GTF++ +++++        +   +QI         SN T       ++N+S   +S            + TL     TK++++ +  L  GI  L M F +LG + + +++ ++ GFTTA+A HV+ +Q+  +LG  + R+ G  ++ Y V      + +T        +  +  + +  E L P + KK +FP P +L++VI GT+IS +F+    YNV  VG IP GLP P++P + + P+V VD++ + IV +
Sbjct:   32 QPKYS---IHRDVLTHEVVIKQTGYAARDKSIPSSLRNCWRSWNFFALFTGVIPILQWLPQYSPRRDLPGDIIAGFTVAIMNIPHGMAYGILAGVSAGNGLYMAVFPVLAYMFLGTSKHISIGTFAVASMMTAKVVDTYANVDDHHQILPINAFGLQSNGTATASPLLLINSSALADSVSSTTISPFQLLNSTLNADPITKIEVATSLALTVGIVNLLMAFLRLGTLSSLLSEPLVNGFTTAAACHVVTAQLKDVLGISVPRHKGAFKIIYTVIDVIKGVPQTNLVNFGFCMAVIAFMMICNEILKPRLSKKCRFPLPAELIMVIGGTLISKWFNLYVDYNVNPVGKIPSGLPEPVLPRLDLVPKVAVDSIAIAIVTY 406          

HSP 2 Score: 116.701 bits (291), Expect = 4.216e-65
Identity = 97/321 (30.22%), Postives = 166/321 (51.71%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLP-GTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAI 2142
            EL A G+ N+VG  F C   A +L+RS +  Q G  SQ+A+++S  L++  L++IGP F S+P  VL+ +I+V+LK M MQ  E+    K  K +   W+ +FL  V +++  GL+ G   SLL + I+   P S LLG +P    +Y ++   ++A+++P ++IFRY   + FA +  F+  LY+  GLD  +I PL K ++   + +    ++++    +Q      N K++                 K +V+D S + ++D    R L ++    +  G +L LA P  R+   L  S    +    I + T+HD +
Sbjct:  429 ELFAMGIGNMVGGCFSCIPMACSLSRSVIQDQTGGVSQIASLVSASLVVVTLMWIGPFFSSLPRCVLAGVIIVALKPMFMQAKELKKFSKQGKLEMFTWISTFLCVVIIDIDIGLLIGICISLLALYIKGLKPYSCLLGYMPEAPGIYMDLNQHRNAMQVPEVRIFRYSGSLNFATSLFFRRALYEAVGLD--KI-PLTK-VSSSNSNSPSKGSKSSYSPVSQNGGKAINGKLEETSGAF-----------KVLVLDFSMLGHIDVAGCRTLTDLSKELKVRGARLLLASPVDRVYDTLVHSMALSEGPFEI-FPTLHDCV 733          
BLAST of slc26a-5 vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0346109)

HSP 1 Score: 91.6633 bits (226), Expect = 7.395e-19
Identity = 57/180 (31.67%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQ 883
            D +AGIT+ +  IPQ +AY  LAGL    GLY++F   ++Y+ FGT   +S+G  S+MA+L                           TL    D  +Q+ +    LAG+ +L+MG  QLG I++++   +   FT+ +AL V+ +Q+  +LG +IK +  +G+       F  NI+ T 
Sbjct:   72 DLIAGITLGLTIIPQSIAYAALAGLSSEYGLYSAFIGSIIYVFFGTIPQVSIGPTSLMAIL---------------------------TLQFCADKPVQVVIVLAFLAGLVELAMGVFQLGFIVSFIPAPVTKAFTSGTALIVVFAQIKNLLGVRIKGFPSIGD-------FFTNIRPTD 217          

HSP 2 Score: 66.2402 bits (160), Expect = 6.702e-11
Identity = 44/134 (32.84%), Postives = 80/134 (59.70%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQ 1584
            E++  GL NI GSFF    + GA  RSAV    G+++ +A I + +++L  L  + P F+ +P + LS++++ ++  M+  +  V  L++ +K DF  W+ SF+  +   V  GL+ G + S++ I++RL NP+
Sbjct:  355 EMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAVIFMI-DLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPK 487          
BLAST of slc26a-5 vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0083105)

HSP 1 Score: 91.6633 bits (226), Expect = 7.395e-19
Identity = 57/180 (31.67%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQ 883
            D +AGIT+ +  IPQ +AY  LAGL    GLY++F   ++Y+ FGT   +S+G  S+MA+L                           TL    D  +Q+ +    LAG+ +L+MG  QLG I++++   +   FT+ +AL V+ +Q+  +LG +IK +  +G+       F  NI+ T 
Sbjct:   72 DLIAGITLGLTIIPQSIAYAALAGLSSEYGLYSAFIGSIIYVFFGTIPQVSIGPTSLMAIL---------------------------TLQFCADKPVQVVIVLAFLAGLVELAMGVFQLGFIVSFIPAPVTKAFTSGTALIVVFAQIKNLLGVRIKGFPSIGD-------FFTNIRPTD 217          

HSP 2 Score: 66.2402 bits (160), Expect = 6.702e-11
Identity = 44/134 (32.84%), Postives = 80/134 (59.70%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQ 1584
            E++  GL NI GSFF    + GA  RSAV    G+++ +A I + +++L  L  + P F+ +P + LS++++ ++  M+  +  V  L++ +K DF  W+ SF+  +   V  GL+ G + S++ I++RL NP+
Sbjct:  355 EMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAVIFMI-DLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPK 487          
BLAST of slc26a-5 vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0083106)

HSP 1 Score: 91.6633 bits (226), Expect = 7.856e-19
Identity = 57/180 (31.67%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQ 883
            D +AGIT+ +  IPQ +AY  LAGL    GLY++F   ++Y+ FGT   +S+G  S+MA+L                           TL    D  +Q+ +    LAG+ +L+MG  QLG I++++   +   FT+ +AL V+ +Q+  +LG +IK +  +G+       F  NI+ T 
Sbjct:  101 DLIAGITLGLTIIPQSIAYAALAGLSSEYGLYSAFIGSIIYVFFGTIPQVSIGPTSLMAIL---------------------------TLQFCADKPVQVVIVLAFLAGLVELAMGVFQLGFIVSFIPAPVTKAFTSGTALIVVFAQIKNLLGVRIKGFPSIGD-------FFTNIRPTD 246          

HSP 2 Score: 66.6254 bits (161), Expect = 4.703e-11
Identity = 44/134 (32.84%), Postives = 80/134 (59.70%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQ 1584
            E++  GL NI GSFF    + GA  RSAV    G+++ +A I + +++L  L  + P F+ +P + LS++++ ++  M+  +  V  L++ +K DF  W+ SF+  +   V  GL+ G + S++ I++RL NP+
Sbjct:  384 EMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAVIFMI-DLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPK 516          
BLAST of slc26a-5 vs. Ensembl Fly
Match: CG9702 (gene:FBgn0039787 transcript:FBtr0336449)

HSP 1 Score: 90.1225 bits (222), Expect = 2.759e-18
Identity = 81/313 (25.88%), Postives = 131/313 (41.85%), Query Frame = 2
Query:  233 FKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFA----VNIKET-----------QWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPR 1126
            F++K   K + F T + H           Y  +  I D +AG T+ +  IPQG+AY  + GL P  GLY SF    VY+L GT +  ++G+ ++ +L++       +Q +                         Q SV  T L GI ++ M   +LGC++ +++  +  GFT+A AL V  SQM  +LG K     G   L   + +F     V + +T             R++    +          +   +              VVIL T ++ +   +      + GNIPKG+P P +P  SI P+
Sbjct:   69 FRKKTLLKRLPFLTWLPH-----------YNRQDCIGDLIAGFTVGLTVIPQGLAYSGVVGLPPEYGLYGSFMGCFVYVLLGTCKDSTIGSTAVASLMT-------FQFAQ---------------------GSWQRSVLLTFLTGIIEILMAIFKLGCLVEFVSGPVSAGFTSAVALIVSTSQMRSMLGVK---SDGGSFLATWISMFRDIENVRVADTCLGFGCVILLLAMRSLGKFTIGPKDESRRNGFQRVVNTVIKFLSTSRNASVVILFTAVTMYLDANGTNPFRLTGNIPKGMPTPSLPPFSIEPQ 339          
BLAST of slc26a-5 vs. Ensembl Zebrafish
Match: slc26a6 (solute carrier family 26 member 6 [Source:ZFIN;Acc:ZDB-GENE-081105-83])

HSP 1 Score: 186.422 bits (472), Expect = 2.864e-88
Identity = 121/358 (33.80%), Postives = 196/358 (54.75%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEK---------------------NINQINSAEATTD-------------ETTQLRIHENNTKV--DFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAIL 2145
            EL+A GLSN +G  F C   + +++RS V V  G KSQVA  IS +++L +LL IG LFE +P +VL++II V+L+ M+ Q  ++ SL++ +K D  VW+++ + T+  N   GL A   FS+LT++ R Q P+  +LG++PGTD+Y+ ++ +    EIPGI IFR  A +YFANAE +   LY+KTG+D  ++   KK+L  ++                        Q       +D               T   +HE + K   D V  E       +    K+I++DL+ VN++D V ++ L  IY  Y + G+Q++L G    + + + K  F  + +++ I++ T+HDA+L
Sbjct:  374 ELIALGLSNSIGGLFSCFAISCSMSRSMVQVSTGGKSQVAGAISALVILVILLKIGELFEELPKAVLAAIIYVNLQGMMKQFGDICSLWRTNKVDMVVWVMTMILTILFNPDMGLAASIAFSILTVVFRTQLPKYSILGQIPGTDIYKPVEDYNQVKEIPGITIFRSSATLYFANAEMYIDALYEKTGVDVAKLLSHKKKLQAKRLRKEKKAAKKAKKEAKKRAKEAARQAKEEPVFSDTEESEEEPELVSHSQTNGNVHELSVKEPKDMVVVEAGPYTDPDTPLPKAIILDLNPVNFLDTVGVKTLRNIYKDYGEAGVQIYLCGCQRGVVESMEKGDFFNEKVTKSILFSTVHDAVL 731          

HSP 2 Score: 160.614 bits (405), Expect = 2.864e-88
Identity = 106/349 (30.37%), Postives = 195/349 (55.87%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSK-TLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            + + K   Y ++R +    ++ +   + +   ++    K  ++      ++  +  +P    +  +   +  I D ++GI++ + H+PQGMAY LLA + P+ GLY+SF+P L+Y +FGTS+H+S+GT+++M+++      R    S+ T   N   TNS+    +  D  +++I+   T L+GIFQL +G  + G ++ Y+++ ++  +TTA+A+HVI+SQ+    G    RYSG   L Y V      + +T   T+V+++V +V L +  E L+ +  KK+  P P++L+ +I+ TV+S++      Y V +VG IP GL  P+ P +S    +  DA  L +VG+
Sbjct:    6 KELRKRVPYHIQREVLDELSVDQVAEKSDFNISVKEKLKDAVRCTGPKAKSCFLSFIPLLAWLPKYPFRENAIGDLISGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVGTYAVMSVMIGSVTERLAPDSDFTFPGNE--TNSTYIDFSSRDAERVKIAATVTFLSGIFQLLLGVVRFGFVVTYLSEPLVRSYTTAAAIHVIVSQLKYSFGINPHRYSGPLSLIYTVIEICALLGKTNIGTLVVSIVTIVGLIIAKE-LSALAAKKIPIPIPVELITIIIATVVSWYMDLKTIYKVEVVGEIPSGLQAPVAPKVSQLGSMVGDAFALAVVGY 351          
BLAST of slc26a-5 vs. Ensembl Zebrafish
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 190.66 bits (483), Expect = 1.558e-87
Identity = 124/360 (34.44%), Postives = 199/360 (55.28%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI------------------KPLKKELTVEKNI---------NQINSAEATTDETTQLRIHENNTKVDFXXXXXXX--------XXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLS-RIMYVTIHDAILSIL 2154
            ELVA GLSN +G FF C     +++RS +    G K+QVA +IS V++L  +L +GPLFE +PT+VLS+I+ V+LK M MQ  ++P+L++ +K D  VW+V+FL TV LN+  GL A   F+LLT+I R Q P+  LLGR+P T+LY   + +K+A  IPGI IFR    +Y+ANAE +   L +K+G++  +I                  K   K+  V + +         +     E   ++T+   + + NT   F  E+             S     T SI++D SSV+++D V ++ ++ I   Y K+ + ++++G    + + L +  F   ++S R ++ +IHDA+L  L
Sbjct:  378 ELVALGLSNTIGGFFQCYAVTSSMSRSLIQESTGGKTQVAGLISAVIVLITVLKLGPLFEELPTAVLSTIVFVNLKGMFMQCRDLPALWRSNKVDLLVWLVTFLCTVLLNLDLGLAASITFTLLTVIFRTQRPRYSLLGRVPDTELYLETESYKAAKAIPGITIFRSSTMIYYANAELYHEALLEKSGINIPKILELKKRKEEEEKSKKGQAKDQDKQTGVLRELLNRMLVSLHHHETDHEHIVNDTSIATVTQGNTNCSFQSEQVTEEQEWGKTNTHSSSCEQTHSIILDFSSVSFIDTVTLKTIQNICRDYAKVDVTVYISGCQACVVQQLERGGFFSGSVSKRRLFPSIHDAVLHCL 737          

HSP 2 Score: 154.066 bits (388), Expect = 1.558e-87
Identity = 96/285 (33.68%), Postives = 169/285 (59.30%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDT-----KLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            D V+G+++ + H+PQGMAY LLA + P+ GLY SF+P LVY +FGTS+H+S+GTF++++++          +S     +    TN +  L + D       +L+++ ATTLL GIFQ+ +G  + G ++ Y+++ ++ G+TT +A H I +Q+  + G   +R++G  +L Y +      + +T   T+V++LV +  L +  E +N     +L  P PI+L+V+  GT+IS++        V +VG IPKGL  P +P++  +  V  DA  + +VG+ ++ +L
Sbjct:   85 DLVSGVSVGIMHLPQGMAYALLASVPPVFGLYTSFYPVLVYFIFGTSKHISIGTFAVISIMIG-------SVSERLAPDGHFLTNGTNGLVVVDTEARDLQRLKVAAATTLLCGIFQVLLGVVRFGFVVTYLSEPLVRGYTTGAAAHAITAQLKYMFGVSPRRFTGPLQLLYTLVELCGLLPQTHVPTLVVSLVSLTALVIVKE-INSCYSHRLPLPIPIELMVITAGTLISHYTEMKTINGVDVVGEIPKGLMPPRVPEVCFFSSVAGDAFAVAVVGYAISISL 361          
BLAST of slc26a-5 vs. Ensembl Zebrafish
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 190.66 bits (483), Expect = 1.722e-87
Identity = 124/360 (34.44%), Postives = 199/360 (55.28%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI------------------KPLKKELTVEKNI---------NQINSAEATTDETTQLRIHENNTKVDFXXXXXXX--------XXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLS-RIMYVTIHDAILSIL 2154
            ELVA GLSN +G FF C     +++RS +    G K+QVA +IS V++L  +L +GPLFE +PT+VLS+I+ V+LK M MQ  ++P+L++ +K D  VW+V+FL TV LN+  GL A   F+LLT+I R Q P+  LLGR+P T+LY   + +K+A  IPGI IFR    +Y+ANAE +   L +K+G++  +I                  K   K+  V + +         +     E   ++T+   + + NT   F  E+             S     T SI++D SSV+++D V ++ ++ I   Y K+ + ++++G    + + L +  F   ++S R ++ +IHDA+L  L
Sbjct:  378 ELVALGLSNTIGGFFQCYAVTSSMSRSLIQESTGGKTQVAGLISAVIVLITVLKLGPLFEELPTAVLSTIVFVNLKGMFMQCRDLPALWRSNKVDLLVWLVTFLCTVLLNLDLGLAASITFTLLTVIFRTQRPRYSLLGRVPDTELYLETESYKAAKAIPGITIFRSSTMIYYANAELYHEALLEKSGINIPKILELKKRKEEEEKSKKGQAKDQDKQTGVLRELLNRMLVSLHHHETDHEHIVNDTSIATVTQGNTNCSFQSEQVTEEQEWGKTNTHSSSCEQTHSIILDFSSVSFIDTVTLKTIQNICRDYAKVDVTVYISGCQACVVQQLERGGFFSGSVSKRRLFPSIHDAVLHCL 737          

HSP 2 Score: 153.68 bits (387), Expect = 1.722e-87
Identity = 96/286 (33.57%), Postives = 169/286 (59.09%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDT-----KLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSALN 1186
            D V+G+++ + H+PQGMAY LLA + P+ GLY SF+P LVY +FGTS+H+S+GTF++++++          +S     +    TN +  L + D       +L+++ ATTLL GIFQ+ +G  + G ++ Y+++ ++ G+TT +A H I +Q+  + G   +R++G  +L Y +      + +T   T+V++LV +  L +  E +N     +L  P PI+L+V+  GT+IS++        V +VG IPKGL  P +P++  +  V  DA  + +VG+ ++ +L 
Sbjct:   85 DLVSGVSVGIMHLPQGMAYALLASVPPVFGLYTSFYPVLVYFIFGTSKHISIGTFAVISIMIG-------SVSERLAPDGHFLTNGTNGLVVVDTEARDLQRLKVAAATTLLCGIFQVLLGVVRFGFVVTYLSEPLVRGYTTGAAAHAITAQLKYMFGVSPRRFTGPLQLLYTLVELCGLLPQTHVPTLVVSLVSLTALVIVKE-INSCYSHRLPLPIPIELMVITAGTLISHYTEMKTINGVDVVGEIPKGLMPPRVPEVCFFSSVAGDAFAVAVVGYAISISLG 362          
BLAST of slc26a-5 vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 172.17 bits (435), Expect = 1.511e-84
Identity = 106/323 (32.82%), Postives = 186/323 (57.59%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSI 2151
            EL+A+G+SN V S F C  ++  LA + ++   G  +Q+A + + +++L VLL IGPLF  +P +VL+ I V SL+ M +Q  ++P L+++SK DF VW+V++L+ V LNV  GL  G +FS++T++ R Q     +LGR   T++YR++       E+PG+KI  Y+ P+Y+ N   F+  + +  GL P RI+      + EK +  I   E     T +  + +++    F  + +     +   + ++++ID SSV +VD    R+  ++    +K+G++++LA  N  + K+LT S        + ++VTIHDA++ I
Sbjct:  362 ELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSINNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTPERIR------SREKALKAIEKREREAISTVEQGVADSS----FSSKNDLFTSEMAEGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVVYI 674          

HSP 2 Score: 162.155 bits (409), Expect = 1.511e-84
Identity = 107/352 (30.40%), Postives = 195/352 (55.40%), Query Frame = 2
Query:  137 TDSYKVERPIYSYENLHRDYNEDEITFNLCR---SFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            + S  + R IY+ +   + Y  ++ +    R      Q+     +    ++   LP    +  +   K+L+ D +AG+T+ + HIPQGMA+ LL  + P+ GLY SFFP ++Y+LFGT  H+S GTF++++L++   +    Q+  + +  NS    SS   A  +  ++ ++ A   L+GI  L M   QLG +  Y+++ ++  FT+A+A HV +SQ+  +LG ++ RY+G   L   +     N+  T    +VI+L+C+ +L    E +N   +++L+ P P++++ VI+ T I+Y FS   KY++ IVG+IP G P P +P +   P +  D + + +V + ++ +L
Sbjct:    2 SASVAIYRNIYTEDRFRQTYGTEDQSGGRERLRDRLAQRCSCSQVECVHLLHKRLPVCSWLPKYKLRKWLLGDIIAGLTVGIVHIPQGMAFALLTSVAPVYGLYTSFFPVVLYMLFGTGHHVSTGTFAVLSLMTGSVV---EQLVPIPLALNS----SSPEAAEFEAQRIGVASAVAFLSGIMMLCMCGLQLGFLSTYLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKE-VNSRFRERLRTPIPVEIITVIIATGITYAFSLDSKYDIQIVGHIPAGFPEPRLPALETVPEIAGDTVAITLVAYAVSVSL 345          
BLAST of slc26a-5 vs. Ensembl Zebrafish
Match: slc26a6 (solute carrier family 26 member 6 [Source:ZFIN;Acc:ZDB-GENE-081105-83])

HSP 1 Score: 171.014 bits (432), Expect = 1.387e-83
Identity = 115/322 (35.71%), Postives = 188/322 (58.39%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAIL 2145
            EL+A GLSN +G  F C   + +++RS V V  G KSQVA  IS +++L +LL IG LFE +P +VL++II V+L+ M+ Q  ++ SL++ +K D  VW+++ + T+  N   GL A   FS+LT++ R Q P+  +LG++PGTD+Y+ ++ +    EIPGI IFR  A +YFANAE +   LY+KTG+D  ++   KK+L   K + +   A     +  + R+     K D V  E       +    K+I++DL+ VN++D V ++ L  +          LFL   +  + + + K  F  + +++ I++ T+HDA+L
Sbjct:  370 ELIALGLSNSIGGLFSCFAISCSMSRSMVQVSTGGKSQVAGAISALVILVILLKIGELFEELPKAVLAAIIYVNLQGMMKQFGDICSLWRTNKVDMVVWVMTMILTILFNPDMGLAASIAFSILTVVFRTQLPKYSILGQIPGTDIYKPVEDYNQVKEIPGITIFRSSATLYFANAEMYIDALYEKTGVDVAKLLSHKKKLQA-KRLRKEKKAAKKAKKEAKKRLSVKEPK-DMVVVEAGPYTDPDTPLPKAIILDLNPVNFLDTVGVKTLRNVRDDLWTCLSSLFLILLSGGVVESMEKGDFFNEKVTKSILFSTVHDAVL 689          

HSP 2 Score: 160.229 bits (404), Expect = 1.387e-83
Identity = 106/349 (30.37%), Postives = 195/349 (55.87%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSK-TLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            + + K   Y ++R +    ++ +   + +   ++    K  ++      ++  +  +P    +  +   +  I D ++GI++ + H+PQGMAY LLA + P+ GLY+SF+P L+Y +FGTS+H+S+GT+++M+++      R    S+ T   N   TNS+    +  D  +++I+   T L+GIFQL +G  + G ++ Y+++ ++  +TTA+A+HVI+SQ+    G    RYSG   L Y V      + +T   T+V+++V +V L +  E L+ +  KK+  P P++L+ +I+ TV+S++      Y V +VG IP GL  P+ P +S    +  DA  L +VG+
Sbjct:    2 KELRKRVPYHIQREVLDELSVDQVAEKSDFNISVKEKLKDAVRCTGPKAKSCFLSFIPLLAWLPKYPFRENAIGDLISGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVGTYAVMSVMIGSVTERLAPDSDFTFPGNE--TNSTYIDFSSRDAERVKIAATVTFLSGIFQLLLGVVRFGFVVTYLSEPLVRSYTTAAAIHVIVSQLKYSFGINPHRYSGPLSLIYTVIEICALLGKTNIGTLVVSIVTIVGLIIAKE-LSALAAKKIPIPIPVELITIIIATVVSWYMDLKTIYKVEVVGEIPSGLQAPVAPKVSQLGSMVGDAFALAVVGY 347          
BLAST of slc26a-5 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 171.785 bits (434), Expect = 2.031e-84
Identity = 115/349 (32.95%), Postives = 199/349 (57.02%), Query Frame = 2
Query:  146 YKVERPI----YSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLR--EYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMN 1174
            Y VERP+    Y  E LH   +E +   +L    KQ  +  +   ++ +   +P    +  +   ++L+ D ++G++  V  +PQG+AY LLAG+ P+ GLY+SF+P  +Y  FG+SRH+S+GTF++++L+     +R    ++ ++   N +  T+  + +   D  ++++ VA TLL+GI QL +G  + G +  Y+ + ++ GFTTA+A+HV  SQ+  +LG K KR+     + +       NI      T+++ L C+++L    E +N   KKKL  P P++++VVI+ T +S   +    + V +VG IP G   P +PDI+++  VFVDA+ + IVGF M 
Sbjct:   17 YCVERPVFTQEYVEEQLHLRKDEPK---SLVHKIKQSCRCTSKKAKSQLYSFIPILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGTFAVISLMIGGVAVRIAPDEMFDIMPANGTNSTDFDEKIEARDAMRVKVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMT 361          

HSP 2 Score: 162.925 bits (411), Expect = 2.031e-84
Identity = 111/348 (31.90%), Postives = 204/348 (58.62%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEAT--------TDETTQLRIHE---NNTKVDFXXXXXXXXXXXXISDTKS---------------IVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAIL 2145
            EL+A G+ N VGSFF       +++RS V    G  +Q+A ++S +++L V++ IG LF+ +P +VL++I++V+LK M  Q  ++P L++ S+ +  +W+VSFLA+V L + YGL+    F++LT+I R Q+PQ ++LG++P TD+Y +++ ++   E   IKIF+ +  +YFAN+E + + L KKTG+DP  I   KK+   +++  ++  A  T        T++      HE   +++ +D      N +    + +T S               I++D + VN+VD+V ++ L+ I   Y+++G+ + ++G +  + K LT   F + +  R I++ +IHDA++
Sbjct:  381 ELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILIAKKKAQ-KRHAREMKKANKTEKKAVLKLTNDVEMAVKHELMNDDSIIDMAANGRNGLSERNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSIIKEYKEIGVTVLVSGCSGLVVKDLTSLNFFDPSNKRDILFHSIHDAVI 727          
BLAST of slc26a-5 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 166.007 bits (419), Expect = 1.269e-81
Identity = 106/322 (32.92%), Postives = 197/322 (61.18%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAIL 2145
            EL+A G+ N VGSFF       +++RS V    G  +Q+A ++S +++L V++ IG LF+ +P +VL++I++V+LK M  Q  ++P L++ S+ +  +W+VSFLA+V L + YGL+    F++LT+I R Q+PQ ++LG++P TD+Y +++ ++   E   IKIF+ +  +YFAN+E + + L KKTG+DP  I   KK+   +++  ++  A   T++   L++  +   +     +        I     I++D + VN+VD+V ++ L+ I   Y+++G+ + ++G +  + K LT   F + +  R I++ +IHDA++
Sbjct:  332 ELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILIAKKKAQ-KRHAREMKKAN-KTEKKAVLKLVSDYVNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSIIKEYKEIGVTVLVSGCSGLVVKDLTSLNFFDPSNKRDILFHSIHDAVI 651          

HSP 2 Score: 159.458 bits (402), Expect = 1.269e-81
Identity = 101/284 (35.56%), Postives = 173/284 (60.92%), Query Frame = 2
Query:  329 KFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLR--EYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMN 1174
            ++L+ D ++G++  V  +PQG+AY LLAG+ P+ GLY+SF+P  +Y  FG+SRH+S+GTF++++L+     +R    ++ ++   N +  T+  + +   D  ++++ VA TLL+GI QL +G  + G +  Y+ + ++ GFTTA+A+HV  SQ+  +LG K KR+     + +       NI      T+++ L C+++L    E +N   KKKL  P P++++VVI+ T +S   +    + V +VG IP G   P +PDI+++  VFVDA+ + IVGF M 
Sbjct:   30 EYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGTFAVISLMIGGVAVRIAPDEMFDIMPANGTNSTDFDEKIEARDAMRVKVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMT 312          
BLAST of slc26a-5 vs. Ensembl Xenopus
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:780378])

HSP 1 Score: 163.31 bits (412), Expect = 1.126e-80
Identity = 113/355 (31.83%), Postives = 192/355 (54.08%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI-------------------KPLKKE------------LTVEKNINQI--NSAEATTDETTQLRIHE--NNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDA 2139
            EL+A GLSN +GSFF C     A++RS V    G  SQVA+ +S +++L ++L  G LF+++P ++L++++VV+LK +  Q T+VP L++ +K D  VW+V+FLAT+ LN+  GL     FSLLT+I R Q P   +LG++  TD+YR++  F    EI GIKIFR    +YFANA  +   + +  G +  ++                   K  KKE               EK ++ I  NS  A   E      +E   +  +D+   E  +          S+++DLS+  ++D V+I++L+ I+  ++++ +Q++L G    I + L    F   ++++ +++ ++HDA
Sbjct:  376 ELIALGLSNSIGSFFQCFTIGTAMSRSLVQESTGGHSQVASAVSSLVILIIILRAGELFQTLPKAILAAVVVVNLKGIYKQFTDVPMLWRSNKIDLLVWVVTFLATILLNLDIGLAVSVAFSLLTVIFRTQKPHYSILGKVDNTDIYRDVAQFDQVTEIQGIKIFRSSCTLYFANANLYAESVKRMCGAEVDKLIELKKKAIKKQKQLQEKAEKQRKKENKRKVSTDRIRMWPCEKELDSIVSNSPAAKEPEIQIAPGYEALEDAGLDYFGSEKCTF--------HSLILDLSTAGFLDTVSIKVLKNIFRDFQEIDVQVYLTGCQASIIEQLDVGNFFSKSITKNLLFNSVHDA 722          

HSP 2 Score: 158.688 bits (400), Expect = 1.126e-80
Identity = 99/314 (31.53%), Postives = 182/314 (57.96%), Query Frame = 2
Query:  236 KQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALL------SSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIV 1159
            K++++      +++++  +P    +  +   ++L+ D VAG+++ +  +PQG+AY LLAG+ P+ GLY+SFFP L+Y +FGTSRH+S GTF++++++      S VP        N T++N          +   D+ ++ ++ A T L G+FQ+ +G  Q+G ++ Y+++ +I G+T+A+A+HV +SQM  +LG +I + S    L Y +      + ET     ++     + +    ++LN     K++ P PI+L+ +I+ T ISY  + ++ Y V IVG IP G+  PM+P+ SI+  V  +A  + +V
Sbjct:   49 KKRIRCSGSIAKSLLLKFIPILGWIPRYPVREWLLGDIVAGLSVGIIQLPQGLAYALLAGVPPVYGLYSSFFPVLLYAIFGTSRHISPGTFAVISVMVGSVTESLVPSELYTLPGNETLIN----------ITARDNDRVAVASALTFLVGLFQIMLGLVQVGFVVTYLSEPLIRGYTSAAAIHVTVSQMKSVLGVQISQRSHPLSLIYAIVNLCAKLPETNI-ASLLIGGIAITVLFVVKFLNDKYSSKIRMPIPIELITLIVATGISYGANLNQVYGVDIVGEIPTGMKAPMVPNASIFASVVGNAFAIAVV 351          
BLAST of slc26a-5 vs. Ensembl Xenopus
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:780378])

HSP 1 Score: 162.155 bits (409), Expect = 2.605e-80
Identity = 111/348 (31.90%), Postives = 192/348 (55.17%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI------KPLKKELTVEKNINQI----------------NSAEATTDETTQLRIHE--NNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAILSI 2151
            EL+A GLSN +GSFF C     A++RS V    G  SQVA+ +S +++L ++L  G LF+++P ++L++++VV+LK +  Q T+VP L++ +K D  VW+V+FLAT+ LN+  GL     FSLLT+I R Q P   +LG++  TD+YR++  F    EI GIKIFR    +YFANA  +   + +  G +  ++         K++   EK   Q                 NS  A   E      +E   +  +D+   E  +          S+++DLS+  ++D V+I++L+ I+  ++++ +Q++L G    I + L    F   ++++ +++ ++HDA++ I
Sbjct:  376 ELIALGLSNSIGSFFQCFTIGTAMSRSLVQESTGGHSQVASAVSSLVILIIILRAGELFQTLPKAILAAVVVVNLKGIYKQFTDVPMLWRSNKIDLLVWVVTFLATILLNLDIGLAVSVAFSLLTVIFRTQKPHYSILGKVDNTDIYRDVAQFDQVTEIQGIKIFRSSCTLYFANANLYAESVKRMCGAEVDKLIELKKKAIKKQKQLQEKAEKQRKKENKRKEKELDSIVSNSPAAKEPEIQIAPGYEALEDAGLDYFGSEKCTF--------HSLILDLSTAGFLDTVSIKVLKNIFRDFQEIDVQVYLTGCQASIIEQLDVGNFFSKSITKNLLFNSVHDAVMYI 715          

HSP 2 Score: 158.688 bits (400), Expect = 2.605e-80
Identity = 99/314 (31.53%), Postives = 182/314 (57.96%), Query Frame = 2
Query:  236 KQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALL------SSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIV 1159
            K++++      +++++  +P    +  +   ++L+ D VAG+++ +  +PQG+AY LLAG+ P+ GLY+SFFP L+Y +FGTSRH+S GTF++++++      S VP        N T++N          +   D+ ++ ++ A T L G+FQ+ +G  Q+G ++ Y+++ +I G+T+A+A+HV +SQM  +LG +I + S    L Y +      + ET     ++     + +    ++LN     K++ P PI+L+ +I+ T ISY  + ++ Y V IVG IP G+  PM+P+ SI+  V  +A  + +V
Sbjct:   49 KKRIRCSGSIAKSLLLKFIPILGWIPRYPVREWLLGDIVAGLSVGIIQLPQGLAYALLAGVPPVYGLYSSFFPVLLYAIFGTSRHISPGTFAVISVMVGSVTESLVPSELYTLPGNETLIN----------ITARDNDRVAVASALTFLVGLFQIMLGLVQVGFVVTYLSEPLIRGYTSAAAIHVTVSQMKSVLGVQISQRSHPLSLIYAIVNLCAKLPETNI-ASLLIGGIAITVLFVVKFLNDKYSSKIRMPIPIELITLIVATGISYGANLNQVYGVDIVGEIPTGMKAPMVPNASIFASVVGNAFAIAVV 351          
BLAST of slc26a-5 vs. Ensembl Xenopus
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:780378])

HSP 1 Score: 160.999 bits (406), Expect = 5.410e-80
Identity = 110/328 (33.54%), Postives = 188/328 (57.32%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFK--SAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHE--NNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAILSI 2151
            EL+A GLSN +GSFF C     A++RS V    G  SQVA+ +S +++L ++L  G LF+++P ++L++++VV+LK +  Q T+VP L++ +K D  VW+V+FLAT+ LN+  GL     FSLLT+I R Q P   +LG++  TD+YR++  F   +  EI GIKIFR    +YFANA      LY ++           K +  E +    NS  A   E      +E   +  +D+   E  +          S+++DLS+  ++D V+I++L+ I+  ++++ +Q++L G    I + L    F   ++++ +++ ++HDA++ I
Sbjct:  376 ELIALGLSNSIGSFFQCFTIGTAMSRSLVQESTGGHSQVASAVSSLVILIIILRAGELFQTLPKAILAAVVVVNLKGIYKQFTDVPMLWRSNKIDLLVWVVTFLATILLNLDIGLAVSVAFSLLTVIFRTQKPHYSILGKVDNTDIYRDVAQFDQVTVTEIQGIKIFRSSCTLYFANA-----NLYAES----------VKRMVSELDSIVSNSPAAKEPEIQIAPGYEALEDAGLDYFGSEKCTF--------HSLILDLSTAGFLDTVSIKVLKNIFRDFQEIDVQVYLTGCQASIIEQLDVGNFFSKSITKNLLFNSVHDAVMYI 680          

HSP 2 Score: 159.073 bits (401), Expect = 5.410e-80
Identity = 99/314 (31.53%), Postives = 182/314 (57.96%), Query Frame = 2
Query:  236 KQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALL------SSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIV 1159
            K++++      +++++  +P    +  +   ++L+ D VAG+++ +  +PQG+AY LLAG+ P+ GLY+SFFP L+Y +FGTSRH+S GTF++++++      S VP        N T++N          +   D+ ++ ++ A T L G+FQ+ +G  Q+G ++ Y+++ +I G+T+A+A+HV +SQM  +LG +I + S    L Y +      + ET     ++     + +    ++LN     K++ P PI+L+ +I+ T ISY  + ++ Y V IVG IP G+  PM+P+ SI+  V  +A  + +V
Sbjct:   49 KKRIRCSGSIAKSLLLKFIPILGWIPRYPVREWLLGDIVAGLSVGIIQLPQGLAYALLAGVPPVYGLYSSFFPVLLYAIFGTSRHISPGTFAVISVMVGSVTESLVPSELYTLPGNETLIN----------ITARDNDRVAVASALTFLVGLFQIMLGLVQVGFVVTYLSEPLIRGYTSAAAIHVTVSQMKSVLGVQISQRSHPLSLIYAIVNLCAKLPETNI-ASLLIGGIAITVLFVVKFLNDKYSSKIRMPIPIELITLIVATGISYGANLNQVYGVDIVGEIPTGMKAPMVPNASIFASVVGNAFAIAVV 351          
BLAST of slc26a-5 vs. Ensembl Mouse
Match: Slc26a5 (solute carrier family 26, member 5 [Source:MGI Symbol;Acc:MGI:1933154])

HSP 1 Score: 186.808 bits (473), Expect = 2.357e-92
Identity = 113/339 (33.33%), Postives = 204/339 (60.18%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINSA----EATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A G+ N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ + + L +KTG++P      R K ++K      N N  N+     +A  D     +  E + +V F      +    E+        +  ++++D + VN+VD+V ++ L  I   Y  +GI ++LAG + ++   LT++ F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPALKELLFHSIHDAVLG 712          

HSP 2 Score: 173.711 bits (439), Expect = 2.357e-92
Identity = 112/349 (32.09%), Postives = 198/349 (56.73%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E   +T  Y VERPI+S+  L  R + +D++T ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + P+ GLY+SF+P ++Y  FGTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    Y+V +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EIPAETQRYYVERPIFSHPVLQERLHVKDKVTESIGDKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          
BLAST of slc26a-5 vs. Ensembl Mouse
Match: Slc26a5 (solute carrier family 26, member 5 [Source:MGI Symbol;Acc:MGI:1933154])

HSP 1 Score: 173.711 bits (439), Expect = 2.337e-84
Identity = 112/349 (32.09%), Postives = 198/349 (56.73%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E   +T  Y VERPI+S+  L  R + +D++T ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + P+ GLY+SF+P ++Y  FGTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    Y+V +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EIPAETQRYYVERPIFSHPVLQERLHVKDKVTESIGDKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          

HSP 2 Score: 160.229 bits (404), Expect = 2.337e-84
Identity = 99/339 (29.20%), Postives = 179/339 (52.80%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINSA----EATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A G+ N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFE                        +P           +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ + + L +KTG++P      R K ++K      N N  N+     +A  D     +  E + +V F      +    E+        +  ++++D + VN+VD+V ++ L  I   Y  +GI ++LAG + ++   LT++ F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFE-----------------------SLPQ---------TIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPALKELLFHSIHDAVLG 680          
BLAST of slc26a-5 vs. Ensembl Mouse
Match: Slc26a2 (solute carrier family 26 (sulfate transporter), member 2 [Source:MGI Symbol;Acc:MGI:892977])

HSP 1 Score: 150.214 bits (378), Expect = 5.464e-74
Identity = 111/354 (31.36%), Postives = 194/354 (54.80%), Query Frame = 2
Query:  170 SYENLH---RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQIS--NVTMMNNSIYTNSSKTLAI-------TDDTKLQISVATTL--LAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGE-LPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSALN 1186
            ++  +H   R+  + +I   + R  ++  +      +       P    +  +   K ++ D ++G+ + +  +PQ +AY LLAG EPI GLY SFF  ++Y LFGTSRH+S+G F I+ L+    + RE   +  +    ++SI   SS  + +        D +   I + +T+  +AG++Q++MGF Q+G +  Y++DA++ GF T ++  ++ SQ   +LG  + R  GVG  +   +++F  NI+ T    ++ +L+C+++L    E LN   K KLK P P++L+VV+  T+ S+F   +  YN  I G+IP G   P  PD S+ P V VDA+ + I+GF +  +L+
Sbjct:   50 AFRRIHMELREKPDTDIKQFVIRELQKSCQCSAAKVRDGAFDFFPVLRWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLFGTSRHISVGIFGILCLMIGEVVDRELHKACPDTDATSSSIAVFSSGCVVVNHTLDGLCDKSCYAIKIGSTVTFMAGVYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSHGVGSVITTWIHIFR-NIRNTNICDLITSLLCLLVLVPSKE-LNEHFKDKLKAPIPVELIVVVAATLASHFGKLNGNYNSSIAGHIPTGFMPPKAPDWSLIPNVAVDAIAISIIGFAITVSLS 401          

HSP 2 Score: 149.058 bits (375), Expect = 5.464e-74
Identity = 94/320 (29.38%), Postives = 175/320 (54.69%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAI 2142
            E+ A G  NI+ SFF C  ++ ALA++ V    G ++Q++ I++ +++L VLL I PLF S+   VL  I +V+L+  L++  ++P +++LS+ D  +W V+ L++  L+   GL+ G  FS+  +I+R Q P++ LLG    ++ + ++  +K+     GIK+FR+ AP+Y+ N E F++ LYKK  L+P  +K   K+    K   ++ +     DE +    H+                     +  +IVID S++ ++D   I  L+E+   Y  +GIQ+ LA  N  +R  L + ++ +     +++ ++ +A+
Sbjct:  417 EMYAIGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAIVTALVLLLVLLVIAPLFYSLQKCVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMFCVILRTQKPKNSLLGLEEESETFESISTYKNLRSKSGIKVFRFIAPLYYINKECFKSALYKK-ALNPVLVKAAWKKAAKRKLKEEMVTFRGDPDEVSMQLSHDP-------------------LEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSLARGEYCKKEEETLLFYSLSEAV 716          
BLAST of slc26a-5 vs. Ensembl Mouse
Match: Slc26a5 (solute carrier family 26, member 5 [Source:MGI Symbol;Acc:MGI:1933154])

HSP 1 Score: 186.808 bits (473), Expect = 5.948e-74
Identity = 113/339 (33.33%), Postives = 204/339 (60.18%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINSA----EATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A G+ N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ + + L +KTG++P      R K ++K      N N  N+     +A  D     +  E + +V F      +    E+        +  ++++D + VN+VD+V ++ L  I   Y  +GI ++LAG + ++   LT++ F E+  L  +++ +IHDA+L 
Sbjct:  337 ELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPALKELLFHSIHDAVLG 675          

HSP 2 Score: 112.079 bits (279), Expect = 5.948e-74
Identity = 94/349 (26.93%), Postives = 167/349 (47.85%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E   +T  Y VERPI+S+  L  R + +D++T ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG  + +++ +  I G+     P  + I  G                                       N++      D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    Y+V +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EIPAETQRYYVERPIFSHPVLQERLHVKDKVTESIGDKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQG-PFAVISLM--IGGVAVRLVPDDIVIPGGV--------------------------------------NATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 314          
BLAST of slc26a-5 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 152.91 bits (385), Expect = 2.093e-70
Identity = 81/200 (40.50%), Postives = 136/200 (68.00%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKE 1782
            ELVA GLSN++G FF C   + +++RS V    G  +QVA  +S + +L +++ +G LF  +P +VL+++I+V+LK M+ Q +++ SL+K ++ D  +W+V+F+AT+ LN+  GL    +FSLL +++R+Q P   +LG++P TD+YR++  +  A E+PG+K+FR  A +YFANAE +   L +K G+D  R+   KK+
Sbjct:  357 ELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYSGAKEVPGVKVFRSSATLYFANAELYSDSLKEKCGVDVDRLITQKKK 556          

HSP 2 Score: 134.42 bits (337), Expect = 2.093e-70
Identity = 99/351 (28.21%), Postives = 189/351 (53.85%), Query Frame = 2
Query:  143 SYKVERPIYSYENLHRDYNEDEITFN-LCRSFKQKMKFK--NINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSALN 1186
             Y VERP+ + E L     ED   +    ++ + +  F+       ++++  +P    +  +   ++L+ D ++G+++ +  +PQG+AY LLAGL P+ GLY+SF+P  +Y LFGTSRH+S+GTF++M+++          + +VT    +         A  DD ++Q++   + L G+FQ+ +G    G ++ Y+++ ++  +TTA+++ V++SQ+  + G K+  +SG   + Y V      + ET     V+T +   +  +  + LN  + ++L  P P +LL +I  T ISY    + ++ V +VGNI  GL  P+ P   ++  +  +A  + +VGF +  +L 
Sbjct:    7 DYHVERPLLNQEQL-----EDLGHWGPAAKTHQWRTWFRCSRARAHSLLLQHVPVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVM----------VGSVTESLTADKAFVQGLNATADDARVQVAYTLSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETV-PGTVVTAIVAGVALVLVKLLNEKLHRRLPLPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAIAVVGFAIAISLG 341          
BLAST of slc26a-5 vs. UniProt/SwissProt
Match: sp|P58743|S26A5_HUMAN (Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.983e-92
Identity = 114/339 (33.63%), Postives = 205/339 (60.47%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINS----AEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A GL N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ +   L +KTG++P      R K ++K      N N  N+    A+A  D     +  E + +V +      S    E+        +  ++++D + VN++D+V ++ L  I   Y  +GI ++LAG + ++   LT+++F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLG 712          

HSP 2 Score: 176.022 bits (445), Expect = 1.983e-92
Identity = 112/349 (32.09%), Postives = 196/349 (56.16%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E +  T  Y VERPI+S+  L  R + +D++  ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + PI GLY+SF+P ++Y   GTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    YNV +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          
BLAST of slc26a-5 vs. UniProt/SwissProt
Match: sp|Q99NH7|S26A5_MOUSE (Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=2 SV=3)

HSP 1 Score: 186.808 bits (473), Expect = 1.432e-91
Identity = 113/339 (33.33%), Postives = 204/339 (60.18%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINSA----EATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A G+ N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ + + L +KTG++P      R K ++K      N N  N+     +A  D     +  E + +V F      +    E+        +  ++++D + VN+VD+V ++ L  I   Y  +GI ++LAG + ++   LT++ F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPALKELLFHSIHDAVLG 712          

HSP 2 Score: 173.711 bits (439), Expect = 1.432e-91
Identity = 112/349 (32.09%), Postives = 198/349 (56.73%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E   +T  Y VERPI+S+  L  R + +D++T ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + P+ GLY+SF+P ++Y  FGTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    Y+V +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EIPAETQRYYVERPIFSHPVLQERLHVKDKVTESIGDKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          
BLAST of slc26a-5 vs. UniProt/SwissProt
Match: sp|Q9EPH0|S26A5_RAT (Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 9.758e-91
Identity = 112/339 (33.04%), Postives = 203/339 (59.88%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINSA----EATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A G+ N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P   +LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ + + L +KTG++P      R K ++K      N N  N+     +A  D     +  E + +V F      +    E+        +  ++++D + VN++D+V ++ L  I   Y  +GI ++LAG + ++   LT ++F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPAIIMGARRKAMRKYAKEVGNANIANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLG 712          

HSP 2 Score: 173.711 bits (439), Expect = 9.758e-91
Identity = 112/349 (32.09%), Postives = 198/349 (56.73%), Query Frame = 2
Query:  122 ETMDKTDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            E   +T  Y VERPI+S+  L  R + +D++T ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + P+ GLY+SF+P ++Y  FGTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    Y+V +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:    8 EIPAETQKYLVERPIFSHPVLQERLHVKDKVTDSIGDKLKQAFTCTPKKVRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          
BLAST of slc26a-5 vs. UniProt/SwissProt
Match: sp|Q9JKQ2|S26A5_MERUN (Prestin OS=Meriones unguiculatus OX=10047 GN=SLC26A5 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.567e-90
Identity = 111/339 (32.74%), Postives = 204/339 (60.18%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDP-----RRIKPLKKELTVEKNINQINSA----EATTDETTQLRIHENNTKVDFXXXXXXXXXXXXI-------SDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAED-NLSRIMYVTIHDAILS 2148
            EL+A G+ N +GS F     + +L+RS V    G K+Q+A  ++ +++L V+L  G LFES+P +VLS+I++V+LK M MQ +++P  ++ SK +  +W+ +F++++FL + YGL+   + +LLT+I R Q+P  ++LG+LP TD+Y ++  ++   EIPGIKIF+ +AP+Y+AN++ +   L +KTG++P      R K ++K      N N  N+A    +   D     +  E + +V +      +    E+        +  +I++D + VN++D+V ++ L  +   Y  +GI ++LAG + ++   LT+++F E+  L  +++ +IHDA+L 
Sbjct:  374 ELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPALIMGARRKAMRKYAKEVGNANIANAAVVKVDGEVDGENATKPEEEDDEVKYPPIVIKTTFPEELQRFMPQTENVHTIILDFTQVNFIDSVGVKTLAVMVKEYGDVGIYVYLAGCSPQVVNDLTRNRFFENPALKELLFHSIHDAVLG 712          

HSP 2 Score: 173.326 bits (438), Expect = 1.567e-90
Identity = 110/344 (31.98%), Postives = 196/344 (56.98%), Query Frame = 2
Query:  137 TDSYKVERPIYSYENLH-RDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            T  Y VERPI+S+  L  R + +D+++ ++    KQ         + ++   LP    + ++   ++++ D V+GI+  V  +PQG+A+ +LA + P+ GLY+SF+P ++Y  FGTSRH+S+G F++++L+     +R     ++ +      TN ++     D  +++++++ TLL+GI Q  +G  + G +  Y+ + ++ GFTTA+A+HV  S +  + G K KRYSG+  + Y       N+K     ++ + L+   +L    E+ N   K+KL  P P++   V++GT IS  F+    Y+V +VG +P GL  P  PD S++  V+VDA+ + IVGF
Sbjct:   13 TQKYHVERPIFSHPVLQERLHVKDKVSESIGDKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIGGVAVRLVP-DDIVIPGGVNATNGTEA---RDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGF 351          
BLAST of slc26a-5 vs. UniProt/SwissProt
Match: sp|Q65AC2|S26A2_HORSE (Sulfate transporter OS=Equus caballus OX=9796 GN=SLC26A2 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 7.557e-78
Identity = 124/384 (32.29%), Postives = 205/384 (53.39%), Query Frame = 2
Query:   86 RIDLNLIK*TFFETMDKTD--SYKVERPIYSYENLHRDYNEDEIT-FN--LCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLRE---------YQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTL--LAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGEL-PYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSALN 1186
            RI L L      E    TD   ++   P   Y  +H +  E   T F   + +  ++  +      + ++   LP    +  +   K ++ D ++G+ + +  +PQ +AY LLAG EPI GLY SFF  L+Y L GTSRH+S+G F ++ L+    + RE         +   ++ M++N   + +  +  I D +   I V +T+  LAGI+Q++MGF Q+G +  Y++DA++ GF T ++  ++ SQ   +LG  + R SGVG L    +++F  NI +T    ++ +L+C+++L    E LN   K KLK P P +L+VV+  T+ S+F     KYN  I G+IP G   P  PD ++ P V VDA+ + I+GF +  +L+
Sbjct:   28 RIHLEL------EKKSSTDFKQFEASEPCRPYPRIHMEPQEKSNTNFKQFVIKKLQKSCQCSPTKAKNMIFGFLPVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASLIYFLLGTSRHISVGIFGVLCLMIGEVVDRELLKAGYDTVHIAPSLGMVSNGSTSLNQTSDRICDRSCYAIKVGSTVTFLAGIYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSSGVGSLITTWIHIFR-NIHKTNVCDLITSLLCLLVLLPTKE-LNEHFKSKLKAPIPTELVVVVAATLASHFGKLHEKYNTSIAGHIPTGFMPPKAPDWNLIPSVAVDAIAISIIGFAITVSLS 403          

HSP 2 Score: 155.221 bits (391), Expect = 7.557e-78
Identity = 99/320 (30.94%), Postives = 181/320 (56.56%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAI 2142
            E+ A G  NI+ SFF C  ++ ALA++ V    G +SQ++ +++ +++L VLL I PLF S+  SVL  I +V+L+  L +  ++P ++++S+ D  +W V+ L++  ++   GL+ G  FS+  +I+R Q P+  LLG +  T+++ +M  +K+    PGIKIFR+ AP+Y+ N E F++ LYKKT L+P  +K  +K+    K   Q  +     +E +    H+                     + ++IVID S++ ++D   I  L+E+   Y  +GIQ+ LA  N  +R  L + ++ +D    +++ ++++A+
Sbjct:  419 EMYAIGFCNIIPSFFHCFTTSAALAKTLVKESTGCQSQLSGVMTALVLLLVLLVIAPLFYSLQKSVLGVITIVNLRGALRKFRDLPKMWRVSRMDTVIWFVTMLSSALISTELGLLIGVCFSMFCVILRTQKPKVSLLGLVEETEIFESMSAYKNLQARPGIKIFRFVAPLYYINKECFKSALYKKT-LNPVLVKAAQKKAAKRKIKKQPVTLSGIQNEISVQLSHDP-------------------LELRTIVIDCSAIQFLDTAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLARGEYCKDEEENLLFYSVYEAM 718          
BLAST of slc26a-5 vs. TrEMBL
Match: A0A0H3YJE7 (Slc26a-5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc26a-5 PE=2 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 352/352 (100.00%), Postives = 352/352 (100.00%), Query Frame = 2
Query:  128 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRTVVITLVCVVILFLFTEYLNPIIKKKLKFPFPIQLLVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL
Sbjct:    1 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRTVVITLVCVVILFLFTEYLNPIIKKKLKFPFPIQLLVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 352          

HSP 2 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 330/330 (100.00%), Postives = 330/330 (100.00%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSILLIGKLH 2172
            ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFESVPTSVLSSIIVVSLKSMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFVEEENNSVPSVEISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSILLIGKLH
Sbjct:  369 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFESVPTSVLSSIIVVSLKSMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFVEEENNSVPSVEISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSILLIGKLH 698          
BLAST of slc26a-5 vs. TrEMBL
Match: A0A0H3YJ97 (Slc26a-7 OS=Schmidtea mediterranea OX=79327 GN=slc26a-7 PE=2 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 0.000e+0
Identity = 201/353 (56.94%), Postives = 265/353 (75.07%), Query Frame = 2
Query:  128 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAIT-DDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            M +   YK+ERPIYSYEN   DY E+E  F++ ++   K + + + F  V+ +I+PFPF+MASFY+ +F+  D V+GITMLVFHIPQGMA+GLL G++PINGLYASFFPPL Y LFGTSRH+SLGTFSIM+LLSSVP++RE +      +NNS+  N +    ++ +  KLQI++AT LLAGI Q+ MG  QLGCIMNY+N  +IGGFTTA+A H+I+SQ+  +LGY ++RYSGVGELPYK+YLF  NIK+    T  +++ C++IL LF  ++NPI+KKK   P PIQL++VI GT+ISY  S   KY+V IVG IPKG P PMIPD+ IWP++ +DA+ L I  FVMNS+L
Sbjct:    1 MGEVPKYKIERPIYSYENFSNDYVEEEKPFDILKTLSYKSRLQQLTFPMVLYYIMPFPFIMASFYKFRFIFNDIVSGITMLVFHIPQGMAFGLLTGVQPINGLYASFFPPLTYFLFGTSRHISLGTFSIMSLLSSVPVMREAR----RPVNNSLAINGTMPQIMSYEMVKLQIAIATALLAGIIQIIMGLCQLGCIMNYVNITLIGGFTTATAFHIILSQLGSLLGYSVRRYSGVGELPYKLYLFLSNIKDVHQITFSLSIACLLILALFNVFINPIVKKKFDVPIPIQLILVIFGTIISYSISLGSKYSVMIVGTIPKGFPSPMIPDVRIWPKITLDAIALAIFAFVMNSSL 349          

HSP 2 Score: 307.375 bits (786), Expect = 0.000e+0
Identity = 168/324 (51.85%), Postives = 233/324 (71.91%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            ELVAYGLSN+ GSFF C  S+ ++ R+AVVV VGMKSQ+A++ISCVLM+ VLLF+GPLFE +P  VL++I+V SLK  LM+I E+P LY LSK DF++W+VSF+AT+ LNVPYGL  GF+FSL+T+ +R  NP+S +LG+LP T++Y+N+K +K A+EIPGIKIFRY+AP+YFANA+HFQ KL KK  +DPR +  L      E           T  ET+ LR  E + K D+             ++ K I++D   VNYVDNVA+R L +IY  Y+++G+ +++A PN ++++ LTK+ FA+D + +I +VTIHDA+L IL
Sbjct:  366 ELVAYGLSNVFGSFFQCIPSSASMTRTAVVVDVGMKSQMASVISCVLMMLVLLFLGPLFEHLPKCVLAAIVVSSLKGNLMRIKELPKLYNLSKLDFEIWIVSFVATILLNVPYGLFVGFIFSLMTVYMRFHNPKSSILGKLPNTNVYQNVKTYKDAIEIPGIKIFRYEAPIYFANADHFQNKLIKKVRVDPRILTDLLSSPNSE--------VYKTKTETSMLRPVEKSYK-DYESN----------NNLKFIILDFRPVNYVDNVAVRTLSDIYKLYKEIGVFVYIAEPNFKVKRSLTKAGFAKDRIDKITFVTIHDAVLKIL 670          
BLAST of slc26a-5 vs. TrEMBL
Match: A0A0H3YF71 (Slc26a-6 OS=Schmidtea mediterranea OX=79327 GN=slc26a-6 PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 6.471e-163
Identity = 172/322 (53.42%), Postives = 231/322 (71.74%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILS 2148
            ELV YGL+NIVGS F CT+SAGA+AR++VVVQ GMKSQVATIISC  M FVL+F+GP FE VP  VLS+IIVVSLK M+MQ+T +PSLYK+S+FDF  W+++FL+T+ LNVP GL  GF FSLLTI+IRLQ  +S++LG+LP T++Y+N+K FK A+EI G+KIFR++AP+YFAN+EHF++KLYK  G                 N  QI   E + +E+T    H+ +  V            V +   K+IV+D S++NY+DNV IR+L+ IYS ++   I   +A PN R+R ML K +FA++ L++IM+VTIHDAIL+
Sbjct:  322 ELVGYGLANIVGSLFQCTISAGAMARTSVVVQAGMKSQVATIISCFFMFFVLMFVGPAFEYVPKCVLSAIIVVSLKGMIMQMTSLPSLYKVSRFDFYTWIITFLSTLLLNVPLGLCVGFAFSLLTIVIRLQTAKSEILGQLPNTNIYKNVKHFKDAIEISGVKIFRFEAPLYFANSEHFRSKLYKIFG-----------------NQLQITECEESLNESTISNEHKKDETV----------AIVLLDIIKTIVVDCSAINYIDNVGIRVLKSIYSDFKNHKITFLIASPNTRVRNMLEKCEFAKEELNKIMFVTIHDAILN 616          

HSP 2 Score: 298.901 bits (764), Expect = 6.471e-163
Identity = 175/304 (57.57%), Postives = 229/304 (75.33%), Query Frame = 2
Query:  287 ILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQI-----SNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            I PFPF+M SFY+ +FL+ D VAG+TML+FHIPQGM YG L+GLEPINGLYASF PPL+Y+LFGTSRH+S+GTFSI+A+L S  + RE  +      N     N+   +S + LA   +TKLQIS+ATTLLAGIFQL +G  + G +MNY++D+MI GFT A+A HV+ SQ S+ILGY I+ YSGVGELPYK++LFA  I   +W T  I++ C+V LFLF E++NPI ++K KFP P Q + +++ TVISY  + S  Y+V IVG+IPKGLP  ++P+ISI P+V  D+LIL IVGF+M+SAL
Sbjct:    5 IFPFPFIMMSFYKVRFLLSDLVAGVTMLIFHIPQGMTYGFLSGLEPINGLYASFIPPLIYLLFGTSRHISIGTFSIIAILISSTVNREVMLIKDLHGNGNNSTNNHNFSSYENLA---ETKLQISIATTLLAGIFQLGLGVLKFGKLMNYVSDSMISGFTCAAAFHVMFSQFSEILGYPIEIYSGVGELPYKLFLFASQIIGIKWITFSISIGCIVALFLFAEFVNPIFQRKFKFPLPFQFVFILIATVISYMTNISSNYSVKIVGHIPKGLPGLLVPNISIMPKVVTDSLILAIVGFIMDSAL 305          
BLAST of slc26a-5 vs. TrEMBL
Match: A0A4V3SF56 (STAS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004962 PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 5.731e-115
Identity = 148/350 (42.29%), Postives = 230/350 (65.71%), Query Frame = 2
Query:  143 SYKVERPIYSYENLHRDYN--EDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLR-EYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
             Y + R +++ E+    YN    E T  L R    K   ++ + + ++ +ILPF  ++ASFY  +  ++D +AGITM + H+PQGMAYG LAGL PINGLY SFFPPLVY  FGTSRH+S+GTFS++ALLS+ P+ R   + ++V + N+S       T  +  D +L++++  TLL+G+FQ  MG  +LG +M Y++  ++GGFT ASALHVI SQ++ + G K+KR  G G LP   Y F +  K+T   TV I+++C+ +L +F   +NP I+ K+ FPFP++++V+IL T IS+F   ++++ V IVG++P+GLP P++PD+S+ P +  D++I+  V      +L
Sbjct:   11 DYNIARRVFNVEDFRTAYNGVHKEKTHLLPR---LKQSCRSFSCRNIVSYILPFYSILASFYTLRAFLHDVIAGITMSILHVPQGMAYGYLAGLRPINGLYTSFFPPLVYFFFGTSRHISVGTFSVVALLSAAPVDRLAAKFADVNVTNSS-------TDYVVYDHRLKVAITVTLLSGLFQFLMGLFRLGFLMVYISSPLLGGFTCASALHVIASQLNALFGVKMKRTVGPGILPLDFYNFILVFKKTNVATVTISVICITVLAVFKFLINPKIEAKIHFPFPVEVVVLILATTISHFAQLNQRFGVRIVGSLPQGLPKPVLPDLSLVPSIATDSVIVSFVALATTVSL 350          

HSP 2 Score: 201.06 bits (510), Expect = 5.731e-115
Identity = 126/329 (38.30%), Postives = 189/329 (57.45%), Query Frame = 1
Query: 1180 IELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI-KPLKKELTVEKNIN------QINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAIL 2145
            +E+ A GL+NIVGSFF C  ++GALAR++V    GMKSQVA++ISC +++ VL  IGP  ESVP  VLSSII+VSL  +L QI +VP L + S  D  VW+V+FLATVF++VP GL+ G +FSL+T++ R Q   S  LG +  TDLY     + +A  IPGI I R+  P+Y+AN+E FQ  + +  G+D  ++ K L+ + TV    N        +S      +T ++ + E    +               +  + IV+D+SS  ++D V    L +I  SY+ + + L       ++R  L     +   L ++ +VT+HDA+L
Sbjct:  366 LEMNALGLANIVGSFFQCHAASGALARTSVSYCAGMKSQVASLISCAVLVLVLTVIGPSLESVPMCVLSSIILVSLTGILGQIMDVPKLLRSSVIDAIVWIVTFLATVFIDVPLGLITGLVFSLVTVLCRTQLSTSYELGHIKDTDLYECRTRYATAERIPGIVILRFGGPLYYANSERFQNWVTETVGVDANKVYKELQSKTTVAAPTNPSQDKCSCSSKCCYLSQTLEVAVPEEEPSLR--------TQLANPTSVRFIVLDISSWTFIDIVGAHTLRDIIRSYKSIDVDLLFTKYQPQVRTTLHNCGLSSHELDKMCFVTLHDAVL 686          
BLAST of slc26a-5 vs. TrEMBL
Match: A0A4S2M0C2 (STAS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004962 PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 4.436e-112
Identity = 148/363 (40.77%), Postives = 230/363 (63.36%), Query Frame = 2
Query:  143 SYKVERPIYSYENLHRDYN--EDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQG-------------MAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLR-EYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
             Y + R +++ E+    YN    E T  L R    K   ++ + + ++ +ILPF  ++ASFY  +  ++D +AGITM + H+PQG             MAYG LAGL PINGLY SFFPPLVY  FGTSRH+S+GTFS++ALLS+ P+ R   + ++V + N+S       T  +  D +L++++  TLL+G+FQ  MG  +LG +M Y++  ++GGFT ASALHVI SQ++ + G K+KR  G G LP   Y F +  K+T   TV I+++C+ +L +F   +NP I+ K+ FPFP++++V+IL T IS+F   ++++ V IVG++P+GLP P++PD+S+ P +  D++I+  V      +L
Sbjct:   11 DYNIARRVFNVEDFRTAYNGVHKEKTHLLPR---LKQSCRSFSCRNIVSYILPFYSILASFYTLRAFLHDVIAGITMSILHVPQGKVSFPMMFGLCVGMAYGYLAGLRPINGLYTSFFPPLVYFFFGTSRHISVGTFSVVALLSAAPVDRLAAKFADVNVTNSS-------TDYVVYDHRLKVAITVTLLSGLFQFLMGLFRLGFLMVYISSPLLGGFTCASALHVIASQLNALFGVKMKRTVGPGILPLDFYNFILVFKKTNVATVTISVICITVLAVFKFLINPKIEAKIHFPFPVEVVVLILATTISHFAQLNQRFGVRIVGSLPQGLPKPVLPDLSLVPSIATDSVIVSFVALATTVSL 363          

HSP 2 Score: 201.06 bits (510), Expect = 4.436e-112
Identity = 126/329 (38.30%), Postives = 189/329 (57.45%), Query Frame = 1
Query: 1180 IELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI-KPLKKELTVEKNIN------QINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAIL 2145
            +E+ A GL+NIVGSFF C  ++GALAR++V    GMKSQVA++ISC +++ VL  IGP  ESVP  VLSSII+VSL  +L QI +VP L + S  D  VW+V+FLATVF++VP GL+ G +FSL+T++ R Q   S  LG +  TDLY     + +A  IPGI I R+  P+Y+AN+E FQ  + +  G+D  ++ K L+ + TV    N        +S      +T ++ + E    +               +  + IV+D+SS  ++D V    L +I  SY+ + + L       ++R  L     +   L ++ +VT+HDA+L
Sbjct:  379 LEMNALGLANIVGSFFQCHAASGALARTSVSYCAGMKSQVASLISCAVLVLVLTVIGPSLESVPMCVLSSIILVSLTGILGQIMDVPKLLRSSVIDAIVWIVTFLATVFIDVPLGLITGLVFSLVTVLCRTQLSTSYELGHIKDTDLYECRTRYATAERIPGIVILRFGGPLYYANSERFQNWVTETVGVDANKVYKELQSKTTVAAPTNPSQDKCSCSSKCCYLSQTLEVAVPEEEPSLR--------TQLANPTSVRFIVLDISSWTFIDIVGAHTLRDIIRSYKSIDVDLLFTKYQPQVRTTLHNCGLSSHELDKMCFVTLHDAVL 699          
BLAST of slc26a-5 vs. Ensembl Cavefish
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:103026473])

HSP 1 Score: 189.504 bits (480), Expect = 5.627e-94
Identity = 119/327 (36.39%), Postives = 196/327 (59.94%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEK---NINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDT--KSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAIL 2145
            ELVA GLSN +G  F C   + +++R+ V +  G K+QVA  +S ++ML +LL+IG LFE +P +VL++II V+L  M+ Q  ++PSL++ +K D  VW+V+F+ T+ LN   GL A   FS+LT+I R Q P+  LLG++PGTD+YR ++ +    +IPGI IFR  A +YFANAE +   LY+K+G+D  ++   KK+L  ++      +       T E ++L  +   +  D V           +  +  K+I++DLS VN++D V ++ L  I   Y   G+++FL+G    + + L    F  + +++ +++ T+HDA+L
Sbjct:  373 ELVALGLSNSIGGVFQCFAISCSMSRTMVQISTGGKTQVAGALSAIVMLVILLWIGSLFEDLPKAVLAAIIYVNLHGMMKQFADIPSLWRSNKVDMLVWLVTFVLTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSLLGQVPGTDIYRPVEDYNQVTQIPGIVIFRSSATLYFANAEMYTDHLYEKSGVDVTKLLNHKKKLEAKRLRQEKKEAKKKAKETVEVSELTGNGQQSGKDVVVVVAGPQLDPSLDPSLPKAIILDLSPVNFLDTVGVKTLRNIIKDYGDAGVKVFLSGCQSCVIENLETGDFFSEKITKAVIFSTVHDAVL 699          

HSP 2 Score: 176.407 bits (446), Expect = 5.627e-94
Identity = 114/344 (33.14%), Postives = 198/344 (57.56%), Query Frame = 2
Query:  134 KTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            K   Y VER +     +    ++ ++T ++    K+ M+      ++  +  +P    +  +   +    D V+GI++ + H+PQGMAY LLA + P+ GLY+SF+P L+Y +FGTS+H+S+GT+++M+++      R    S+ T+ NN I  +S       D  +++I+ A T L+GIFQL +G  Q G ++ Y+++ ++  +TTA+A+HVI+SQ+    G    R+SG   L Y V      + +T   T+V+++V +V L +  E LN  + +KL  P P++L+ +I+ TV+S+ F F  +Y V +VG+IP GL  P +P  S+   +  DA  L +VG+
Sbjct:    9 KRVGYHVERDVMDEIVVDSVADKLDVTTSVKDKLKESMRCSGPQVKSCFLSCIPLLAWLPRYPFKENAFGDLVSGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVGTYAVMSVMIGSVTERLAPDSDFTLWNN-ISNSSEINFEARDIERVKIAAAVTFLSGIFQLLLGLVQFGFVVTYLSEPLVRAYTTAAAIHVIVSQLKYSFGISATRFSGPLSLIYTVLEVCSLLGQTNIGTLVVSIVTIVCLIIAKE-LNSWLARKLPVPVPVELIAIIIATVLSWQFDFKTEYKVEVVGSIPSGLQPPKLPAFSMMGSMIGDAFALAVVGY 350          
BLAST of slc26a-5 vs. Ensembl Cavefish
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:103026473])

HSP 1 Score: 176.792 bits (447), Expect = 8.274e-87
Identity = 114/344 (33.14%), Postives = 198/344 (57.56%), Query Frame = 2
Query:  134 KTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            K   Y VER +     +    ++ ++T ++    K+ M+      ++  +  +P    +  +   +    D V+GI++ + H+PQGMAY LLA + P+ GLY+SF+P L+Y +FGTS+H+S+GT+++M+++      R    S+ T+ NN I  +S       D  +++I+ A T L+GIFQL +G  Q G ++ Y+++ ++  +TTA+A+HVI+SQ+    G    R+SG   L Y V      + +T   T+V+++V +V L +  E LN  + +KL  P P++L+ +I+ TV+S+ F F  +Y V +VG+IP GL  P +P  S+   +  DA  L +VG+
Sbjct:    9 KRVGYHVERDVMDEIVVDSVADKLDVTTSVKDKLKESMRCSGPQVKSCFLSCIPLLAWLPRYPFKENAFGDLVSGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVGTYAVMSVMIGSVTERLAPDSDFTLWNN-ISNSSEINFEARDIERVKIAAAVTFLSGIFQLLLGLVQFGFVVTYLSEPLVRAYTTAAAIHVIVSQLKYSFGISATRFSGPLSLIYTVLEVCSLLGQTNIGTLVVSIVTIVCLIIAKE-LNSWLARKLPVPVPVELIAIIIATVLSWQFDFKTEYKVEVVGSIPSGLQPPKLPAFSMMGSMIGDAFALAVVGY 350          

HSP 2 Score: 165.236 bits (417), Expect = 8.274e-87
Identity = 107/327 (32.72%), Postives = 175/327 (53.52%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEK---NINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDT--KSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAIL 2145
            ELVA GLSN +G  F C   + +++R+ V +  G K+QVA  +S ++ML +LL+IG LFE                       ++P L         VW+V+F+ T+ LN   GL A   FS+LT+I R Q P+  LLG++PGTD+YR ++ +    +IPGI IFR  A +YFANAE +   LY+K+G+D  ++   KK+L  ++      +       T E ++L  +   +  D V           +  +  K+I++DLS VN++D V ++ L  I   Y   G+++FL+G    + + L    F  + +++ +++ T+HDA+L
Sbjct:  373 ELVALGLSNSIGGVFQCFAISCSMSRTMVQISTGGKTQVAGALSAIVMLVILLWIGSLFE-----------------------DLPKL---------VWLVTFVLTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSLLGQVPGTDIYRPVEDYNQVTQIPGIVIFRSSATLYFANAEMYTDHLYEKSGVDVTKLLNHKKKLEAKRLRQEKKEAKKKAKETVEVSELTGNGQQSGKDVVVVVAGPQLDPSLDPSLPKAIILDLSPVNFLDTVGVKTLRNIIKDYGDAGVKVFLSGCQSCVIENLETGDFFSEKITKAVIFSTVHDAVL 667          
BLAST of slc26a-5 vs. Ensembl Cavefish
Match: slc26a3.2 (solute carrier family 26 member 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-041210-179])

HSP 1 Score: 178.333 bits (451), Expect = 2.039e-84
Identity = 121/346 (34.97%), Postives = 196/346 (56.65%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI-----KPLKK--------ELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXIS--------DTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFL-AGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            EL+A+G+SNI G  F    S+ AL+RSAV    G K+Q+A I+S +++L V L IG L E +P SVL ++++V+LK MLMQ+ EVP L+K  + D  +W+V+FLA++FL +  GL  G    LL ++ R Q P+  +L  + GTD+YR+ K + +  E  G+KIFR  AP++FAN + F+ KL    G +P RI     K L+K        EL+V     Q+  +    +   +    E +  VDF +         E+         D  S+V+D S+V+++D  A++ L+     + ++ +++++ A   + I K+ + S F  +  + I +VT+HDA+L IL
Sbjct:  359 ELIAFGVSNIFGGAFKSLASSTALSRSAVQESTGGKTQIAGILSAIIVLIVTLAIGFLLEPLPKSVLGAVVIVNLKGMLMQMREVPYLWKKDRLDCIIWIVTFLASIFLGLDLGLAVGLGVELLAVVFRTQFPRCSVLANISGTDIYRDRKDYINIYEPEGVKIFRIPAPIFFANIDFFRGKLLDAVGFNPLRILRKRNKALRKIRKLIKKGELSVTIKGLQVTGSYPIEESEDETNTEELDQPVDFSDLPVQVNWRAELPANISVPPVDIHSLVLDFSAVSFIDISALKGLKTALKEFIRIDVEIYIVACDPYIIEKLKSCSFFDHEIKTSIFFVTLHDAMLHIL 704          

HSP 2 Score: 155.606 bits (392), Expect = 2.039e-84
Identity = 112/353 (31.73%), Postives = 188/353 (53.26%), Query Frame = 2
Query:  128 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLC-RSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            M   D Y V RP+Y+ ++   ++ + E          KQ     +   +   + ++P    M  +   ++L+ D V+G++  +  I QG+AY LLA L    GLYA+FFP ++Y   GTSRH+S+G F +++L+    + R      V     ++     + L+I DD +  +S + T L GIFQL MG  Q+G ++ Y++D ++ GFTTA+A+H++ISQ+  I G  +  +SG    P  +      I  T    +V  +V +V++F   E +N   K KL  P PI++++ I+   +SY F+F   + V +VG IP     P+ P+I ++    VDA  + IVGF ++ A+
Sbjct:    1 MTPVDQYVVSRPLYTEDSFTENHEKVERKHKTTLDHVKQYFTCDSKRVKNAALSLVPIVGWMKMYRVKEWLLGDIVSGVSTGLVAILQGLAYSLLASLPAWYGLYAAFFPVIIYFFLGTSRHISVGAFPVLSLMVGAVVTR-----MVPDGGPTVNITGLEGLSI-DDQRAMVSASLTFLIGIFQLGMGLLQVGFVVIYLSDTLVSGFTTAAAVHILISQLKFIFGLSVPGFSG----PLILESIFTQITSTNIHDLVTAIVVMVVVFAVKE-INERFKSKLPVPIPIEVIMTIIACGVSYAFNFKDNHGVDVVGLIPDSFETPVAPNIEVFKETAVDAFPMAIVGFAISFAV 342          
BLAST of slc26a-5 vs. Ensembl Cavefish
Match: slc26a3.2 (solute carrier family 26 member 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-041210-179])

HSP 1 Score: 177.948 bits (450), Expect = 6.308e-84
Identity = 121/346 (34.97%), Postives = 196/346 (56.65%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI-----KPLKK--------ELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXIS--------DTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFL-AGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            EL+A+G+SNI G  F    S+ AL+RSAV    G K+Q+A I+S +++L V L IG L E +P SVL ++++V+LK MLMQ+ EVP L+K  + D  +W+V+FLA++FL +  GL  G    LL ++ R Q P+  +L  + GTD+YR+ K + +  E  G+KIFR  AP++FAN + F+ KL    G +P RI     K L+K        EL+V     Q+  +    +   +    E +  VDF +         E+         D  S+V+D S+V+++D  A++ L+     + ++ +++++ A   + I K+ + S F  +  + I +VT+HDA+L IL
Sbjct:  361 ELIAFGVSNIFGGAFKSLASSTALSRSAVQESTGGKTQIAGILSAIIVLIVTLAIGFLLEPLPKSVLGAVVIVNLKGMLMQMREVPYLWKKDRLDCIIWIVTFLASIFLGLDLGLAVGLGVELLAVVFRTQFPRCSVLANISGTDIYRDRKDYINIYEPEGVKIFRIPAPIFFANIDFFRGKLLDAVGFNPLRILRKRNKALRKIRKLIKKGELSVTIKGLQVTGSYPIEESEDETNTEELDQPVDFSDLPVQVNWRAELPANISVPPVDIHSLVLDFSAVSFIDISALKGLKTALKEFIRIDVEIYIVACDPYIIEKLKSCSFFDHEIKTSIFFVTLHDAMLHIL 706          

HSP 2 Score: 154.451 bits (389), Expect = 6.308e-84
Identity = 111/349 (31.81%), Postives = 187/349 (53.58%), Query Frame = 2
Query:  140 DSYKVERPIYSYENLHRDYNEDEITFNLC-RSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            D Y V RP+Y+ ++   ++ + E          KQ     +   +   + ++P    M  +   ++L+ D V+G++  +  I QG+AY LLA L    GLYA+FFP ++Y   GTSRH+S+G F +++L+    + R      V     ++     + L+I DD +  +S + T L GIFQL MG  Q+G ++ Y++D ++ GFTTA+A+H++ISQ+  I G  +  +SG    P  +      I  T    +V  +V +V++F   E +N   K KL  P PI++++ I+   +SY F+F   + V +VG IP     P+ P+I ++    VDA  + IVGF ++ A+
Sbjct:    7 DQYVVSRPLYTEDSFTENHEKVERKHKTTLDHVKQYFTCDSKRVKNAALSLVPIVGWMKMYRVKEWLLGDIVSGVSTGLVAILQGLAYSLLASLPAWYGLYAAFFPVIIYFFLGTSRHISVGAFPVLSLMVGAVVTR-----MVPDGGPTVNITGLEGLSI-DDQRAMVSASLTFLIGIFQLGMGLLQVGFVVIYLSDTLVSGFTTAAAVHILISQLKFIFGLSVPGFSG----PLILESIFTQITSTNIHDLVTAIVVMVVVFAVKE-INERFKSKLPVPIPIEVIMTIIACGVSYAFNFKDNHGVDVVGLIPDSFETPVAPNIEVFKETAVDAFPMAIVGFAISFAV 344          
BLAST of slc26a-5 vs. Ensembl Cavefish
Match: slc26a3.2 (solute carrier family 26 member 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-041210-179])

HSP 1 Score: 177.948 bits (450), Expect = 7.025e-84
Identity = 121/346 (34.97%), Postives = 196/346 (56.65%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI-----KPLKK--------ELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXIS--------DTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFL-AGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            EL+A+G+SNI G  F    S+ AL+RSAV    G K+Q+A I+S +++L V L IG L E +P SVL ++++V+LK MLMQ+ EVP L+K  + D  +W+V+FLA++FL +  GL  G    LL ++ R Q P+  +L  + GTD+YR+ K + +  E  G+KIFR  AP++FAN + F+ KL    G +P RI     K L+K        EL+V     Q+  +    +   +    E +  VDF +         E+         D  S+V+D S+V+++D  A++ L+     + ++ +++++ A   + I K+ + S F  +  + I +VT+HDA+L IL
Sbjct:  383 ELIAFGVSNIFGGAFKSLASSTALSRSAVQESTGGKTQIAGILSAIIVLIVTLAIGFLLEPLPKSVLGAVVIVNLKGMLMQMREVPYLWKKDRLDCIIWIVTFLASIFLGLDLGLAVGLGVELLAVVFRTQFPRCSVLANISGTDIYRDRKDYINIYEPEGVKIFRIPAPIFFANIDFFRGKLLDAVGFNPLRILRKRNKALRKIRKLIKKGELSVTIKGLQVTGSYPIEESEDETNTEELDQPVDFSDLPVQVNWRAELPANISVPPVDIHSLVLDFSAVSFIDISALKGLKTALKEFIRIDVEIYIVACDPYIIEKLKSCSFFDHEIKTSIFFVTLHDAMLHIL 728          

HSP 2 Score: 154.451 bits (389), Expect = 7.025e-84
Identity = 111/349 (31.81%), Postives = 187/349 (53.58%), Query Frame = 2
Query:  140 DSYKVERPIYSYENLHRDYNEDEITFNLC-RSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            D Y V RP+Y+ ++   ++ + E          KQ     +   +   + ++P    M  +   ++L+ D V+G++  +  I QG+AY LLA L    GLYA+FFP ++Y   GTSRH+S+G F +++L+    + R      V     ++     + L+I DD +  +S + T L GIFQL MG  Q+G ++ Y++D ++ GFTTA+A+H++ISQ+  I G  +  +SG    P  +      I  T    +V  +V +V++F   E +N   K KL  P PI++++ I+   +SY F+F   + V +VG IP     P+ P+I ++    VDA  + IVGF ++ A+
Sbjct:   29 DQYVVSRPLYTEDSFTENHEKVERKHKTTLDHVKQYFTCDSKRVKNAALSLVPIVGWMKMYRVKEWLLGDIVSGVSTGLVAILQGLAYSLLASLPAWYGLYAAFFPVIIYFFLGTSRHISVGAFPVLSLMVGAVVTR-----MVPDGGPTVNITGLEGLSI-DDQRAMVSASLTFLIGIFQLGMGLLQVGFVVIYLSDTLVSGFTTAAAVHILISQLKFIFGLSVPGFSG----PLILESIFTQITSTNIHDLVTAIVVMVVVFAVKE-INERFKSKLPVPIPIEVIMTIIACGVSYAFNFKDNHGVDVVGLIPDSFETPVAPNIEVFKETAVDAFPMAIVGFAISFAV 366          
BLAST of slc26a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003427.1 (pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-1 gene:ENSPMAG00000003117.1 transcript:ENSPMAT00000003427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 1.131e-73
Identity = 109/328 (33.23%), Postives = 185/328 (56.40%), Query Frame = 2
Query:  263 NFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVT---------MMNNSI-YTNSSKTLAIT--------DDTKLQISVATTL--LAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSALN 1186
              ++  +++ P    +  +   ++++ DF++G+ + +  +PQ +AY LLAG +PI GLY SFF  ++Y L GTS+H+S+G F ++ L+    + RE Q++            ++NNS+ ++NS +    T          +   I+V TT+  +AG++Q+ MG  Q+G +  Y+++ M+ GF T S+L V+ SQM  +LG  I R SG G L    Y     I  T    VV +++C+++L    E LN   K +LK PFPI+L+VV+  T+ S+F  F   Y+  I G+IP G   P  P+ ++ PR+  DA+ + I+GF +  +L+
Sbjct:   47 ELKSFFLNLFPVLRWLPKYKVREWILGDFMSGLIVGILLVPQCIAYSLLAGQDPIYGLYTSFFACIIYFLMGTSKHISVGIFGVLCLMIGQVVDRELQVAGFAEEGIKGHDHVVNNSMNFSNSDEENGFTVMIGGLPCGRSCFAIAVGTTVTFMAGVYQVVMGIFQMGFVSIYLSEPMLSGFVTGSSLTVLTSQMKYLLGIHIPRASGAGALLKTWYHIFSQISNTNVCDVVTSIICILVLVPAKE-LNEHFKARLKAPFPIELVVVVAATLASHFGGFKENYSSSIAGHIPTGFLPPRAPEWTLIPRIAADAVPIAIIGFAITVSLS 373          

HSP 2 Score: 146.747 bits (369), Expect = 1.131e-73
Identity = 96/326 (29.45%), Postives = 180/326 (55.21%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTD-LYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPR-RIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKF---AEDNLSRIMYVTIHDAIL 2145
            E++A G  NIV +FF+   ++ ALA++ V    G ++Q++ +++  ++L VLL I PLF S+   VL  I +V+L+    +  ++P +++ S+ D  +W V+ LA+  ++   GL+ G   SLL  I+R Q P++ L G +  T+  Y +++ + +  E+PG+++F +DAP+Y+AN E+F+++L+ KT ++P   +   KK     +   +++ ++       Q  +  N     F              D  +IVID S++ ++D+V +  ++ I   Y+ +GI++ LA  N  +   L + K     EDNL+   +  IHDA+L
Sbjct:  389 EMIAIGFCNIVPAFFYSFTTSAALAKTLVKEATGCQTQMSAVVTAGVLLLVLLLIAPLFYSLQKCVLGVITIVNLRGAFRKFLDIPRMWQESRVDTSIWFVTMLASALISTEIGLLVGVCVSLLVFIVRTQRPRAALYGCVHDTNNFYADLEAYSNVAEVPGVRVFHFDAPLYYANKEYFKSQLFLKTRVNPALEVAAQKKRQEKLQKRKKLSGSDNGEIVNKQAMLEFNKLLPTF--------------DFHTIVIDCSAMQFMDSVGVGAVKSIMKDYQSIGIRVILACCNPTVMDSLHRGKCISTIEDNLT---FCLIHDAVL 697          
BLAST of slc26a-5 vs. Ensembl Sea Lamprey
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 172.555 bits (436), Expect = 1.262e-64
Identity = 111/337 (32.94%), Postives = 197/337 (58.46%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFE---XXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKE-LTVEKNINQINSAEATTD-ETTQLRIHENNTK----VDFXXXXXXXXXXXXISDT-------KSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRI-MYVTIHDAI 2142
            ELVA GLSNI GS F     + A++RS V    G ++QVA ++S +L+L V+L I  LF        + L+++++V+LK M  Q  +VP L++  + D  +WMV+F A+V L +  GL     F+LL+++IR Q P+  +LG++P TD+Y ++K +  A E+ GI+IF+ +A +YFANA+ +   L  KTGLDPR +  ++K+ L  ++ + +    EA T+ ++  L + E  T+    VD  E  +  +P  E  +        + +V+D  +V +VD   +++L+ I+  ++++G+Q+ LAG    +   L ++ F     S+  +++++ DA+
Sbjct:  200 ELVAIGLSNIFGSIFHSFTISCAMSRSLVQDATGGQTQVAGLVSALLVLIVILAISSLFRPLPRSGQAALAAVVLVNLKGMFKQFADVPQLWRTCRIDLAMWMVTFWASVLLGLDLGLAVAVSFALLSVVIRTQTPKYSILGKIPNTDIYLDLKEYAEAKEVSGIRIFQTNASLYFANADMYTEALISKTGLDPRSLIAVRKKFLAHQQRLERKRRREAGTEAKSATLNLGEAVTRGGEAVDGAEAGHVVLPLEESEEQGLTSPAYRFLVLDFGAVTFVDTPGVKMLKRIFQEHKEVGVQVCLAGCRAVVVTQLERTGFLSGPSSKAQLFLSVPDAV 536          

HSP 2 Score: 92.8189 bits (229), Expect = 1.262e-64
Identity = 59/177 (33.33%), Postives = 105/177 (59.32%), Query Frame = 2
Query:  635 LQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
            + +++A T L GI+QLS+G  + G +  Y+++ M+ GFTTA ++HV ++Q+  + G  + RYSG          F  ++  T   ++++ ++C V L    E L    + +L  P P++L++V+L T+ S     + K+ V I+G+IP GL  P++P  +++ +V VDA+ L IVGF
Sbjct:    1 VSVAIAVTFLCGIYQLSLGMLRFGVVATYLSEPMVRGFTTACSIHVCVTQLKYMFGVSVSRYSGPLASEQTTIEFCSHLGHTNLVSLLLCVICTVGLAGSKE-LGDRYRNRLPAPIPLELILVVLATLASSGLELNEKHAVDIIGDIPTGLKPPVVPSFTLFGKVVVDAITLAIVGF 176          
BLAST of slc26a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003699.1 (pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 gene:ENSPMAG00000003383.1 transcript:ENSPMAT00000003699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 1.031e-20
Identity = 63/173 (36.42%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  677 QLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNI----KETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            QL M   QLG +  Y++D ++  FT A+A+HV++SQ+  +LG ++ R+SG   + + V+   V+I      T    +V +LVC+ +L    E +N   K KLK P P++LL+++L TVIS++     K+ V +VGNIP GLP P +P ++ +  +  D L + IVG+ ++ +L
Sbjct:    1 QLIMFSLQLGFVAIYLSDPLVSAFTNAAAIHVLVSQIKNMLGLQVPRFSGPASI-FMVFQTMVDIFQKLPNTNIAELVTSLVCLTVLIPVRE-INQRYKSKLKAPIPVELLLIVLATVISFYARLEEKFGVTVVGNIPAGLPVPQLPTVTNFSSLIADGLAIAIVGYAVSVSL 171          

HSP 2 Score: 35.4242 bits (80), Expect = 1.031e-20
Identity = 16/39 (41.03%), Postives = 26/39 (66.67%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQV 1299
            EL A+G+ N+ GSFF C  SA +++R+++    G  +QV
Sbjct:  188 ELFAHGVCNLFGSFFQCFPSAASISRTSIQEGTGGNTQV 226          
BLAST of slc26a-5 vs. Ensembl Sea Lamprey
Match: slc26a11 (solute carrier family 26 member 11 [Source:ZFIN;Acc:ZDB-GENE-030131-5349])

HSP 1 Score: 75.485 bits (184), Expect = 1.574e-14
Identity = 51/155 (32.90%), Postives = 83/155 (53.55%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYK 808
            D VAG+T+ +  +PQ +AY  +AGL    GLY++F    VY L GTS+ ++LG  +IM+L+ SV + R           + +Y                 +V  T L+G  QL MG  +LG ++ +++  ++ GFT A+A+ +  SQ+  +LG K
Sbjct:    9 DLVAGLTVGLTVVPQSLAYAQVAGLPAQYGLYSAFMGCFVYCLLGTSKDVTLGPTAIMSLVVSVYVRR-----------DPVY-----------------AVLLTFLSGAIQLLMGILRLGFLVEFISLPVLKGFTCAAAITIGFSQIKTLLGLK 135          
BLAST of slc26a-5 vs. Ensembl Yeast
Match: YPR003C_mRNA (Putative sulfate permease; physically interacts with Hsp82p; green fluorescent protein (GFP)-fusion protein localizes to the ER; YPR003C is not an essential gene [Source:SGD;Acc:S000006207])

HSP 1 Score: 67.0106 bits (162), Expect = 1.429e-16
Identity = 73/322 (22.67%), Postives = 131/322 (40.68%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPS--LYKLSKFDFD---VWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIF-----------KSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGP--NHRIRKMLTKSKFA 2094
            ELVA G  NIV S F    + G   RS +    G +S ++ +   V+ L  +     L + V       + V++    +  + EVP    + L    F    V+ V+F  T+F ++  G+  G ++S++ II      + Q+L R+ GT  + N+  +           +   EI G  I R   P+ F N+E  + +L +       +I P +K L  + +I                                           K ++ DL  +  +D+ A ++LEEI +SY++  + ++L     N ++R+ L K+  A
Sbjct:  410 ELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNL---LLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDSI-------------------------------------------KYVIFDLGGMTSIDSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFKAGVA 685          

HSP 2 Score: 36.5798 bits (83), Expect = 1.429e-16
Identity = 63/270 (23.33%), Postives = 119/270 (44.07%), Query Frame = 2
Query:  407 LAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALL-----SSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRY----SGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYL---NXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIP----KGLPYPMI-PDISIWPRVFVDALILGIVGF 1165
            +A + P+ GLY+    P VY + G+   + +G  S ++L+      S+ L +E    NV++++                    IS   T ++G   L  G ++ G + N ++ A++ GF ++  L +II+ +  I   K+ ++          P++  LF ++    Q+           ++ LF   L     +   K    FP  LLVVI+  +IS  F+   +Y + I+G+        L  P+  P   + P +F  +LI+ ++GF
Sbjct:  144 IAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKE----NVSLID--------------------ISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSL--ISELKLDKFLVSLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAIFFPDILLVVIVTILISMKFNLKHRYGISIIGDFSMDNFDELKNPLTRPRRKLIPDLFSASLIVAMLGF 387          
BLAST of slc26a-5 vs. Ensembl Yeast
Match: SUL1 (High affinity sulfate permease of the SulP anion transporter family; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000000498])

HSP 1 Score: 76.2554 bits (186), Expect = 8.958e-15
Identity = 47/157 (29.94%), Postives = 78/157 (49.68%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSS---VPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGY 805
            D VAGIT+    +PQ M+Y  +A L P  GLY+SF    +Y LF TS+ + +G  ++M+L ++     +L++Y                      T+ T   I+    LL GI    +G  +LG ++  ++   + GF T SA ++I  Q+  ++GY
Sbjct:  124 DLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEDQ------------------TEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAFNIIWGQIPALMGY 262          

HSP 2 Score: 48.1358 bits (113), Expect = 4.000e-6
Identity = 32/141 (22.70%), Postives = 75/141 (53.19%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRL 1605
            EL+A G++N++G+FF    + G+ +RSA+  +  +++  + + +   +L  L  +   F  +P + LS++I+ ++  +L       + +K +  D   ++V+   TVF ++  G+     +S   ++++   P  + LGR+
Sbjct:  427 ELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRV 567          
BLAST of slc26a-5 vs. Ensembl Yeast
Match: SUL2 (High affinity sulfate permease; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000004082])

HSP 1 Score: 70.8626 bits (172), Expect = 4.271e-13
Identity = 45/162 (27.78%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  320 YQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGY 805
            Y   +   D +AGIT+    +PQ M+Y  +A L    GLY+SF     Y  F TS+ + +G  ++M+L          Q + V     + Y +    +     T   I+    LL GI   ++GF +LG ++  ++   + GF T SA +++  Q+  ++GY
Sbjct:  132 YNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSL----------QTAKVIADVTAKYPDGDSAI-----TGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGY 278          

HSP 2 Score: 58.151 bits (139), Expect = 3.578e-9
Identity = 37/141 (26.24%), Postives = 80/141 (56.74%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRL 1605
            EL+A G+SN++G+FF    + G+ +RSA+  +  +++ ++ + S   +L  L  +   F  +P + LS++I+ ++  +L       + +K++  DF  ++V+ L TVF ++  G+     +S   +I+++  P  + LGR+
Sbjct:  443 ELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRV 583          
BLAST of slc26a-5 vs. Ensembl Nematostella
Match: EDO49691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG03])

HSP 1 Score: 143.665 bits (361), Expect = 5.021e-62
Identity = 103/294 (35.03%), Postives = 163/294 (55.44%), Query Frame = 2
Query:  329 KFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLRE---YQISNVTMMNNSIYTNSSKTLAIT------DDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            K  + D   G+T+ V HIPQG+A+ +LA L P+ GLY +  P ++Y+L GTS++LS G+F+++ L+ +    RE   Y  + +T    + Y  SS    +       D  K++I+V   LL GI Q+ MG  +LG +  Y++D +I GFTT SA+ V++SQ+  I G  + + +G      KV    +    +     +IT V  +++ +  +++N   KK+L  P P +LLVV LGT ISY  S S ++ V ++G IPKGLP   IP       +  DA ++ +V F  N +L
Sbjct:   86 KEFVADLTGGMTVGVMHIPQGLAFAMLASLPPVTGLYTALIPVMIYMLMGTSKYLSQGSFAVICLMVAQVSEREVQSYTPTPLTTPITAPYNASSSQPPMVGPWSELDSRKMEIAVTLALLIGIMQILMGLCRLGFVATYLSDPLISGFTTGSAVLVVLSQLKHIFGQVVPQNTGAFA-SIKVAAHMLKFIASSNPGAIITGVLCLVILVTLKFINEKYKKRLPIPIPAELLVVALGTAISYGASLSDEFGVKVLGEIPKGLPPISIPSFKRMRTIVPDAFVISVVIFATNISL 378          

HSP 2 Score: 113.62 bits (283), Expect = 5.021e-62
Identity = 94/327 (28.75%), Postives = 171/327 (52.29%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKS-QVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKEL-----TVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAIL 2145
            EL+AYG+ N+ GSFF C     ALAR+  VVQ  + S Q+ +I    L+L VLLF+ PLF  +P ++L+++++ +L  +L Q   +  L+ + + D   W V+    + L V  GL  G + ++  +IIR   P+  +LG +  T+LYR+ +    A  IP +KI R+++ ++FANA   + ++   + ++P  + P K+E      T E  +    +AE  + +TT+    E                    ++ K++++D S+  ++D+V I  ++ I +     G+ + LA  ++ +RK L          +  ++V+IHDA+L
Sbjct:  395 ELLAYGMCNVGGSFFSCFPICNALART--VVQENLASTQLCSIPVICLILLVLLFMAPLFYYLPKAILAAVVIANLGGLLKQFARLRQLWCICRTDAVTWFVTCFGVILLGVDLGLGLGVITTIFVVIIRQSRPRVSILGHIKDTELYRDTQECPQAAGIPNVKILRFESSLFFANAGFIKERIM--SFMNP--LTPTKRECIPGITTDEAEVTMELNAEKESLDTTKRTNREQGVN----------------ANIKAVIVDASAFTFIDSVGITAIKTIITEGDSRGVHVCLAACSYHLRKQLEAGGLEPSLNNDHLFVSIHDAVL 699          
BLAST of slc26a-5 vs. Ensembl Nematostella
Match: EDO48275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ6])

HSP 1 Score: 88.5817 bits (218), Expect = 2.623e-18
Identity = 65/210 (30.95%), Postives = 109/210 (51.90%), Query Frame = 2
Query:  182 LHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLM-ASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYK 808
            L +  +++E+      S ++K+  + I   T       FP     S Y   FL  D +AG+T+ +  +PQG+AY L+AGL P  GLY++F    VY +FGTS+ ++LG  +IM+L+ S      Y  S +                          +  TLL+G+ QL MG  +LG ++N+++  ++ GFT+++A+ + ISQ+  +LG K
Sbjct:    5 LPKTQHQEELEEKCAESCQRKIDLEAIKKYTKKR----FPIAKWLSKYNLHFLQCDLIAGLTVGLMVVPQGLAYALVAGLPPQYGLYSAFMGCFVYCVFGTSKDITLGPTAIMSLIVSA-----YGKSEIPAF----------------------VMVLTLLSGVIQLLMGILKLGFLVNFISIPVVSGFTSSAAIIIAISQIKDVLGLK 183          
BLAST of slc26a-5 vs. Ensembl Nematostella
Match: EDO48274 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ5])

HSP 1 Score: 76.6406 bits (187), Expect = 2.710e-16
Identity = 54/171 (31.58%), Postives = 94/171 (54.97%), Query Frame = 2
Query:  344 DFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYK-IKRYSGVGELPYKVY 853
            D + G+T+ +  IPQG+AY  +AGL  + GLY++F    +Y +FGTS+ +SLG  +IM+L+                +N   Y + S+     +D   + ++A    +G+ Q +MGF + G ++ +++  +I GFT+A+A+ +   Q+  ILG + I+R     E  Y VY
Sbjct:   18 DMIGGLTVGLMVIPQGLAYATIAGLPTVYGLYSAFMGCFIYCIFGTSKDVSLGPTAIMSLI----------------VNQ--YCHYSE-----EDEDTRFAIALAFFSGLIQFAMGFFRFGFLVRFISVPVISGFTSAAAITIAAGQLKSILGLQHIRR-----EFIYCVY 160          
BLAST of slc26a-5 vs. Ensembl Nematostella
Match: EDO34158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ57])

HSP 1 Score: 65.4698 bits (158), Expect = 3.341e-13
Identity = 32/69 (46.38%), Postives = 47/69 (68.12%), Query Frame = 2
Query:  314 SFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMA 520
            S Y   FL  D +AG+T+ +  +PQG+AY L+AGL P  GLY++F    VY +FGTS+ ++LG  +IM+
Sbjct:   23 SKYNLHFLQCDLIAGLTVGLMVVPQGLAYALVAGLPPQYGLYSAFMGCFVYCVFGTSKDITLGPTAIMS 91          
BLAST of slc26a-5 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 199.519 bits (506), Expect = 4.970e-92
Identity = 133/361 (36.84%), Postives = 202/361 (55.96%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRI---------------KPLKKELTVEKNIN------------------QINSA---EATTDETTQLRIHENN-TKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            EL+A GLSN +GSFF C     +L+RS V    G  +Q+A ++S +LML +++ IG LFE +P +VLS+I+ V+LK M  Q  +VP L+K +K D  VW+V+F++TV  N+  GL     FS+LT I + Q P   +LG +P TDLY + + FK   EIPGIKIFR  A + F NAE +   L +++GLD R++               K +KK L  EKN++                   +NSA   +ATT E       ENN T + +   E+       +S T SI++D+S+  +VD V +++L+ I+  +  + + ++LAG    + + L K+ F E      ++VT+HDA+L IL
Sbjct:  373 ELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGNVPSTDLYLDTEAFKQVKEIPGIKIFRSSATICFTNAELYLEALQQRSGLDVRKLQMEKKKRAKQEKMAKKEVKKSLNKEKNLSMHKDVAIFLTNTSSNGFGHVNSAYQYDATTSEIDSGCHGENNLTPISY---EHEKDGRTCMSVTHSIILDISTTGFVDTVTVKMLKNIFGDFADVDVDIYLAGCQACVVEQLEKAAFFESIPKTRLFVTVHDAVLHIL 730          

HSP 2 Score: 159.458 bits (402), Expect = 4.970e-92
Identity = 109/359 (30.36%), Postives = 199/359 (55.43%), Query Frame = 2
Query:  161 PIYSYENLHRDYNED------------EITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIY---TNSSKTLAIT--DDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSALN 1186
            P++ Y  +HRD  ++             I   +    K+ ++    + + +++  +P    +  +   + ++ D V+G ++ + H+PQGMAY LLA L P+ GLY S FP LVY++FGTSRH+S+GTF++++++          ++     + + Y   TN S T+ I   D  ++Q++ + TLL+GIFQ+ +G  + G +  Y+++ ++ G+TT +A HV +SQ+  + G K  R++G   L Y +      + +T+   +V++LV + +L +  E +N    KKL  P PI+L+VVI  T+I +F      Y + +VG IP GL  P  PD++ + ++  DA+ + IV + +  +L 
Sbjct:    8 PVHRYA-VHRDVLDELGLEEVAQKGTWSIKPTVGEKLKESLRCSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAVISIMVG-------SVTERLAPDEAFYFNGTNGSLTVNIDARDAYRVQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIVVKE-INACYSKKLPLPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFFSQLIGDAIAVAIVSYAITISLG 357          
BLAST of slc26a-5 vs. Ensembl Medaka
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101169607])

HSP 1 Score: 181.415 bits (459), Expect = 4.456e-91
Identity = 117/337 (34.72%), Postives = 190/337 (56.38%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEK---------------NINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAIL 2145
            ELVA GLSN +G  F C   + +++RS V    G K+QVA  +S V++LF+ L+IG LFE +P +VL++II V+L+ ML Q  ++ +L+K SK D  +W+ +F+ T+ LN   GL A   FS+LT+I R Q P+  +LGR+  TD+Y+ +  +    E+PGI IFR  A +YFANAE +Q  L KK+G+D  +I   KK+L  ++                IN +N  +   +E   + +   + + +              S  ++I++DLS VN++D V ++ +  I   Y ++GI++ LA     +   L    F  + +++  ++ TIHDA+L
Sbjct:  369 ELVALGLSNSIGGIFQCFAISCSMSRSLVQESSGGKTQVAGALSAVVILFITLWIGTLFEDLPKAVLAAIIHVNLQGMLKQFMDIFALWKSSKIDMMIWIATFILTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSILGRVEDTDIYKPLDGYSKVKELPGILIFRSSATLYFANAEMYQEALGKKSGIDITKILSAKKKLEAKRIRHEKKVAKKAKKEQKINGVNMEQHDNEEPEDIAVIHVDPEPN-------------PSLPQAIILDLSPVNFLDTVGVKTIRNIRRDYGEIGIEVVLAACQPGVVDNLEAGGFFNEKVTKSCLFSTIHDAVL 692          

HSP 2 Score: 174.481 bits (441), Expect = 4.456e-91
Identity = 112/341 (32.84%), Postives = 195/341 (57.18%), Query Frame = 2
Query:  143 SYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
             Y+V+R I     +    ++D+  F      K+ ++      +  +   +P    +  +   ++ + D ++GI++ +  +PQGMAY LLA + PI GLY+SF+P L+Y +FGTS+H+SLGT+++M+++      R    S+    +N        T+A  D  +++++ A T ++GIFQ+ +G  Q G ++ Y+++ ++ G+TTA+A+HVI+SQ+    G    RYSG   L Y V      + +T   T+V+TLV ++ LFL  E LN  + KK+  P P +L+ +I+ T++S+    S KY + +VG IP GL  P+ PD+ ++  V  DA  L +VG+
Sbjct:    8 DYRVQRQILDEGEVDELAHKDDSHFPFSERVKKSVRCSGPRLKKALFSTIPILSWLPRYPFKEYAVGDLISGISVGIMQLPQGMAYALLASVPPIFGLYSSFYPVLIYFIFGTSKHISLGTYAVMSVMIGGVTERLAPDSDFMTWDNVTNATLIDTVA-RDAERVRVAAAVTFMSGIFQILLGVVQFGFVVTYLSEPLVRGYTTAAAIHVIVSQLKYSFGISPDRYSGPLSLIYTVIEICYLLPKTNIGTLVVTLVAILGLFLAKE-LNAYLSKKIPVPIPTELIAIIIATIVSWQVDLSGKYGIDVVGEIPSGLQPPVFPDVKLFAPVIGDAFALSVVGY 346          
BLAST of slc26a-5 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 189.889 bits (481), Expect = 1.044e-88
Identity = 133/384 (34.64%), Postives = 202/384 (52.60%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKK--------------------------------------ELTVEKNIN------------------QINSA---EATTDETTQLRIHENN-TKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            EL+A GLSN +GSFF C     +L+RS V    G  +Q+A ++S +LML +++ IG LFE +P +VLS+I+ V+LK M  Q  +VP L+K +K D  VW+V+F++TV  N+  GL     FS+LT I + Q P   +LG +P TDLY + + FK   EIPGIKIFR  A + F NAE +   L +++GLD R+++  KK                                      EL  EKN++                   +NSA   +ATT E       ENN T + +   E+       +S T SI++D+S+  +VD V +++L+ I+  +  + + ++LAG    + + L K+ F E      ++VT+HDA+L IL
Sbjct:  372 ELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGNVPSTDLYLDTEAFKQVKEIPGIKIFRSSATICFTNAELYLEALQQRSGLDVRKLQMEKKKRAKQEKMAKKEVKKSVIEIHKDLLDHPCNSTSSSKVSELNKEKNLSMHKDVAIFLTNTSSNGFGHVNSAYQYDATTSEIDSGCHGENNLTPISY---EHEKDGRTCMSVTHSIILDISTTGFVDTVTVKMLKNIFGDFADVDVDIYLAGCQACVVEQLEKAAFFESIPKTRLFVTVHDAVLHIL 752          

HSP 2 Score: 158.303 bits (399), Expect = 1.044e-88
Identity = 103/324 (31.79%), Postives = 187/324 (57.72%), Query Frame = 2
Query:  227 RSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIY---TNSSKTLAIT--DDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
               K+ ++    + + +++  +P    +  +   + ++ D V+G ++ + H+PQGMAY LLA L P+ GLY S FP LVY++FGTSRH+S+GTF++++++          ++     + + Y   TN S T+ I   D  ++Q++ + TLL+GIFQ+ +G  + G +  Y+++ ++ G+TT +A HV +SQ+  + G K  R++G   L Y +      + +T+   +V++LV + +L +  E +N    KKL  P PI+L+VVI  T+I +F      Y + +VG IP GL  P  PD++ + ++  DA+ + IV + +  +L
Sbjct:   40 EKLKESLRCSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAVISIMVG-------SVTERLAPDEAFYFNGTNGSLTVNIDARDAYRVQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIVVKE-INACYSKKLPLPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFFSQLIGDAIAVAIVSYAITISL 355          
BLAST of slc26a-5 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 189.889 bits (481), Expect = 1.841e-85
Identity = 133/384 (34.64%), Postives = 202/384 (52.60%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKK--------------------------------------ELTVEKNIN------------------QINSA---EATTDETTQLRIHENN-TKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            EL+A GLSN +GSFF C     +L+RS V    G  +Q+A ++S +LML +++ IG LFE +P +VLS+I+ V+LK M  Q  +VP L+K +K D  VW+V+F++TV  N+  GL     FS+LT I + Q P   +LG +P TDLY + + FK   EIPGIKIFR  A + F NAE +   L +++GLD R+++  KK                                      EL  EKN++                   +NSA   +ATT E       ENN T + +   E+       +S T SI++D+S+  +VD V +++L+ I+  +  + + ++LAG    + + L K+ F E      ++VT+HDA+L IL
Sbjct:  321 ELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGNVPSTDLYLDTEAFKQVKEIPGIKIFRSSATICFTNAELYLEALQQRSGLDVRKLQMEKKKRAKQEKMAKKEVKKSVIEIHKDLLDHPCNSTSSSKVSELNKEKNLSMHKDVAIFLTNTSSNGFGHVNSAYQYDATTSEIDSGCHGENNLTPISY---EHEKDGRTCMSVTHSIILDISTTGFVDTVTVKMLKNIFGDFADVDVDIYLAGCQACVVEQLEKAAFFESIPKTRLFVTVHDAVLHIL 701          

HSP 2 Score: 147.517 bits (371), Expect = 1.841e-85
Identity = 90/322 (27.95%), Postives = 159/322 (49.38%), Query Frame = 2
Query:  227 RSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAIT--DDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSALN 1186
               K+ ++    + + +++  +P    +  +   + ++ D V+G ++ + H+PQGMAY LLA L P+ GLY S FP LVY++FGTSRH+S+GTF++++++  V  + E    +     N   TN S T+ I   D  ++Q++ + TLL+GIFQ+ +G  + G +  Y+++ ++ G+TT +A HV +SQ+  + G K  R++G   L Y                                                    VI  T+I +F      Y + +VG IP GL  P  PD++ + ++  DA+ + IV + +  +L 
Sbjct:   40 EKLKESLRCSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAVISIM--VGSVTERLAPDEAFYFNG--TNGSLTVNIDARDAYRVQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIY----------------------------------------------------VIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFFSQLIGDAIAVAIVSYAITISLG 305          
BLAST of slc26a-5 vs. Ensembl Medaka
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101169607])

HSP 1 Score: 174.866 bits (442), Expect = 2.153e-85
Identity = 112/341 (32.84%), Postives = 195/341 (57.18%), Query Frame = 2
Query:  143 SYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGF 1165
             Y+V+R I     +    ++D+  F      K+ ++      +  +   +P    +  +   ++ + D ++GI++ +  +PQGMAY LLA + PI GLY+SF+P L+Y +FGTS+H+SLGT+++M+++      R    S+    +N        T+A  D  +++++ A T ++GIFQ+ +G  Q G ++ Y+++ ++ G+TTA+A+HVI+SQ+    G    RYSG   L Y V      + +T   T+V+TLV ++ LFL  E LN  + KK+  P P +L+ +I+ T++S+    S KY + +VG IP GL  P+ PD+ ++  V  DA  L +VG+
Sbjct:    8 DYRVQRQILDEGEVDELAHKDDSHFPFSERVKKSVRCSGPRLKKALFSTIPILSWLPRYPFKEYAVGDLISGISVGIMQLPQGMAYALLASVPPIFGLYSSFYPVLIYFIFGTSKHISLGTYAVMSVMIGGVTERLAPDSDFMTWDNVTNATLIDTVA-RDAERVRVAAAVTFMSGIFQILLGVVQFGFVVTYLSEPLVRGYTTAAAIHVIVSQLKYSFGISPDRYSGPLSLIYTVIEICYLLPKTNIGTLVVTLVAILGLFLAKE-LNAYLSKKIPVPIPTELIAIIIATIVSWQVDLSGKYGIDVVGEIPSGLQPPVFPDVKLFAPVIGDAFALSVVGY 346          

HSP 2 Score: 162.54 bits (410), Expect = 2.153e-85
Identity = 110/322 (34.16%), Postives = 173/322 (53.73%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSR-IMYVTIHDAIL 2145
            ELVA GLSN +G  F C   + +++RS V    G K+QVA  +S V++LF+ L+IG LFE +P +VL++II V+L+ ML Q  ++ +L+K SK D  +W+ +F+ T+ LN   GL A   FS+LT+I R Q P+  +LGR+  TD+Y+ +  +    E+PGI IFR  A +YFANAE +Q  L KK                                       H+N    D      +  P+  +   ++I++DLS VN++D V ++ +  I   Y ++GI++ LA     +   L    F  + +++  ++ TIHDA+L
Sbjct:  369 ELVALGLSNSIGGIFQCFAISCSMSRSLVQESSGGKTQVAGALSAVVILFITLWIGTLFEDLPKAVLAAIIHVNLQGMLKQFMDIFALWKSSKIDMMIWIATFILTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSILGRVEDTDIYKPLDGYSKVKELPGILIFRSSATLYFANAEMYQEALGKK-------------------------------------EQHDNEEPEDIAVIHVDPEPNPSLP--QAIILDLSPVNFLDTVGVKTIRNIRRDYGEIGIEVVLAACQPGVVDNLEAGGFFNEKVTKSCLFSTIHDAVL 651          
BLAST of slc26a-5 vs. Planmine SMEST
Match: SMESG000052053.1 (SMESG000052053.1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 351/352 (99.72%), Postives = 352/352 (100.00%), Query Frame = 2
Query:  128 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASAL+VIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRTVVITLVCVVILFLFTEYLNPIIKKKLKFPFPIQLLVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL
Sbjct:    1 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALYVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRTVVITLVCVVILFLFTEYLNPIIKKKLKFPFPIQLLVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 352          

HSP 2 Score: 484.567 bits (1246), Expect = 0.000e+0
Identity = 272/273 (99.63%), Postives = 272/273 (99.63%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEE 2001
            ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFESVPTSVLSSIIVVSLKSMLMQITEVP LYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFVEEENNSVPSVEISDTKSIVIDLSSVNYVDNVAIRILEE
Sbjct:  369 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFESVPTSVLSSIIVVSLKSMLMQITEVPGLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFVEEENNSVPSVEISDTKSIVIDLSSVNYVDNVAIRILEE 641          
BLAST of slc26a-5 vs. Planmine SMEST
Match: SMESG000052008.1 (SMESG000052008.1)

HSP 1 Score: 374.015 bits (959), Expect = 0.000e+0
Identity = 202/353 (57.22%), Postives = 265/353 (75.07%), Query Frame = 2
Query:  128 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAIT-DDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            M  T  YKVERPIYSYE    D+ E+E  F++ ++   K + + + F  V+ +I+PFPF+MASFY+ +F+  D V+GITMLVFHIPQGMA+GLL+G++PINGLYASFFPPL Y LFGTSRH+SLGTFSIM+LLSSVP++RE +      +NNS+  N +    I+ +  KLQI++AT LLAGI Q+ MG  QLGCIMNY+N  +IGGFTTA+A H+I+SQ+  +LGY ++RYSGVGELPYK+YLF  NIK+    T  +++ C++IL LF  ++NPI+KKK   P PIQL++VI GT+ISY  S   KY+V IVG IPKG P PMIPD+ IWP++ +DA+ L I  FVMNS+L
Sbjct:    1 MGDTPQYKVERPIYSYERFTHDFVEEEKPFDILKTLSYKSRLQQLTFPMVLYYIMPFPFIMASFYKFRFIFNDIVSGITMLVFHIPQGMAFGLLSGVQPINGLYASFFPPLTYFLFGTSRHISLGTFSIMSLLSSVPVMREAR----RPVNNSLAINGTMPQIISYEMVKLQIAIATALLAGIIQIIMGLCQLGCIMNYVNITLIGGFTTATAFHIILSQLGSLLGYSVRRYSGVGELPYKLYLFLSNIKDVHQITFSLSIACLLILALFNVFINPIVKKKFDVPIPIQLILVIFGTIISYSISLGSKYSVMIVGTIPKGFPSPMIPDVRIWPKITLDAIALAIFAFVMNSSL 349          

HSP 2 Score: 306.99 bits (785), Expect = 0.000e+0
Identity = 168/324 (51.85%), Postives = 233/324 (71.91%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            ELVAYGLSN+ GSFF C  S+ ++ R+AVVV VGMKSQ+A++ISCVLM+ VLLF+GPLFE +P  VL++I+V SLK  LM+I E+P LY LSK DF++W+VSF+AT+ LNVPYGL  GF+FSL+T+ +R  NP+S +LG+LP T++Y+N+K +K A+EIPGIKIFRY+AP+YFANA+HFQ KL KK  +DPR +  L      E           T  ET+ LR  E + K D+             ++ K I++D   VNYVDNVA+R L +IY  Y+++G+ +++A PN ++++ LTK+ FA+D + +I +VTIHDA+L IL
Sbjct:  366 ELVAYGLSNVFGSFFQCIPSSASMTRTAVVVDVGMKSQMASVISCVLMMLVLLFLGPLFEHLPKCVLAAIVVSSLKGNLMRIKELPKLYNLSKLDFEIWIVSFVATILLNVPYGLFVGFIFSLMTVYMRFHNPKSSILGKLPNTNVYQNVKTYKDAIEIPGIKIFRYEAPIYFANADHFQNKLIKKVRVDPRILTDLLSSPNSE--------VYKTKTETSMLRPVEKSYK-DYESN----------NNLKFIILDFRPVNYVDNVAVRTLSDIYKLYKEIGVFVYIAEPNFKVKRSLTKAGFAKDRIDKITFVTIHDAVLKIL 670          
BLAST of slc26a-5 vs. Planmine SMEST
Match: SMESG000051986.1 (SMESG000051986.1)

HSP 1 Score: 373.629 bits (958), Expect = 0.000e+0
Identity = 201/353 (56.94%), Postives = 266/353 (75.35%), Query Frame = 2
Query:  128 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAIT-DDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            M +   YK+ERPIYSYEN   DY E+E  F++ ++   K + + + F  V+ +I+PFPF+MASFY+ +F+  D V+GITMLVFHIPQGMA+GLL G++PINGLYASFFPPL Y LFGTSRH+SLGTFSIM+LLSSVP++RE +      +NNS+  N +    ++ +  KLQI++AT LLAGI Q+ MG  QLGCIMNY+N  +IGGFTTA+A H+I SQ+  +LGY ++RYSGVGELPYK YLF  NI++    T  +++ C++IL LFT ++NPI+KKK   P PIQL++VI+GT+ISY+ S   KY+V IVG IPKG P PM+PDI IWP++ +DA+ L I  FVMNS+L
Sbjct:    1 MGEVPKYKIERPIYSYENFSNDYVEEEKPFDILKTLSYKSRLQQLTFPMVLYYIMPFPFIMASFYKFRFIFNDIVSGITMLVFHIPQGMAFGLLTGVQPINGLYASFFPPLTYFLFGTSRHISLGTFSIMSLLSSVPVMREAR----RPVNNSLAINGTMPQIMSYEMVKLQIAIATALLAGIIQIIMGLCQLGCIMNYVNITLIGGFTTATAFHIIFSQLGSLLGYSVRRYSGVGELPYKFYLFVSNIRDIHPVTFSLSISCMLILLLFTLFINPIVKKKFDIPIPIQLILVIIGTIISYYLSLGSKYSVKIVGTIPKGFPKPMVPDIKIWPKITLDAIALAIFAFVMNSSL 349          

HSP 2 Score: 327.791 bits (839), Expect = 0.000e+0
Identity = 170/324 (52.47%), Postives = 235/324 (72.53%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILSIL 2154
            ELVAYGL+N+VGSFF C  ++ A+ R+AVVV VGMKSQ+A+++SC+LM+ VLLF+GPLFE +P  VL++IIV SLK +L Q+ E+P LY LSK DF+VW+VSF+AT+ LNVPYGL  GF+FSL+T+ +R  NP+S +LG+LP T++Y+N+K +K A+EIPGIKIFRY+AP+YFANA+HFQ KL KK  +DPR +  L      E           T  ET+ LR  E   K D+             ++ K I++D   VNYVDNVA+R L +IY  Y+++G+ +++A PN R++K+LTKS FA+D++ +I +VTIHDA+L IL
Sbjct:  366 ELVAYGLANMVGSFFQCIPTSAAMTRTAVVVDVGMKSQMASLVSCILMMLVLLFLGPLFEPLPKCVLAAIIVASLKGILSQVKELPRLYNLSKLDFEVWIVSFVATILLNVPYGLFVGFIFSLMTVYMRFHNPKSSILGKLPHTNIYQNVKTYKDAIEIPGIKIFRYEAPIYFANADHFQNKLIKKVRVDPRILTDLLSSPNSE--------VYKTKTETSMLRPVEKTFK-DYESN----------NNLKFIILDFRPVNYVDNVAVRALSDIYKLYKEIGVFVYIAEPNFRVKKLLTKSGFAKDHIDKITFVTIHDAVLKIL 670          
BLAST of slc26a-5 vs. Planmine SMEST
Match: SMESG000071473.1 (SMESG000071473.1)

HSP 1 Score: 330.872 bits (847), Expect = 2.261e-175
Identity = 196/357 (54.90%), Postives = 259/357 (72.55%), Query Frame = 2
Query:  128 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTN-----SSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            M+K  SY VERPIYSYE L  ++ E++   +L  S K K K   +  +++   I PFPF+M SFY+ +FL+ D VAG+TML+FHIPQGM YG L+GLEPINGLYASF PPL+Y+LFGTSRH+S+GTFSI+A+L S  + RE  +      N +  TN     S + LA   +TKLQIS+ATTLLAGIFQL +G  + G +MNY++D+MI GFT A+A HV+ SQ S+ILGY I+ YSGVGELPYK++LFA  I   +W T  I++ C+V LFLF E++NPI ++K KFP P Q + +++ TVISY  + S  Y+V IVG+IPKGLP  ++P+ISI P+V  D+LIL IVGF+M+SAL
Sbjct:    1 MEKIVSYNVERPIYSYEELKNEFKEEKSQLSLIESLKLKGKGCKL--KSMAETIFPFPFIMMSFYKVRFLLSDLVAGVTMLIFHIPQGMTYGFLSGLEPINGLYASFIPPLIYLLFGTSRHISIGTFSIIAILISSTVNREVMLIKDLQGNGNSSTNNHNFSSYENLA---ETKLQISIATTLLAGIFQLGLGVLKFGKLMNYVSDSMISGFTCAAAFHVMFSQFSEILGYPIEIYSGVGELPYKLFLFASQIIGIKWITFSISIGCIVALFLFAEFVNPIFQRKFKFPLPFQFVFILIATVISYMTNISSNYSVKIVGHIPKGLPGLLVPNISIMPKVVTDSLILAIVGFIMDSAL 352          

HSP 2 Score: 305.834 bits (782), Expect = 2.261e-175
Identity = 172/322 (53.42%), Postives = 230/322 (71.43%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTDETTQLRIHENNTKVDFXXXXXXXXXXXXISDTKSIVIDLSSVNYVDNVAIRILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHDAILS 2148
            ELV YGL+NIVGS F CT+SAGA+AR++VVVQ GMKSQVATIISC  M FVL+F+GP FE VP  VLS+IIVVSLK M+MQ+T +PSLYK+S+FDF  W+++FL+T+ LNVP GL  GF FSLLTI+IRLQ  +S++LG+LP T++Y+N+K FK A+EI G+KIFR++AP+YFAN+EHF++KLYK  G                 N  QI   E + +E+T    H+ +  V            V +   K+IV+D S++NY+DNV IR+L+ IYS  +   I   +A PN R+R ML K +FA++ L++IM+VTIHDAIL+
Sbjct:  369 ELVGYGLANIVGSLFQCTISAGAMARTSVVVQAGMKSQVATIISCFFMFFVLMFVGPAFEYVPKCVLSAIIVVSLKGMIMQMTSLPSLYKVSRFDFYTWIITFLSTLLLNVPLGLCVGFAFSLLTIVIRLQTAKSEILGQLPNTNIYKNVKHFKDAIEISGVKIFRFEAPLYFANSEHFRSKLYKIFG-----------------NQLQITECEESLNESTISNEHKKDETV----------AIVLLDIIKTIVVDCSAINYIDNVGIRVLKSIYSDLKNHKITFLIASPNTRVRNMLEKCEFAKEELNKIMFVTIHDAILN 663          
BLAST of slc26a-5 vs. Planmine SMEST
Match: SMESG000071475.1 (SMESG000071475.1)

HSP 1 Score: 356.295 bits (913), Expect = 1.579e-164
Identity = 191/352 (54.26%), Postives = 261/352 (74.15%), Query Frame = 2
Query:  128 MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTVMMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPINGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMMNNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMNDAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKETQWRXXXXXXXXXXXXXXXXEYLNXXXXXXXXXXXXXXXXVVILGTVISYFFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNSAL 1183
            M++  +YK++RPIYSY++L + Y ED+  FN+ +S K K K    +F++++  I P PF+M  FY+ KFL+ DF+AG TML+FHIPQGMAYGLLAGL+PINGLY SFFPPL+Y+ FGTSRHLS+GTFSI+A+L+SVP LRE    + T+  N+    S       + +KLQ+S+ TTLLAGIFQ  MG  + G +MNY++DAMIGGFTTA+A HV++SQM +ILGY I RY+GVGELPYKV+L+   I ET W ++ I+ V +  + LF E +NP  +KK KFP PIQ ++V+  T+ISYF + S+ ++V IVG IPKG P  +IPD+ + P + +DALI+ +VGF++NSAL
Sbjct:    1 MNEGSNYKIDRPIYSYQDLTKYYAEDKQKFNILKSIKSKAKIPRPSFKSILERIFPLPFIMLLFYKPKFLLNDFIAGFTMLIFHIPQGMAYGLLAGLKPINGLYTSFFPPLIYMFFGTSRHLSMGTFSIIAILASVPTLREATF-HYTLNPNNTKIGSDFDNENFEYSKLQVSITTTLLAGIFQFVMGLFKFGSLMNYVSDAMIGGFTTAAAFHVLVSQMREILGYSIDRYTGVGELPYKVFLYFSKINETHWISIGISFVSIFAIVLFNEIINPRFQKKFKFPIPIQFILVVAATLISYFGNISKVWSVEIVGLIPKGFPSIIIPDVFLMPNIVIDALIIAVVGFIINSAL 351          

HSP 2 Score: 244.202 bits (622), Expect = 1.579e-164
Identity = 127/195 (65.13%), Postives = 167/195 (85.64%), Query Frame = 1
Query: 1183 ELVAYGLSNIVGSFFFCTMSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFEXXXXXXXXXXXXXXXXXMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAGFLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYDAPVYFANAEHFQTKLYKKTGLDPRRIK 1767
            E ++YGL NIVGSFF CT+S G+LAR+A+V QVGMKSQ+A++ISC+ M FVLLFIGPLF+ VPTSVLS+II+VSLK+++ Q++ +  LY+LSKFDF+VW+VSFLAT+ LNVP GL  G LFSLLTI+IRLQNP+S++LG+LPGT++Y+ +KIFK A EI GIKIFR++AP+YFANAE F+ KL++K  L+   +K
Sbjct:  368 ESISYGLCNIVGSFFQCTISCGSLARTALVAQVGMKSQIASLISCIFMFFVLLFIGPLFQYVPTSVLSAIIIVSLKNLIGQLSTLAKLYRLSKFDFNVWIVSFLATMLLNVPLGLTIGILFSLLTIVIRLQNPKSEVLGQLPGTNIYKCIKIFKDAKEISGIKIFRFEAPLYFANAEQFKDKLFRKAKLNINELK 562          
The following BLAST results are available for this feature:
BLAST of slc26a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC26A54.482e-9333.63solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A52.191e-9233.14solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A52.191e-9233.14solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A51.598e-8832.09solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A53.271e-8532.09solute carrier family 26 member 5 [Source:HGNC Sym... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sulp-56.954e-7035.67SULfate Permease family [Source:UniProtKB/TrEMBL;... [more]
sulp-61.177e-6334.76SULfate Permease family [Source:UniProtKB/TrEMBL;... [more]
sulp-61.177e-6334.76SULfate Permease family [Source:UniProtKB/TrEMBL;... [more]
sulp-41.327e-6133.66Anion transporter SULP-4; SULfate Permease family ... [more]
sulp-86.315e-6133.43Anion transporter SULP-8a; Anion transporter SULP-... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prestin4.216e-6529.63gene:FBgn0036770 transcript:FBtr0075153[more]
CG61257.395e-1931.67gene:FBgn0038337 transcript:FBtr0346109[more]
CG61257.395e-1931.67gene:FBgn0038337 transcript:FBtr0083105[more]
CG61257.856e-1931.67gene:FBgn0038337 transcript:FBtr0083106[more]
CG97022.759e-1825.88gene:FBgn0039787 transcript:FBtr0336449[more]
back to top
BLAST of slc26a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a62.864e-8833.80solute carrier family 26 member 6 [Source:ZFIN;Acc... [more]
si:ch211-117c9.21.558e-8734.44si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
si:ch211-117c9.21.722e-8734.44si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
slc26a101.511e-8432.82solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
slc26a61.387e-8335.71solute carrier family 26 member 6 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC26A52.031e-8432.95solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A51.269e-8132.92solute carrier family 26 member 5 [Source:NCBI gen... [more]
slc26a61.126e-8031.83solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a62.605e-8031.90solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a65.410e-8033.54solute carrier family 26 member 6 [Source:NCBI gen... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc26a52.357e-9233.33solute carrier family 26, member 5 [Source:MGI Sym... [more]
Slc26a52.337e-8432.09solute carrier family 26, member 5 [Source:MGI Sym... [more]
Slc26a25.464e-7431.36solute carrier family 26 (sulfate transporter), me... [more]
Slc26a55.948e-7433.33solute carrier family 26, member 5 [Source:MGI Sym... [more]
Slc26a62.093e-7040.50solute carrier family 26, member 6 [Source:MGI Sym... [more]
back to top
BLAST of slc26a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58743|S26A5_HUMAN1.983e-9233.63Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV... [more]
sp|Q99NH7|S26A5_MOUSE1.432e-9133.33Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=2 S... [more]
sp|Q9EPH0|S26A5_RAT9.758e-9133.04Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 P... [more]
sp|Q9JKQ2|S26A5_MERUN1.567e-9032.74Prestin OS=Meriones unguiculatus OX=10047 GN=SLC26... [more]
sp|Q65AC2|S26A2_HORSE7.557e-7832.29Sulfate transporter OS=Equus caballus OX=9796 GN=S... [more]
back to top
BLAST of slc26a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJE70.000e+0100.00Slc26a-5 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YJ970.000e+056.94Slc26a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YF716.471e-16353.42Slc26a-6 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4V3SF565.731e-11542.29STAS domain-containing protein OS=Opisthorchis fel... [more]
A0A4S2M0C24.436e-11240.77STAS domain-containing protein OS=Opisthorchis fel... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a65.627e-9436.39solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a68.274e-8733.14solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a3.22.039e-8434.97solute carrier family 26 member 3, tandem duplicat... [more]
slc26a3.26.308e-8434.97solute carrier family 26 member 3, tandem duplicat... [more]
slc26a3.27.025e-8434.97solute carrier family 26 member 3, tandem duplicat... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003427.11.131e-7333.23pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-... [more]
si:ch211-117c9.21.262e-6432.94si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
ENSPMAT00000003699.11.031e-2036.42pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 ge... [more]
slc26a111.574e-1432.90solute carrier family 26 member 11 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YPR003C_mRNA1.429e-1622.67Putative sulfate permease; physically interacts wi... [more]
SUL18.958e-1529.94High affinity sulfate permease of the SulP anion t... [more]
SUL24.271e-1327.78High affinity sulfate permease; sulfate uptake is ... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO496915.021e-6235.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482752.623e-1830.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482742.710e-1631.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341583.341e-1346.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc26a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-117c9.24.970e-9236.84solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a64.456e-9134.72solute carrier family 26 member 6 [Source:NCBI gen... [more]
si:ch211-117c9.21.044e-8834.64solute carrier family 26 member 6 [Source:NCBI gen... [more]
si:ch211-117c9.21.841e-8534.64solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a62.153e-8532.84solute carrier family 26 member 6 [Source:NCBI gen... [more]
back to top
BLAST of slc26a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052053.10.000e+099.72SMESG000052053.1[more]
SMESG000052008.10.000e+057.22SMESG000052008.1[more]
SMESG000051986.10.000e+056.94SMESG000051986.1[more]
SMESG000071473.12.261e-17554.90SMESG000071473.1[more]
SMESG000071475.11.579e-16454.26SMESG000071475.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029757
GenBankAKN21609.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029757 ID=SMED30029757|Name=slc26a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=2172bp
ATTTTGTGGTTATTCAAATAATTTATTTTATTAACTACTTATTAATTTTA
AATTAGAAATTTAATTTTTTTCTTTTTTTAATAAAAGAATCGACTTGAAT
TTAATAAAATAAACTTTTTTTGAAACTATGGATAAAACTGATTCTTACAA
AGTGGAACGACCTATTTATTCATACGAAAATCTGCATCGTGATTATAATG
AAGATGAAATAACTTTCAATTTATGCCGGAGCTTTAAACAAAAAATGAAA
TTTAAGAATATTAATTTTCAAACTGTTATGATGCACATATTGCCATTTCC
ATTTCTAATGGCATCATTTTATCAAGCTAAATTTTTAATTTATGACTTTG
TAGCTGGGATCACAATGTTAGTTTTCCATATTCCACAAGGAATGGCGTAT
GGACTTTTAGCAGGTTTAGAACCAATCAATGGACTTTATGCATCATTCTT
TCCGCCATTAGTTTACATTTTATTTGGCACATCCAGACATTTGTCATTAG
GTACATTTTCTATTATGGCACTTTTATCGAGCGTTCCTCTATTAAGAGAA
TATCAAATATCAAATGTTACAATGATGAACAATTCGATTTATACCAATTC
CTCGAAAACCCTTGCTATCACTGATGATACTAAGCTTCAAATTTCTGTTG
CTACTACTCTTTTGGCTGGTATCTTTCAGTTGAGTATGGGATTTACTCAG
TTGGGTTGCATCATGAACTATATGAATGATGCCATGATTGGTGGTTTTAC
AACTGCTAGTGCTCTACATGTCATTATTTCCCAAATGTCCCAGATCTTAG
GATATAAAATTAAACGATATTCTGGCGTCGGAGAATTGCCATATAAAGTT
TACCTTTTTGCTGTAAATATTAAAGAAACTCAATGGAGAACAGTTGTAAT
TACTCTCGTTTGTGTCGTTATTTTATTCTTGTTCACGGAATATCTCAATC
CAATTATTAAAAAAAAATTAAAATTTCCATTTCCAATTCAGCTTTTAGTG
GTGATATTAGGAACTGTGATATCTTACTTTTTCTCATTTTCCCGCAAATA
CAATGTTCCGATTGTTGGCAATATACCAAAGGGTTTACCCTATCCAATGA
TTCCTGATATTTCAATTTGGCCAAGGGTTTTTGTGGATGCCCTCATTCTA
GGAATTGTTGGATTTGTCATGAATAGTGCATTGAATTAGTGGCGTACGGT
TTATCAAATATTGTCGGTTCGTTTTTCTTTTGTACAATGTCAGCAGGAGC
TTTAGCTCGATCAGCTGTTGTCGTCCAGGTTGGCATGAAATCCCAGGTCG
CAACTATAATATCATGTGTCCTGATGCTTTTTGTCCTGCTTTTTATTGGA
CCGCTTTTTGAGAGCGTTCCAACATCCGTTTTATCGTCGATTATTGTCGT
GTCACTCAAAAGTATGCTCATGCAAATTACTGAAGTTCCCAGTCTTTATA
AATTGTCTAAATTTGACTTTGACGTTTGGATGGTCTCATTTTTGGCAACG
GTTTTTTTAAATGTACCATATGGACTAGTCGCTGGATTTCTCTTCAGTCT
GCTCACTATTATTATTAGATTACAGAATCCCCAATCTCAATTGCTTGGCC
GGTTGCCCGGAACTGATCTCTATAGAAATATGAAAATATTTAAAAGTGCC
GTAGAAATACCGGGTATTAAAATATTTCGATATGATGCGCCGGTCTATTT
TGCCAATGCAGAACATTTCCAAACGAAATTGTATAAGAAAACTGGTTTGG
ATCCACGGAGAATTAAACCACTCAAAAAAGAACTCACTGTGGAAAAGAAT
ATAAACCAAATAAACAGTGCTGAAGCCACAACCGACGAAACTACTCAACT
AAGAATCCACGAGAACAATACCAAAGTTGATTTCGTAGAAGAAGAAAACA
ACTCGGTCCCGTCTGTGGAAATCAGTGACACCAAGTCTATTGTGATAGAC
TTGTCATCAGTCAATTATGTAGATAATGTTGCCATCAGAATCCTTGAAGA
GATTTACTCCTCTTATCGGAAGCTGGGGATCCAATTGTTCCTAGCGGGAC
CGAATCATAGAATCAGGAAGATGTTAACGAAATCAAAGTTCGCCGAGGAT
AACCTAAGTCGAATTATGTATGTCACGATTCATGATGCGATTCTGTCTAT
TTTGTTGATCGGAAAATTACAC
back to top

protein sequence of SMED30029757-orf-1

>SMED30029757-orf-1 ID=SMED30029757-orf-1|Name=SMED30029757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=354bp
MDKTDSYKVERPIYSYENLHRDYNEDEITFNLCRSFKQKMKFKNINFQTV
MMHILPFPFLMASFYQAKFLIYDFVAGITMLVFHIPQGMAYGLLAGLEPI
NGLYASFFPPLVYILFGTSRHLSLGTFSIMALLSSVPLLREYQISNVTMM
NNSIYTNSSKTLAITDDTKLQISVATTLLAGIFQLSMGFTQLGCIMNYMN
DAMIGGFTTASALHVIISQMSQILGYKIKRYSGVGELPYKVYLFAVNIKE
TQWRTVVITLVCVVILFLFTEYLNPIIKKKLKFPFPIQLLVVILGTVISY
FFSFSRKYNVPIVGNIPKGLPYPMIPDISIWPRVFVDALILGIVGFVMNS
ALN*
back to top

protein sequence of SMED30029757-orf-2

>SMED30029757-orf-2 ID=SMED30029757-orf-2|Name=SMED30029757-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MSAGALARSAVVVQVGMKSQVATIISCVLMLFVLLFIGPLFESVPTSVLS
SIIVVSLKSMLMQITEVPSLYKLSKFDFDVWMVSFLATVFLNVPYGLVAG
FLFSLLTIIIRLQNPQSQLLGRLPGTDLYRNMKIFKSAVEIPGIKIFRYD
APVYFANAEHFQTKLYKKTGLDPRRIKPLKKELTVEKNINQINSAEATTD
ETTQLRIHENNTKVDFVEEENNSVPSVEISDTKSIVIDLSSVNYVDNVAI
RILEEIYSSYRKLGIQLFLAGPNHRIRKMLTKSKFAEDNLSRIMYVTIHD
AILSILLIGKLH
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000087proximal tubule
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR001902SLC26A/SulP_fam
IPR011547SLC26A/SulP_dom
IPR002645STAS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0008272sulfate transport
GO:0006810transport
GO:0055085transmembrane transport
GO:1902358sulfate transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015116sulfate transmembrane transporter activity
GO:0008271secondary active sulfate transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011547SLC26A/SulP transporter domainPFAMPF00916Sulfate_transpcoord: 70..348
e-value: 3.0E-62
score: 210.6
IPR001902SLC26A/SulP transporterPANTHERPTHR11814SULFATE TRANSPORTERcoord: 23..352
NoneNo IPR availablePANTHERPTHR11814:SF180ANION TRANSPORTER SULP-4coord: 23..352
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 202..224
NoneNo IPR availableTMHMMTMhelixcoord: 102..124
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 44..65
NoneNo IPR availableTMHMMTMhelixcoord: 173..195
NoneNo IPR availableTMHMMTMhelixcoord: 330..352
NoneNo IPR availableTMHMMTMhelixcoord: 285..304