Dual specificity tyrosine-phosphorylation-regulated kinase

Overview
NameDual specificity tyrosine-phosphorylation-regulated kinase
Smed IDSMED30029726
Length (bp)1943
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity tyrosine-phosphorylation-regulated kinase (SMED30029726) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase (SMED30029726) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity tyrosine-phosphorylation-regulated kinase (SMED30029726) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase (SMED30029726) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029726

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029726SMESG000064198.1 SmedASXL_059094SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30029726SMESG000064198.1 SmedASXL_015860SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30029726SMESG000064198.1 dd_Smed_v6_10045_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029726SMESG000064198.1 dd_Smed_v4_10045_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 272/428 (63.55%), Postives = 329/428 (76.87%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            +P+TP+QAMK YM +L+ FEHHEIF+YP+IYF+G NAKK+ G++ G NN GYDD+ GSY  V HDHV+YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKDN  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP Q  LD  KR+K F  SKGYPRYC + T ++   G  ++N       G +S+RGK RG P S+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP     S+ +
Sbjct:  152 TPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSD---GSVVLN-------GGRSRRGKLRGPPESREWGNALKGCDDPL-----------------FLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKR 552          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 273/428 (63.79%), Postives = 327/428 (76.40%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            +P+TP+QAMK YM +L+ FEHHEIF+YP+IYF+G NAKK+ G++ G NN GYDD+ GSY  V HDHV+YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKDN  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP Q  LD  KR+K F  SKGYPRYC   T T    G  ++N       G +S+RGK RG P S+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP     S+ +
Sbjct:   79 TPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYC---TVTTLSDGSVVLN-------GGRSRRGKLRGPPESREWGNALKGCDDPL-----------------FLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKR 479          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 253/417 (60.67%), Postives = 307/417 (73.62%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            PLTP+QA+K Y H L+ +E  EI NYP+IYFVG NAKK+HG+  G NN GYDD  G+Y HV  DH++YRYE+LKI+GKGSFGQV + YDHK   +VALKMVRNEKRF +QA EEI+ILE LK QDK  + N++H+LE FTFRNHVCM FELL+I+LY LIKKNKFQGFS+ LV+KFA SIL  LD LHKNK+IHCDLKPENILLK  GRS  KVIDFGSSC+++Q++YTYIQSRFYRAPE+ILG +YS  ID+WSFGCIL E+LTG PLFPGEDE DQLAC++E+LGMPP   L+Q KR+K F  SKG PRYC + T+ +   G+ +       L G +S+RGK RG PGSK   + +   +  L                 FI FL +CL W P  R TP +ALRH W+ + +PRP
Sbjct:  140 PLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQAD---GRVV-------LVGGRSRRGKKRGPPGSKDWGTALKGCDDYL-----------------FIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRP 529          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 253/417 (60.67%), Postives = 307/417 (73.62%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            PLTP+QA+K Y H L+ +E  EI NYP+IYFVG NAKK+HG+  G NN GYDD  G+Y HV  DH++YRYE+LKI+GKGSFGQV + YDHK   +VALKMVRNEKRF +QA EEI+ILE LK QDK  + N++H+LE FTFRNHVCM FELL+I+LY LIKKNKFQGFS+ LV+KFA SIL  LD LHKNK+IHCDLKPENILLK  GRS  KVIDFGSSC+++Q++YTYIQSRFYRAPE+ILG +YS  ID+WSFGCIL E+LTG PLFPGEDE DQLAC++E+LGMPP   L+Q KR+K F  SKG PRYC + T+ +   G+ +       L G +S+RGK RG PGSK   + +   +  L                 FI FL +CL W P  R TP +ALRH W+ + +PRP
Sbjct:  120 PLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQAD---GRVV-------LVGGRSRRGKKRGPPGSKDWGTALKGCDDYL-----------------FIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRP 509          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 253/417 (60.67%), Postives = 307/417 (73.62%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            PLTP+QA+K Y H L+ +E  EI NYP+IYFVG NAKK+HG+  G NN GYDD  G+Y HV  DH++YRYE+LKI+GKGSFGQV + YDHK   +VALKMVRNEKRF +QA EEI+ILE LK QDK  + N++H+LE FTFRNHVCM FELL+I+LY LIKKNKFQGFS+ LV+KFA SIL  LD LHKNK+IHCDLKPENILLK  GRS  KVIDFGSSC+++Q++YTYIQSRFYRAPE+ILG +YS  ID+WSFGCIL E+LTG PLFPGEDE DQLAC++E+LGMPP   L+Q KR+K F  SKG PRYC + T+ +   G+ +       L G +S+RGK RG PGSK   + +   +  L                 FI FL +CL W P  R TP +ALRH W+ + +PRP
Sbjct:  120 PLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQAD---GRVV-------LVGGRSRRGKKRGPPGSKDWGTALKGCDDYL-----------------FIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRP 509          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 255/426 (59.86%), Postives = 321/426 (75.35%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSI 1560
            S   P+ A++ +  +L  FE +EI+NY +++FVG +AKK+ G+  GANN GYDDE+GSYQ V HDH++YRYE+LK++GKGSFGQV+KA+DHK   +VALK+VRNEKRF +QA EEI+IL+ L+ QD D   NI+H+L++F FRNH C+TFELL+INLY LIK+NKFQGFSL+LV+KFAYS+L+CLDLL KN++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC+D QRIYTYIQSRFYRAPEVILG KY + IDMWS GCIL E+LTGYPL PGEDE DQLA IIE+LGMPP   L+  KR++ F  SKGYPRYC   T T    G  +       L G +SKRGK RG P S+S ++ +  M  +L                 F++FL +CL+W P+ R TP +AL+H+WLRR+LP PP +   S+
Sbjct:  391 SGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYC---TATSMPDGSVV-------LAGARSKRGKMRGPPASRSWSTALKNMGDEL-----------------FVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESM 789          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 255/426 (59.86%), Postives = 321/426 (75.35%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSI 1560
            S   P+ A++ +  +L  FE +EI+NY +++FVG +AKK+ G+  GANN GYDDE+GSYQ V HDH++YRYE+LK++GKGSFGQV+KA+DHK   +VALK+VRNEKRF +QA EEI+IL+ L+ QD D   NI+H+L++F FRNH C+TFELL+INLY LIK+NKFQGFSL+LV+KFAYS+L+CLDLL KN++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC+D QRIYTYIQSRFYRAPEVILG KY + IDMWS GCIL E+LTGYPL PGEDE DQLA IIE+LGMPP   L+  KR++ F  SKGYPRYC   T T    G  +       L G +SKRGK RG P S+S ++ +  M  +L                 F++FL +CL+W P+ R TP +AL+H+WLRR+LP PP +   S+
Sbjct:  374 SGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYC---TATSMPDGSVV-------LAGARSKRGKMRGPPASRSWSTALKNMGDEL-----------------FVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESM 772          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 255/426 (59.86%), Postives = 321/426 (75.35%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSI 1560
            S   P+ A++ +  +L  FE +EI+NY +++FVG +AKK+ G+  GANN GYDDE+GSYQ V HDH++YRYE+LK++GKGSFGQV+KA+DHK   +VALK+VRNEKRF +QA EEI+IL+ L+ QD D   NI+H+L++F FRNH C+TFELL+INLY LIK+NKFQGFSL+LV+KFAYS+L+CLDLL KN++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC+D QRIYTYIQSRFYRAPEVILG KY + IDMWS GCIL E+LTGYPL PGEDE DQLA IIE+LGMPP   L+  KR++ F  SKGYPRYC   T T    G  +       L G +SKRGK RG P S+S ++ +  M  +L                 F++FL +CL+W P+ R TP +AL+H+WLRR+LP PP +   S+
Sbjct:  374 SGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYC---TATSMPDGSVV-------LAGARSKRGKMRGPPASRSWSTALKNMGDEL-----------------FVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESM 772          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 255/426 (59.86%), Postives = 321/426 (75.35%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSI 1560
            S   P+ A++ +  +L  FE +EI+NY +++FVG +AKK+ G+  GANN GYDDE+GSYQ V HDH++YRYE+LK++GKGSFGQV+KA+DHK   +VALK+VRNEKRF +QA EEI+IL+ L+ QD D   NI+H+L++F FRNH C+TFELL+INLY LIK+NKFQGFSL+LV+KFAYS+L+CLDLL KN++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC+D QRIYTYIQSRFYRAPEVILG KY + IDMWS GCIL E+LTGYPL PGEDE DQLA IIE+LGMPP   L+  KR++ F  SKGYPRYC   T T    G  +       L G +SKRGK RG P S+S ++ +  M  +L                 F++FL +CL+W P+ R TP +AL+H+WLRR+LP PP +   S+
Sbjct:  391 SGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYC---TATSMPDGSVV-------LAGARSKRGKMRGPPASRSWSTALKNMGDEL-----------------FVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESM 789          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 255/427 (59.72%), Postives = 321/427 (75.18%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSIS 1563
            S   P+ A++ +  +L  FE +EI+NY +++FVG +AKK+ G+  GANN GYDDE+GSYQ V HDH++YRYE+LK++GKGSFGQV+KA+DHK   +VALK+VRNEKRF +QA EEI+IL+ L+ QD D   NI+H+L++F FRNH C+TFELL+INLY LIK+NKFQGFSL+LV+KFAYS+L+CLDLL KN++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC+D QRIYTYIQSRFYRAPEVILG KY + IDMWS GCIL E+LTGYPL PGEDE DQLA IIE+LGMPP   L+  KR++ F  SKGYPRYC   T T    G  +       L G +SKRGK RG P S+S ++ +  M  +L                 F++FL +CL+W P+ R TP +AL+H+WLRR+LP PP +   S+ 
Sbjct:  109 SGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYC---TATSMPDGSVV-------LAGARSKRGKMRGPPASRSWSTALKNMGDEL-----------------FVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMG 508          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100406)

HSP 1 Score: 523.472 bits (1347), Expect = 1.411e-176
Identity = 258/417 (61.87%), Postives = 315/417 (75.54%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPP 1539
            ++P Q M LYM++L+ +E  EI  YPQIYF+G NAKK+ G+  G NN+ YD+E G+Y HV HDHV+YRYE+LKI+GKGSFGQV+KAYDHKT   VALK+VRNEKRF +QA EEI+IL  L+  DK N  NI+H+ ++FTFRNH C+TFELL+INLY LIKKN F+GFSL LV+KFA+S+L CLD L+KN +IHCD+KPEN+LLKQQGRSGIKVIDFGSSC+++QRIYTYIQSRFYRAPEVILGGKY   IDMWS GCIL E+L+G+ LFPGE+E DQLACIIEVLGMP +N L   KRSK FF  KGYPRYC +         +T+ +G+V  + G +S+RGK RG P SKSL+  ++     L                 F+NF+  CLEW  D R TP EAL+H WLRR+LPRPP
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGV-YGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTV---------RTMSDGMVVLIGG-QSRRGKQRGPPCSKSLSKALDGCKDPL-----------------FLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPP 597          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100404)

HSP 1 Score: 523.472 bits (1347), Expect = 1.411e-176
Identity = 258/417 (61.87%), Postives = 315/417 (75.54%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPP 1539
            ++P Q M LYM++L+ +E  EI  YPQIYF+G NAKK+ G+  G NN+ YD+E G+Y HV HDHV+YRYE+LKI+GKGSFGQV+KAYDHKT   VALK+VRNEKRF +QA EEI+IL  L+  DK N  NI+H+ ++FTFRNH C+TFELL+INLY LIKKN F+GFSL LV+KFA+S+L CLD L+KN +IHCD+KPEN+LLKQQGRSGIKVIDFGSSC+++QRIYTYIQSRFYRAPEVILGGKY   IDMWS GCIL E+L+G+ LFPGE+E DQLACIIEVLGMP +N L   KRSK FF  KGYPRYC +         +T+ +G+V  + G +S+RGK RG P SKSL+  ++     L                 F+NF+  CLEW  D R TP EAL+H WLRR+LPRPP
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGV-YGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTV---------RTMSDGMVVLIGG-QSRRGKQRGPPCSKSLSKALDGCKDPL-----------------FLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPP 597          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100402)

HSP 1 Score: 523.472 bits (1347), Expect = 1.411e-176
Identity = 258/417 (61.87%), Postives = 315/417 (75.54%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPP 1539
            ++P Q M LYM++L+ +E  EI  YPQIYF+G NAKK+ G+  G NN+ YD+E G+Y HV HDHV+YRYE+LKI+GKGSFGQV+KAYDHKT   VALK+VRNEKRF +QA EEI+IL  L+  DK N  NI+H+ ++FTFRNH C+TFELL+INLY LIKKN F+GFSL LV+KFA+S+L CLD L+KN +IHCD+KPEN+LLKQQGRSGIKVIDFGSSC+++QRIYTYIQSRFYRAPEVILGGKY   IDMWS GCIL E+L+G+ LFPGE+E DQLACIIEVLGMP +N L   KRSK FF  KGYPRYC +         +T+ +G+V  + G +S+RGK RG P SKSL+  ++     L                 F+NF+  CLEW  D R TP EAL+H WLRR+LPRPP
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGV-YGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTV---------RTMSDGMVVLIGG-QSRRGKQRGPPCSKSLSKALDGCKDPL-----------------FLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPP 597          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0100447)

HSP 1 Score: 407.912 bits (1047), Expect = 5.102e-133
Identity = 198/415 (47.71%), Postives = 281/415 (67.71%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKK---KHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLR 1518
            +P+TP + +K + + L+  E  E+  Y ++++ G +A K   K   +    N GYDD++G+Y+ + HDH+++RYEIL+++GKGSFGQV++A DHKT   VA+K++RN+KRF  QA+ E+ IL++L+ +D D + N++H+L++  FR H+C+TFEL+++NLY LIKKN + GFS+ L+++F  SI+ CL LL+K  +IHCDLKPENILLKQ+G S IKVIDFGSSCY  ++IYTYIQSRFYR+PEVILG +Y   IDMWS GCIL E+ TG+PLFPGE+E++QLACI+EVLG+PP+  +   +R + FF S+  PR C   T                        +G+ R SPGSKSLA I++  +                    FI+FL +CLEW P +R TP EA  HE+L+
Sbjct:  125 TPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPR-CITNT------------------------KGRKR-SPGSKSLAHILHCQD------------------RYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0089289)

HSP 1 Score: 407.912 bits (1047), Expect = 5.102e-133
Identity = 198/415 (47.71%), Postives = 281/415 (67.71%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKK---KHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLR 1518
            +P+TP + +K + + L+  E  E+  Y ++++ G +A K   K   +    N GYDD++G+Y+ + HDH+++RYEIL+++GKGSFGQV++A DHKT   VA+K++RN+KRF  QA+ E+ IL++L+ +D D + N++H+L++  FR H+C+TFEL+++NLY LIKKN + GFS+ L+++F  SI+ CL LL+K  +IHCDLKPENILLKQ+G S IKVIDFGSSCY  ++IYTYIQSRFYR+PEVILG +Y   IDMWS GCIL E+ TG+PLFPGE+E++QLACI+EVLG+PP+  +   +R + FF S+  PR C   T                        +G+ R SPGSKSLA I++  +                    FI+FL +CLEW P +R TP EA  HE+L+
Sbjct:  125 TPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPR-CITNT------------------------KGRKR-SPGSKSLAHILHCQD------------------RYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 266/420 (63.33%), Postives = 322/420 (76.67%), Query Frame = 1
Query:  280 PSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPP 1539
            P+PLTP+QAMK YM +LS FEH EI +Y +IYF+G NAKK+ G+  G+NN GYDD+ GSY HV HDH++YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKD+  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CL+ LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP +  L+  KR+K F  SKG+PRYC +          T +      L G +S+RGK RG PGS+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP
Sbjct:  138 PAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTV----------TTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPL-----------------FLDFLKQCLEWDPSQRMTPSQALRHPWLRRRLPKPP 530          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 266/420 (63.33%), Postives = 322/420 (76.67%), Query Frame = 1
Query:  280 PSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPP 1539
            P+PLTP+QAMK YM +LS FEH EI +Y +IYF+G NAKK+ G+  G+NN GYDD+ GSY HV HDH++YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKD+  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CL+ LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP +  L+  KR+K F  SKG+PRYC +          T +      L G +S+RGK RG PGS+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP
Sbjct:  128 PAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTV----------TTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPL-----------------FLDFLKQCLEWDPSQRMTPSQALRHPWLRRRLPKPP 520          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 266/420 (63.33%), Postives = 322/420 (76.67%), Query Frame = 1
Query:  280 PSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPP 1539
            P+PLTP+QAMK YM +LS FEH EI +Y +IYF+G NAKK+ G+  G+NN GYDD+ GSY HV HDH++YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKD+  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CL+ LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP +  L+  KR+K F  SKG+PRYC +          T +      L G +S+RGK RG PGS+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP
Sbjct:  149 PAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTV----------TTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPL-----------------FLDFLKQCLEWDPSQRMTPSQALRHPWLRRRLPKPP 541          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Zebrafish
Match: dyrk3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:ZFIN;Acc:ZDB-GENE-080219-31])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 259/426 (60.80%), Postives = 321/426 (75.35%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSI 1560
            SP+TP+QA+K +  +++T E  EI NY +IYF+G NAKK+  ++ G NN+GYDD+ G Y HV HDH++YRYE LK++GKGSFGQV K YDHK    VALK+VRNEKRF +QA EEI+ILE LK QDK  + N+VH+LE+FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ LH++K+IHCDLKPENILLKQQGRSGIKVIDFGSSC+DHQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCIL E+LTGYPLFPGEDE DQLAC++E+LGMPP   L+Q KR+K F  SKG+PRYC +          T+ NG +  L G +S+RGK RG+PGSK   + +         DA             FI+FL KCL+W P  R TP +ALRH WL ++LP+P      ++
Sbjct:  131 SPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNNSGYDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPSKLLEQAKRAKNFISSKGHPRYCTVS---------TLSNGTIV-LNGSRSRRGKMRGAPGSKEWGTALKGCE-----DA------------TFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLPKPAPGGEKTV 529          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Zebrafish
Match: dyrk3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:ZFIN;Acc:ZDB-GENE-080219-31])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 259/426 (60.80%), Postives = 321/426 (75.35%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSI 1560
            SP+TP+QA+K +  +++T E  EI NY +IYF+G NAKK+  ++ G NN+GYDD+ G Y HV HDH++YRYE LK++GKGSFGQV K YDHK    VALK+VRNEKRF +QA EEI+ILE LK QDK  + N+VH+LE+FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ LH++K+IHCDLKPENILLKQQGRSGIKVIDFGSSC+DHQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCIL E+LTGYPLFPGEDE DQLAC++E+LGMPP   L+Q KR+K F  SKG+PRYC +          T+ NG +  L G +S+RGK RG+PGSK   + +         DA             FI+FL KCL+W P  R TP +ALRH WL ++LP+P      ++
Sbjct:  130 SPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNNSGYDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPSKLLEQAKRAKNFISSKGHPRYCTVS---------TLSNGTIV-LNGSRSRRGKMRGAPGSKEWGTALKGCE-----DA------------TFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLPKPAPGGEKTV 528          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Xenopus
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:100485120])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 280/428 (65.42%), Postives = 327/428 (76.40%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            S LTP+QAMK YM +L+ FEHHEIFNYP+IYF+G NAKK+ G+  G NN GYDD+ GSY  V HDHV+YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE LK QDKDNN N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILGG+Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP Q  LD  KR K FF SKGYPRYC   T T    G  ++N       G +S+RGK RG PGS+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP     S  +
Sbjct:  176 SSLTPEQAMKQYMQKLTAFEHHEIFNYPEIYFLGPNAKKRQGVIGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKLHQHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDNNMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGGRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRGKNFFSSKGYPRYC---TVTSLPDGSVVLN-------GGRSRRGKLRGPPGSRDWVTALKGCDDPL-----------------FLDFLTQCLEWDPSLRMTPSQALRHHWLRRRLPKPPTGEKISTKR 576          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 260/416 (62.50%), Postives = 315/416 (75.72%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            LTPDQA+K Y H+LS +E  EI ++ +IYFVG NAKK+ G+  G NN GYDD+ G Y  V HDHV+YRYE+LK++GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE LK QDK  + N++H+LE FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L++NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC+DHQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCILVE+LTGYPLFPGEDE DQLAC++E+LG PP   L+Q KR+K F  SKGYPRYC   T T   +G T++N       G +S+RGK RG+PGSK   + +      L                 FI+FL  CL W P  R TP +ALRH+W+ ++LP+P
Sbjct:  122 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYC---TVTTLPNGTTVLN-------GSRSRRGKMRGAPGSKDWVAALKGCEDSL-----------------FIDFLKGCLTWDPVARMTPSQALRHQWISKRLPKP 510          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 260/416 (62.50%), Postives = 315/416 (75.72%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            LTPDQA+K Y H+LS +E  EI ++ +IYFVG NAKK+ G+  G NN GYDD+ G Y  V HDHV+YRYE+LK++GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE LK QDK  + N++H+LE FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L++NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC+DHQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCILVE+LTGYPLFPGEDE DQLAC++E+LG PP   L+Q KR+K F  SKGYPRYC   T T   +G T++N       G +S+RGK RG+PGSK   + +      L                 FI+FL  CL W P  R TP +ALRH+W+ ++LP+P
Sbjct:  100 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYC---TVTTLPNGTTVLN-------GSRSRRGKMRGAPGSKDWVAALKGCEDSL-----------------FIDFLKGCLTWDPVARMTPSQALRHQWISKRLPKP 488          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 260/416 (62.50%), Postives = 315/416 (75.72%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            LTPDQA+K Y H+LS +E  EI ++ +IYFVG NAKK+ G+  G NN GYDD+ G Y  V HDHV+YRYE+LK++GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE LK QDK  + N++H+LE FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L++NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC+DHQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCILVE+LTGYPLFPGEDE DQLAC++E+LG PP   L+Q KR+K F  SKGYPRYC   T T   +G T++N       G +S+RGK RG+PGSK   + +      L                 FI+FL  CL W P  R TP +ALRH+W+ ++LP+P
Sbjct:   93 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYC---TVTTLPNGTTVLN-------GSRSRRGKMRGAPGSKDWVAALKGCEDSL-----------------FIDFLKGCLTWDPVARMTPSQALRHQWISKRLPKP 481          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 260/416 (62.50%), Postives = 315/416 (75.72%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            LTPDQA+K Y H+LS +E  EI ++ +IYFVG NAKK+ G+  G NN GYDD+ G Y  V HDHV+YRYE+LK++GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE LK QDK  + N++H+LE FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L++NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC+DHQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCILVE+LTGYPLFPGEDE DQLAC++E+LG PP   L+Q KR+K F  SKGYPRYC   T T   +G T++N       G +S+RGK RG+PGSK   + +      L                 FI+FL  CL W P  R TP +ALRH+W+ ++LP+P
Sbjct:   83 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYC---TVTTLPNGTTVLN-------GSRSRRGKMRGAPGSKDWVAALKGCEDSL-----------------FIDFLKGCLTWDPVARMTPSQALRHQWISKRLPKP 471          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Mouse
Match: Dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:MGI Symbol;Acc:MGI:1330301])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 271/428 (63.32%), Postives = 328/428 (76.64%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            SP+TP+QAMK YM +L+ FEHHEIF+YP+IYF+G NAKK+ G++ G NN GYDD+ GSY  V HDHV+YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKDN  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRS IKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP Q  LD  KR+K F  SKGYPRYC + T ++   G  ++N       G +S+RGK RG P S+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP     ++ +
Sbjct:  150 SPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSD---GSVVLN-------GGRSRRGKLRGPPESREWGNALKGCDDPL-----------------FLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTAVKR 550          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Mouse
Match: Dyrk3 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:MGI Symbol;Acc:MGI:1330300])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 254/417 (60.91%), Postives = 308/417 (73.86%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            PLTP+QA+K Y H L+ +E  EI +YP+IYFVG NAKK+ G+  G NN GYDD  G+Y HV  DH++YRYE+LKI+GKGSFGQV + YDHK   +VALKMVRNEKRF +QA EEI+ILE LK QDK  + N++H+LE FTFRNHVCM FELL+I+LY LIKKNKFQGFS+ LV+KFA SIL  LD LHKNK+IHCDLKPENILLK  GRS  KVIDFGSSC+++Q++YTYIQSRFYRAPE+ILG +YS  ID+WSFGCIL E+LTG PLFPGEDE DQLAC+IE+LGMPPQ  L+Q KR+K F  SKG PRYC + T+T+   G+ +       L G +S+RGK RG PGSK  A+ +      L                 FI FL +CL+W P  R TP +ALRH W+ +  P+P
Sbjct:  139 PLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTD---GRVV-------LLGGRSRRGKKRGPPGSKDWATALKGCGDYL-----------------FIEFLKRCLQWDPSARLTPAQALRHPWISKSTPKP 528          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Mouse
Match: Dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:MGI Symbol;Acc:MGI:1330292])

HSP 1 Score: 428.328 bits (1100), Expect = 6.512e-142
Identity = 208/420 (49.52%), Postives = 280/420 (66.67%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWL---RRKLPRP 1536
            PLT  +A+K + ++LS +E  EI  Y +++F+G  AKK + +    +   +DDEHGSY  V HDH++YRYE+L+++GKGSFGQV K  DHK    VALK++RN+KRF  QAL E+KILE L+ +DKDNN N+VH+ + F FRNH+C+TFELL INLY L+K N F GF+L +V++F +SIL CL +L+  K+IHCDLKPENI+L Q+G+  +KVIDFGSSCY+HQ++YTYIQSRFYR+PEVILG  Y++ IDMWS GCI+ E+ TGYPLFPGE+E++QLACI+EVLG+PP +F     R + FF SKG P                         K   + RG  R  P SK L  +V   +                  ++F++FL +CL W P  R TP++AL+H W+   R+  PRP
Sbjct:  150 PLTVAEALKFFKNQLSPYEQSEILGYSELWFLGLEAKKLNVVPEKFSKTSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKDNNHNVVHMKDFFYFRNHLCITFELLGINLYELMKNNSFHGFNLSIVRRFTFSILKCLHMLYVEKIIHCDLKPENIVLYQRGQVTVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPAHFTQTASRRQVFFDSKGLP-------------------------KNINNNRGGKR-YPDSKDLTMVVKTYD------------------SSFLDFLRRCLVWEPSLRMTPEQALKHAWIHEPRKFKPRP 525          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 299.286 bits (765), Expect = 3.096e-92
Identity = 157/367 (42.78%), Postives = 220/367 (59.95%), Query Frame = 1
Query:  427 NNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNK--VIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRR 1521
            N+GYDD++  Y   + +    RYEI  ++GKGSFGQVVKAYDH+T   VA+K+++N+K F  QA  E+++LE +   D +    IVH+  HF FRNH+C+ FELL+ NLY L++   F+G SL L +K A  +   L  L   +  +IHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG  Y + IDMWS GCILVEM TG PLF G +E+DQ++ I+EVLG+PP   L+Q  +++++F                       + G  + L+  K  R  Y+G PG++ L  ++             +      D+  F + +L+ LE+ P  R +P  AL+H + RR
Sbjct:   89 NHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYF---------------------ERLPGGGWTLRRTKELRKDYQG-PGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRR 433          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 299.671 bits (766), Expect = 8.745e-92
Identity = 157/367 (42.78%), Postives = 220/367 (59.95%), Query Frame = 1
Query:  427 NNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNK--VIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRR 1521
            N+GYDD++  Y   + +    RYEI  ++GKGSFGQVVKAYDH+T   VA+K+++N+K F  QA  E+++LE +   D +    IVH+  HF FRNH+C+ FELL+ NLY L++   F+G SL L +K A  +   L  L   +  +IHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG  Y + IDMWS GCILVEM TG PLF G +E+DQ++ I+EVLG+PP   L+Q  +++++F                       + G  + L+  K  R  Y+G PG++ L  ++             +      D+  F + +L+ LE+ P  R +P  AL+H + RR
Sbjct:  149 NHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYF---------------------ERLPGGGWTLRRTKELRKDYQG-PGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRR 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. UniProt/SwissProt
Match: sp|Q92630|DYRK2_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 272/428 (63.55%), Postives = 329/428 (76.87%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            +P+TP+QAMK YM +L+ FEHHEIF+YP+IYF+G NAKK+ G++ G NN GYDD+ GSY  V HDHV+YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKDN  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP Q  LD  KR+K F  SKGYPRYC + T ++   G  ++N       G +S+RGK RG P S+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP     S+ +
Sbjct:  152 TPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSD---GSVVLN-------GGRSRRGKLRGPPESREWGNALKGCDDPL-----------------FLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKR 552          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. UniProt/SwissProt
Match: sp|Q5U4C9|DYRK2_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus OX=10090 GN=Dyrk2 PE=2 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 271/428 (63.32%), Postives = 328/428 (76.64%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            SP+TP+QAMK YM +L+ FEHHEIF+YP+IYF+G NAKK+ G++ G NN GYDD+ GSY  V HDHV+YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKDN  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRS IKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP Q  LD  KR+K F  SKGYPRYC + T ++   G  ++N       G +S+RGK RG P S+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP     ++ +
Sbjct:  150 SPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSD---GSVVLN-------GGRSRRGKLRGPPESREWGNALKGCDDPL-----------------FLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTAVKR 550          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. UniProt/SwissProt
Match: sp|Q5ZIU3|DYRK2_CHICK (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Gallus gallus OX=9031 GN=DYRK2 PE=2 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 270/428 (63.08%), Postives = 325/428 (75.93%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            S +TP+QAMK YM +L+TFEH+EIF Y +IYF+G NAKK+ G+  G NN GYDD+ GSY  V HDH++YRYE+LK++GKGSFGQVVKAYDHK    VALKMVRNEKRF +QA EEI+ILE L+ QDKDNN N++H+LE+FTFR+H+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP    LD  KR+K F  SKGYPRYC + T ++   G  I+N       G +S+RGK RG P S+   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP     S  +
Sbjct:   77 SVMTPEQAMKQYMQKLTTFEHNEIFGYTEIYFLGPNAKKRQGVIGGPNNCGYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKMHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNNMNVIHMLENFTFRSHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSPKLLDSSKRAKNFVSSKGYPRYCTITTLSD---GSIILN-------GGRSRRGKLRGPPESREWGNALKGCDDPL-----------------FLDFLKQCLEWDPAIRMTPSQALRHPWLRRRLPKPPTGEKASAKR 477          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. UniProt/SwissProt
Match: sp|Q9XTF3|MBK2_CAEEL (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans OX=6239 GN=mbk-2 PE=1 SV=1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 255/426 (59.86%), Postives = 321/426 (75.35%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSI 1560
            S   P+ A++ +  +L  FE +EI+NY +++FVG +AKK+ G+  GANN GYDDE+GSYQ V HDH++YRYE+LK++GKGSFGQV+KA+DHK   +VALK+VRNEKRF +QA EEI+IL+ L+ QD D   NI+H+L++F FRNH C+TFELL+INLY LIK+NKFQGFSL+LV+KFAYS+L+CLDLL KN++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC+D QRIYTYIQSRFYRAPEVILG KY + IDMWS GCIL E+LTGYPL PGEDE DQLA IIE+LGMPP   L+  KR++ F  SKGYPRYC   T T    G  +       L G +SKRGK RG P S+S ++ +  M  +L                 F++FL +CL+W P+ R TP +AL+H+WLRR+LP PP +   S+
Sbjct:  391 SGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYC---TATSMPDGSVV-------LAGARSKRGKMRGPPASRSWSTALKNMGDEL-----------------FVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESM 789          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. UniProt/SwissProt
Match: sp|A8WJR8|MBK2_CAEBR (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis briggsae OX=6238 GN=mbk-2 PE=3 SV=2)

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 254/426 (59.62%), Postives = 322/426 (75.59%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSI 1560
            S   P+ A++ +  +L  +E +EI+NY +++FVG +AKK+ G+  GANN GYDDE+GSYQ V HDH++YRYE+LK++GKGSFGQV+KA+DHK   +VALK+VRNEKRF +QA EEI+IL+ L+ QD D   NI+H+L++F FRNH C+TFELL+INLY LIK+NKFQGFSL+LV+KFAYS+L+CLDLL KN++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC+D QRIYTYIQSRFYRAPEVILG KY + IDMWS GCIL E+LTGYPL PGEDE DQLA IIE+LGMPP   L+  KR++ F  SKGYPRYC   T T    G  +       L G +SKRGK RG P S+S ++ +  M  +L                 F++FL +CL+W P+ R TP +AL+H+WLRR+LP PP +  +S+
Sbjct:  390 SGFRPEDAVQTFGAKLVPYEKNEIYNYTRVFFVGSHAKKQPGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYC---TATSMPDGSVV-------LAGARSKRGKMRGPPESRSWSTALKNMGDEL-----------------FVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGMDSM 788          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. TrEMBL
Match: A0A3R7JJH4 (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Clonorchis sinensis OX=79923 GN=Dyrk2 PE=4 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 289/426 (67.84%), Postives = 343/426 (80.52%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSK-GYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSIS 1563
            LTP+ AMKLY+H+LS FEHHEIF+YP IYFVGHNAKK+ G+    NN+GYDDE GSY + AHDHV+YRYE+LKILGKGSFGQVVKAYDHKTG +VALKMVRNEKRF  QA EEI+ILE LK QDKDN +N+VH+LE+FTFRNHVCMTFELL++NLY LIK++KFQGF L LV+KFA+SILVCLD+LH+NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC++ QRIYTYIQSRFYRAPEVILG KY   IDMWSFGCIL E+LTG PLFPGEDE DQLACIIE+LGMPPQ  LDQC+R K FF +  GYPRYC + +++E   G+ +       L+  KSKRGK RG+PGS+SL + +                    + T F++FL +CL+W+P+DR TP+EA RHEWLRR+LP+PP N  ++ S
Sbjct:  221 LTPEMAMKLYVHKLSAFEHHEIFSYPHIYFVGHNAKKRAGVVGAPNNSGYDDEQGSYLNTAHDHVAYRYEVLKILGKGSFGQVVKAYDHKTGTYVALKMVRNEKRFTHQAAEEIRILELLKQQDKDNTRNVVHMLENFTFRNHVCMTFELLSMNLYELIKRSKFQGFPLQLVRKFAHSILVCLDMLHRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFESQRIYTYIQSRFYRAPEVILGFKYGTAIDMWSFGCILAELLTGAPLFPGEDEGDQLACIIELLGMPPQKLLDQCRRVKHFFSTTHGYPRYC-MASDSE---GRVV-------LRPSKSKRGKIRGTPGSRSLVTALGGC-----------------EDTAFLDFLRRCLQWLPEDRMTPREAFRHEWLRRRLPKPPGNTTSAAS 618          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. TrEMBL
Match: G7YDV1 (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Clonorchis sinensis OX=79923 GN=CLF_105631 PE=4 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 289/426 (67.84%), Postives = 343/426 (80.52%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSK-GYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSIS 1563
            LTP+ AMKLY+H+LS FEHHEIF+YP IYFVGHNAKK+ G+    NN+GYDDE GSY + AHDHV+YRYE+LKILGKGSFGQVVKAYDHKTG +VALKMVRNEKRF  QA EEI+ILE LK QDKDN +N+VH+LE+FTFRNHVCMTFELL++NLY LIK++KFQGF L LV+KFA+SILVCLD+LH+NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC++ QRIYTYIQSRFYRAPEVILG KY   IDMWSFGCIL E+LTG PLFPGEDE DQLACIIE+LGMPPQ  LDQC+R K FF +  GYPRYC + +++E   G+ +       L+  KSKRGK RG+PGS+SL + +                    + T F++FL +CL+W+P+DR TP+EA RHEWLRR+LP+PP N  ++ S
Sbjct:  218 LTPEMAMKLYVHKLSAFEHHEIFSYPHIYFVGHNAKKRAGVVGAPNNSGYDDEQGSYLNTAHDHVAYRYEVLKILGKGSFGQVVKAYDHKTGTYVALKMVRNEKRFTHQAAEEIRILELLKQQDKDNTRNVVHMLENFTFRNHVCMTFELLSMNLYELIKRSKFQGFPLQLVRKFAHSILVCLDMLHRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFESQRIYTYIQSRFYRAPEVILGFKYGTAIDMWSFGCILAELLTGAPLFPGEDEGDQLACIIELLGMPPQKLLDQCRRVKHFFSTTHGYPRYC-MASDSE---GRVV-------LRPSKSKRGKIRGTPGSRSLVTALGGC-----------------EDTAFLDFLRRCLQWLPEDRMTPREAFRHEWLRRRLPKPPGNTTSAAS 615          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. TrEMBL
Match: A0A1I8JL07 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 278/417 (66.67%), Postives = 333/417 (79.86%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPP 1539
            +TP+ AMKLYM +LSTFEHHEIF++PQ+YFVG NA K+ G+  G NN+GYDDE GSYQH AHDH+SYRYE+LKI+GKGSFGQV+K +DHKT   VALKMVRNEKRF +QA EEI+ILEQL  QD+DN+ N+VHILEHFTFRNHVC+TFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD+LH+NK+IHCDLKPENILLK QGRSGIKVIDFGSSCY+HQRIYTYIQSRFYRAPEVILGGKY + IDMWS GCIL E+ TG P+FPGEDE DQLAC +EVLG PP   L+  KR++ FF S+G+PRYC +ET+ +   G T        LKG +S+RGK+RG PGSK+L++ +                       +F++FL +CL W PD+R TP EALRH+WL+R+LPRPP
Sbjct: 1237 MTPETAMKLYMQKLSTFEHHEIFSFPQVYFVGQNANKRQGVVGGPNNSGYDDEQGSYQHTAHDHISYRYEVLKIIGKGSFGQVLKCHDHKTNSQVALKMVRNEKRFTRQASEEIRILEQLLRQDRDNSHNVVHILEHFTFRNHVCITFELLSMNLYELIKKNKFQGFSLQLVRKFAHSILQCLDMLHRNKIIHCDLKPENILLKCQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSLGCILAELYTGVPIFPGEDEGDQLACAMEVLGAPPTRLLEASKRTRVFFSSRGHPRYCSVETDAD---GAT-------QLKGGRSRRGKFRGPPGSKTLSTALRGCED-----------------RHFLDFLTRCLHWAPDERMTPHEALRHDWLKRRLPRPP 1626          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. TrEMBL
Match: A0A183ARR5 (Protein kinase domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9651 PE=4 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 289/426 (67.84%), Postives = 342/426 (80.28%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSK-GYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSIS 1563
            LTP+ AMKLY+H+L+ +EHHEIF YPQIYFVGHNAKK+ G+    NN GYDD+ GSY + AHDHV+YRYE+LKILGKGSFGQVVKAYDHKTG +VALKMVRNEKRF  QA EEI+ILEQLK QDKDN +N+VH+LEHFTFRNHVCMTFELL++NLY LIK++KFQGF L LV+KFA+SILVCLD+LH+NK+IHCDLKPENILLKQQGRSGIKVIDFGSSCY+ QRIYTYIQSRFYRAPEVILG KY   ID+WSFGCIL E+LTG PLFPGEDE DQLACIIE+LGMPPQ  L+QC+R K FF +  GYPRYC + T+ +   G+ +       L+  KSKRGK RG+PGS+SL + +N        DA             F++FL +CL+W+P++R TP+EA RHEWLRR+LP+PP   N + S
Sbjct:  194 LTPEMAMKLYVHKLTPYEHHEIFGYPQIYFVGHNAKKRSGVLGAPNNGGYDDDQGSYLNTAHDHVAYRYEVLKILGKGSFGQVVKAYDHKTGTYVALKMVRNEKRFTHQAAEEIRILEQLKQQDKDNTRNVVHMLEHFTFRNHVCMTFELLSMNLYELIKRSKFQGFPLQLVRKFAHSILVCLDMLHRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCYESQRIYTYIQSRFYRAPEVILGFKYGSAIDIWSFGCILAELLTGAPLFPGEDEGDQLACIIELLGMPPQKLLEQCRRVKHFFSTTHGYPRYC-MATDAD---GRVV-------LRPSKSKRGKLRGTPGSRSLVTALNGCE-----DA------------AFLDFLRRCLQWLPEERMTPREAFRHEWLRRRLPKPPATGNTTSS 591          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. TrEMBL
Match: A0A4S2LGD8 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007387 PE=4 SV=1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 289/426 (67.84%), Postives = 343/426 (80.52%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSK-GYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSIS 1563
            LTP+ AMKLY+H+LS FEHHEIF+YP IYFVGHNAKK+ G+    NN+GYDDE GSY + AHDHV+YRYE+LKILGKGSFGQVVKAYDHKTG +VALKMVRNEKRF  QA EEI+ILE LK QDKDN +N+VH+LE+FTFRNHVCMTFELL++NLY LIK++KFQGF L LV+KFA+SILVCLD+LH+NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC++ QRIYTYIQSRFYRAPEVILG KY   ID+WSFGCIL E+LTG PLFPGEDE DQLACIIE+LGMPPQ  LDQC+R K FF +  GYPRYC + T++E   G+ +       L+  KSKRGK RG+PGS+SL + +                    + T F++FL +CL+W+P+DR TP+EA RHEWLRR+LP+PP N  ++ S
Sbjct:  211 LTPEMAMKLYVHKLSVFEHHEIFSYPHIYFVGHNAKKRAGVVGAPNNSGYDDEQGSYLNTAHDHVAYRYEVLKILGKGSFGQVVKAYDHKTGTYVALKMVRNEKRFTHQAAEEIRILELLKQQDKDNTRNVVHMLENFTFRNHVCMTFELLSMNLYELIKRSKFQGFPLQLVRKFAHSILVCLDMLHRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFESQRIYTYIQSRFYRAPEVILGFKYGTAIDVWSFGCILAELLTGAPLFPGEDEGDQLACIIELLGMPPQKLLDQCRRVKHFFSTTHGYPRYC-MATDSE---GRVV-------LRPSKSKRGKIRGTPGSRSLVTALGGC-----------------EDTAFLDFLRRCLQWLPEDRMTPREAFRHEWLRRRLPKPPGNTTSAAS 608          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Cavefish
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:103042530])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 277/429 (64.57%), Postives = 330/429 (76.92%), Query Frame = 1
Query:  280 PSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            P+PLTP+QAMK Y+ +LSTFEH EIFNYP+I+FVG NAKK+ G+  G+NN GYDD+ GSY HV HDH++YRYE+LK++GKGSFGQVVKAYDHKT   VALKMVRNEKRF +QA EEI+ILE L+ QDKD+  N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLAC+IE+LGMP Q  LD  KR+K F  SKGYPRYC   T T    G   +N       G +S+RGK RG PGSK   + +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP     ++ +
Sbjct:  136 PAPLTPEQAMKQYLSKLSTFEHQEIFNYPEIFFVGPNAKKRPGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKTHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDSLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIELLGMPSQKLLDSSKRAKNFISSKGYPRYC---TVTSLPDGTVALN-------GGRSRRGKLRGPPGSKDWVTALKGCDDPL-----------------FLDFLKQCLEWDPTLRMTPSQALRHPWLRRRLPKPPTGEKTTVKR 537          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 258/429 (60.14%), Postives = 315/429 (73.43%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP-PDNNNNSISK 1566
             PL  +QA+K Y  +L+  E  E+ NY +I+FVG NAKK+  ++ G+NN GYDD+ G Y HV HDH++YRYE LK++GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE LK QDK  + N+VH+LE+FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L ++K+IHCDLKPENILLKQQGRSGIKVIDFGSSC+DHQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCIL E+LTGYPLFPGEDE DQLAC++E+LGMPPQ  L+Q KR+K F  SKG+PRYC +          T+ NG +  L G +S+RGK RG PGSK   + +                    D   FI+FL KCL+W P  R TP  ALRH WL ++LP+P P      + K
Sbjct:  134 GPLGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNNCGYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVT---------TLSNGTLV-LNGSRSRRGKMRGPPGSKEWVTALKGC-----------------DDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKRLPKPVPSGEKTMVPK 535          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 258/429 (60.14%), Postives = 315/429 (73.43%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP-PDNNNNSISK 1566
             PL  +QA+K Y  +L+  E  E+ NY +I+FVG NAKK+  ++ G+NN GYDD+ G Y HV HDH++YRYE LK++GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE LK QDK  + N+VH+LE+FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L ++K+IHCDLKPENILLKQQGRSGIKVIDFGSSC+DHQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCIL E+LTGYPLFPGEDE DQLAC++E+LGMPPQ  L+Q KR+K F  SKG+PRYC +          T+ NG +  L G +S+RGK RG PGSK   + +                    D   FI+FL KCL+W P  R TP  ALRH WL ++LP+P P      + K
Sbjct:  126 GPLGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNNCGYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVT---------TLSNGTLV-LNGSRSRRGKMRGPPGSKEWVTALKGC-----------------DDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKRLPKPVPSGEKTMVPK 527          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 447.203 bits (1149), Expect = 2.105e-149
Identity = 210/429 (48.95%), Postives = 289/429 (67.37%), Query Frame = 1
Query:  229 SVYNNLEKSNLHLIHNVPSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWL 1515
            S+ N  EK   +    +P  ++P  A+K +  +L+ +E  EI +Y +I+++G + KK  G      N+GYDDEHGSY  V HDH++YRYE+L+++GKGSFGQV+K  DHKT   VA+K++RN+KRF +QAL E+KIL+ ++ +D+D+  N++H+ E+F FRNH+C++FELL  NLY LIKKN FQGFSL L+++FA+S+L CL +LH+ K+IHCDLKPENILL Q+G+  IKV+DFGSSCY+ QR+YTYIQSRFYR+PEVILG  YS+ IDMWS GCIL E+ TGYPLFPGE E++Q+ACI+EV+GMPP +F+    R + FF SKG PR                            + +GK R  P SK LAS++   +P                   F++F+ +CL W P  R TP E ++HEW+
Sbjct:  113 SIINKFEKIRTYEGQRLP--MSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRDSCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPR-------------------------NVTNSKGKKR-RPNSKELASVLKTNDP------------------LFLDFIRRCLVWDPTKRMTPDEGMQHEWI 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 447.588 bits (1150), Expect = 2.241e-149
Identity = 210/429 (48.95%), Postives = 289/429 (67.37%), Query Frame = 1
Query:  229 SVYNNLEKSNLHLIHNVPSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWL 1515
            S+ N  EK   +    +P  ++P  A+K +  +L+ +E  EI +Y +I+++G + KK  G      N+GYDDEHGSY  V HDH++YRYE+L+++GKGSFGQV+K  DHKT   VA+K++RN+KRF +QAL E+KIL+ ++ +D+D+  N++H+ E+F FRNH+C++FELL  NLY LIKKN FQGFSL L+++FA+S+L CL +LH+ K+IHCDLKPENILL Q+G+  IKV+DFGSSCY+ QR+YTYIQSRFYR+PEVILG  YS+ IDMWS GCIL E+ TGYPLFPGE E++Q+ACI+EV+GMPP +F+    R + FF SKG PR                            + +GK R  P SK LAS++   +P                   F++F+ +CL W P  R TP E ++HEW+
Sbjct:  121 SIINKFEKIRTYEGQRLP--MSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRDSCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPR-------------------------NVTNSKGKKR-RPNSKELASVLKTNDP------------------LFLDFIRRCLVWDPTKRMTPDEGMQHEWI 503          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 256/407 (62.90%), Postives = 311/407 (76.41%), Query Frame = 1
Query:  292 TPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEW 1512
            +PDQA++LY  +L+ +EH EI+NY +IYFVGHNAKK+ G+  GA+N GYDDE GSY HVAHDHV+YRYE+LK++GKGSFGQVVKA+DHKT   VALKMVRNEKRF +QA EEI+ILE L+ QD++N+ NI+H+LE FTFR HVCMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LH+N++IHCDLKPENILLKQ GRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEV+LG +Y   IDMWS GCIL E+LTG PL PGEDE DQLAC +E+LGMPPQ  L Q KRS+ F  S+G+PRYC +   TE   G  ++N         +S+RGK RG PGS+ L + +   +  L                  ++FL  CLEW P +R TP +ALRH W
Sbjct:   95 SPDQAVRLYGQKLTAYEHQEIYNYAEIYFVGHNAKKRPGVVGGASNCGYDDEQGSYVHVAHDHVAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSMNIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRNRIIHCDLKPENILLKQPGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRSRNFVSSRGHPRYCGV---TEAPDGAVVLN-------AGRSRRGKPRGPPGSRELPAALRGCDDPL-----------------LLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 252/415 (60.72%), Postives = 313/415 (75.42%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIK-VIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRK 1524
            + ++P+QAM+ YMHRLS FEHHEIFNY ++YFVG +AKK+     G NNNG+DDE GSY HV HDHV+YRYE+L+++GKGSFGQVVKAYDH+T  +VALKMVRNEKRF +QA EEI+ILE LK QDK+N  N++H+LE F FRNH+CMTFELL++NLY LIKKNKFQGFSL +V+KFA+SIL+CL+ LHKN++IHCDLKPENILL+QQGRSGIK +IDFGSSCY+HQR+YTYIQSRFYRAP    GG+Y + IDMWS GCIL E+LTG PL PGEDE DQLAC +E+ G PP   L+Q KR+++FF S G+PRYC   T T    G  ++N       G +++RGK RG P S+   + +   +  L                 FI+FL KCL+W P  R TP +AL+H WLRR+
Sbjct:  102 TAMSPEQAMRKYMHRLSMFEHHEIFNYHEVYFVGPSAKKRQATLSGVNNNGFDDEQGSYIHVPHDHVAYRYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKENTMNVIHMLESFNFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHKNRIIHCDLKPENILLRQQGRSGIKIIIDFGSSCYEHQRVYTYIQSRFYRAP----GGRYGLPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYC---TVTTLPGGPVVLN-------GGRTRRGKLRGPPSSRDWTTALKGCDDHL-----------------FIDFLKKCLDWDPATRLTPSQALKHPWLRRR 485          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 289.271 bits (739), Expect = 8.346e-88
Identity = 153/360 (42.50%), Postives = 221/360 (61.39%), Query Frame = 1
Query:  490 RYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNK--VIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSIS 1563
            RYEI  ++GKGSFGQVVKAYDH+   +VA+K+++N+K F  QA  E+++LE +   D D    IVH+  HF FRNH+C+ FELL+ NLY L++   F+G SL L +KFA  +   L  L   +  +IHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG  Y + IDMWS GCILVEM TG PLF G +E+DQ+  I+EVLG+PP + L+Q  +++++F                    + + +G  + +K  K  + +Y+ + GS+ L  I+   +         ++   + D+  F + +L+ L++ P  R TP  AL+H + ++       N +NS+S
Sbjct:  161 RYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKYF--------------------ERLSDG-SWTVKKTKDSKREYK-TAGSRKLHDIIGVESGGPGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTTDE-GTNTSNSVS 497          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007952.1 (pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 1.164e-75
Identity = 141/359 (39.28%), Postives = 197/359 (54.87%), Query Frame = 1
Query:  466 VAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQA-LEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPP 1539
            V H+H+ YRYE+L++LG+GSFG+V+K  DHK+  FVA+K++ N  RF +     EI+IL++L  Q    +  I+ ++EHF+FR   C+ FELLN NL S +K    QGF L +V+ FA S+L  L+ L    VIH DLKP NI +       +K+ DFG SC+DH+  +T IQ+R YRAPEVIL   YS   DMWS GC L E+ +G  LFPG    DQL  I+EV G+PPQ+ +++ +    FF  K +    +L                          RG  R  PGS++L   +   +                   +F +F+  CL+W P+ R TP  A+ HEW+R   PR P
Sbjct:    2 VWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRL--QTARESSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFACKDFSSNVRL-------------------------NRGLVR-VPGSRALPLALRTTD------------------EHFTDFIRSCLQWDPEWRLTPHGAMDHEWVR--APRMP 311          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007958.1 (pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.195 bits (609), Expect = 5.063e-74
Identity = 139/352 (39.49%), Postives = 195/352 (55.40%), Query Frame = 1
Query:  466 VAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQA-LEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLR 1518
            V H+H+ YRYE+L++LG+GSFG+V+K  DHK+  FVA+K++ N  RF +     EI+IL++L  Q    +  I+ ++EHF+FR   C+ FELLN NL S +K    QGF L +V+ FA S+L  L+ L    VIH DLKP NI +       +K+ DFG SC+DH+  +T IQ+R YRAPEVIL   YS   DMWS GC L E+ +G  LFPG    DQL  I+EV G+PPQ+ +++ +    FF                T+     IN          + RG  R  PGS++L   +   +                   +F +F+  CL+W P+ R TP  A+ HEW+R
Sbjct:    2 VWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRL--QTARESSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFAI--------------TKPTHWDIN----------NHRGLVR-VPGSRALPLALRTTD------------------EHFTDFIRSCLQWDPEWRLTPHGAMDHEWVR 307          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 253.447 bits (646), Expect = 1.860e-74
Identity = 152/380 (40.00%), Postives = 222/380 (58.42%), Query Frame = 1
Query:  412 SVGANNNGYDDEHGSYQHVAHDHVSY----RYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQ-DKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFY--LKGCKSKRGKYRGSPGSKSLASIVNAMNPDL--NSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRK 1524
            S G  NNG+D+ +  Y    +D +      +Y +L ILG+G+FGQVVK  +  T   +A+K+V++   +  Q++ E KILE L  + D  N  + + + + F  +NH+C+ FELL+ NLY L+K+NKF G S+ L++ F   IL  L +L ++K+IHCDLKPENILL    +  +K+IDFGSSC + + +YTYIQSRFYRAPE+ILG  YS  IDMWS GCI+ E+  G P+FPG  E +QL  II+ LG PP   +D  K S +F   K  P   +  + T+    KTI      Y  ++    +  K+R  P       I N   P    NS   ID E+Q ++    I+FL   L   P +R+TP++A+ H ++ ++
Sbjct:  338 SEGKCNNGFDNINSDYILYVNDVLGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFM-KKLAPE--ESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPD-----IIRNYRYPKSIQNSQELIDQEMQNREC--LIHFLGGVLNLNPLERWTPQQAMLHPFITKQ 707          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 142.895 bits (359), Expect = 1.394e-38
Identity = 82/233 (35.19%), Postives = 141/233 (60.52%), Query Frame = 1
Query:  484 SYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVR--NEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKK----NKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTY---IQSRFYRAPEVILGGK-YSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMP 1152
            S +++ L+ LG G++  V K  +  TG++VALK V+  +E+     A+ EI ++++LK      ++NIV + +     N + + FE ++ +L   +      N  +G  L LVK F + +L  L   H+NK++H DLKP+N+L+ ++G+  +K+ DFG +      + T+   + + +YRAP+V++G + YS  ID+WS GCIL EM+TG PLFPG ++ +QL  I +++G P
Sbjct:    4 SSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELK------HENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQ--LKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTP 228          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 137.887 bits (346), Expect = 3.423e-36
Identity = 115/368 (31.25%), Postives = 175/368 (47.55%), Query Frame = 1
Query:  481 VSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVR--NEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILE-----HFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLL---VKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFG-----SSCYDHQR-----IYTYIQSRFYRAPEVILG-GKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQ--CKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWL 1515
            +  +Y+++ ++G+G++G V  A    +G+ VA+K ++  ++K F  + + EIK+L          ++NI+ IL+          N V +  EL+  +L  +I  N+  GFS L    V+ F Y IL  L  +H  +VIH D+KP N+LL       +KV DFG     +S  D +      +  Y+ +R+YRAPE++L   +Y+  +D+WS GCIL EM++G PLFPG D   QL  I+EVLG P     +Q   KR+KE+  +   P    L  ET                               SK+          DLN D               I+ L K L++ PD R +  EALRH +L
Sbjct:    9 IPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFH-----EHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVIN-NQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLL--NSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIAN--LPMRPPLPWETV-----------------------------WSKT----------DLNPD--------------MIDLLDKMLQFNPDKRISAAEALRHPYL 313          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 134.035 bits (336), Expect = 2.805e-34
Identity = 79/235 (33.62%), Postives = 131/235 (55.74%), Query Frame = 1
Query:  481 VSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVR---NEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHF-TFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGG-KYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLD 1170
            ++ RY  L  +G G+FG V  A D  T   VA+K +    +    AK+   E+K+L+ L+      ++N++ + + F +    +    EL   +L+ L++    +      V+ F Y IL  L  +H   VIH DLKP NIL+ +     +K+ DFG +     ++  Y+ +R+YRAPE++L   KY V++D+WS GCI  EM+ G PLFPG+D + Q + I ++LG PP++ ++
Sbjct:   19 ITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLR------HENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEK---QFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINEN--CDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIN 242          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 135.191 bits (339), Expect = 1.266e-33
Identity = 97/355 (27.32%), Postives = 172/355 (48.45%), Query Frame = 1
Query:  259 LHLIHNVPSPLTPDQAMKLYM-HRLSTFEH--HEIFNYPQIYFVGHNAKKKHGISV-------------GANNNGYDDEHGSYQHVAHDHVSY--RYEILKILGKGSFGQVVKAYDHK-TGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILL---------------------KQQGRSG---------IKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMP-PQNFLDQ 1173
            LHL  +    L  ++A+ L + H  S F +   +I + PQ      N KK+ G S+                +N   D+ G Y +  +D      R+ +  +LG+G+FG+V+K  D+K    +VA+K++R   R+ + A  E++IL+ +   D       + + E F ++NH+C+  +L   ++Y  +  N    F    ++  A  ++  +  LH   +IH DLKPENIL+                     +++   G         IK+IDFGS+ + ++     I +R YRAPE++LG  +S   D+WS  C+LVE++ G  L+P  + ++ +A +  + G P P + +D+
Sbjct:  222 LHLTGSCAKTLEGNKAVNLTIAHSTSPFSNPPAQIASLPQ-----SNLKKQIGSSLRKFTSNGSSESASSNKSNFKTDKDGHYVYQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPTDIIDK 571          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 279/426 (65.49%), Postives = 322/426 (75.59%), Query Frame = 1
Query:  289 LTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRK-LPRPPDNNNNSIS 1563
             T + AMK YMH+LS +E HEIFNY QIYFVG  AKK+ G+  GANN GYDDE GSY HV  DH++YRYE+LKI+GKGSFGQVVKA DHKT   VALKMVRNEKRF +QA EEI+ILE LK QDKDN  NI+H+LEHFTFRNHVCMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQRIYTYIQSRFYRAPEVILG +Y + IDMWSFGCIL E+LTGYPLFPGEDE DQLAC +E+LG  P+   +  KR+K F  SKGYPRYC +          T+ +G V  + G +S+RGK RG+P SK+    +                    D   FI+FL +CLEW P  R TP +ALRH WLRR+ LPR P++NNN  S
Sbjct:   99 FTAEVAMKQYMHKLSGYETHEIFNYSQIYFVGEAAKKRQGVVGGANNCGYDDEQGSYIHVPKDHIAYRYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTI---------TTLPDGSV-AVSGGRSRRGKTRGAPNSKTFVQALKGC-----------------DDAMFIDFLKRCLEWDPSARMTPSQALRHPWLRRRALPRAPESNNNLAS 497          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 426.402 bits (1095), Expect = 6.160e-146
Identity = 189/298 (63.42%), Postives = 248/298 (83.22%), Query Frame = 1
Query:  325 RLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPR 1218
            R++TFE  EI +YP+++F+G +AKK  G+     NN YDD++GSY    HDH++YRYE+L++LGKGSFGQVVKA DHKTG  VA+K++RN+KRF +QAL E+KIL+ L+ +DKDN  N++H++EHF FRNH+C+TFEL+ +NLY LIKKN FQGFSL L+++FA+++L CL ++HK K+IHCDLKPENILL+Q+G++ IKVIDFGSSCY+HQR+YTYIQSRFYR+PEVILG  YS+ IDMWSFGCIL E+ TGYPLFPGE+E++QLACI+EVLG+P    ++   R + FF SKG PR
Sbjct:    4 RITTFEQSEILDYPEVWFLGLDAKKIDGVPGAPQNNNYDDDNGSYLKALHDHLAYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKDNTHNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEKIIHCDLKPENILLRQRGQTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFFDSKGIPR 301          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 285.419 bits (729), Expect = 1.202e-89
Identity = 159/367 (43.32%), Postives = 218/367 (59.40%), Query Frame = 1
Query:  427 NNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNK--VIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRR 1521
            N+GYDDE+  Y   A +    RYEI  ++GKGSFGQV KAYDH+    +A+K+++N+K F  QA  E+K+LE +   D D    IV +  HF +RNH+C+ FELL+ NLY L++   F+G SL L +KFA  +   L  L   +  +IHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG  Y++ IDMWS GCILVEM TG PLF G +E DQ+  I+EVLGMPP++ LD   ++++FF       Y  L+ +          +GV  YL            SPGS+ L  I+             ++   L+D+  F + +L+ L++    R  P  AL H + ++
Sbjct:   57 NDGYDDENYDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPDGKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRLPDGSYQCLKVK----------DGVKEYL------------SPGSRKLHDILGCETGGPGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFFKK 401          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 198.749 bits (504), Expect = 6.244e-58
Identity = 122/352 (34.66%), Postives = 191/352 (54.26%), Query Frame = 1
Query:  499 ILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILL----KQQGRSGIKVIDFGSSCYDHQRI-YTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIIN---GVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNP----DLNSDANIDSEIQLK-DFTNFINFLLKCLEWVPDDRFTPKEALRHEWL 1515
            +L+ LG+G+FGQVVK +   T   VA+K++++   +A+Q   EI IL +L  ++ +   N V  +E F  +NH C+ FE+L  NLY  +K++KF    L  ++     +LV L  L    +IH DLKPENI+L    KQ  R  +KVIDFGS+ +  + +  TY+QSR+YRAPEVILG  +   IDMWS GC++ E+  G+PL+PG  E DQ+  II+  G+P  + L+   ++  FF                    K  IN   GV+ +     ++  +    P  ++   I N+++     +L+S    +  I  K D   F++ L + L    + R TP+EAL H+++
Sbjct:    1 VLEFLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLSAENSEAY-NFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQPFR--VKVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATKTSRFF--------------------KKAINTHTGVLEWKLKNANEHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTGNERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQFV 329          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 190.66 bits (483), Expect = 8.022e-54
Identity = 118/373 (31.64%), Postives = 203/373 (54.42%), Query Frame = 1
Query:  439 DDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILL-------------KQQGR----SGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRH 1506
            DDE G   +   D +  RYE+  +LG+G+FG+V++ YD KTG  VA+K+++N +++ + A  EIK+LE++  +++      + +L+ F    H+C+ FE + ++++  +K N ++ + L  V+  +Y ++V +  LH+ K+ H DLKPEN+L              KQ  R    S +++IDFGS+ ++H+   T + +R YRAPEVIL   +S   D+WS GCI+ E+ TG+ LF   +  + LA +  ++G  P +F  + +++K F+  KG     +LE + ++ SGK +        + CK         P  K + S               DSE   + F N +++L   LE+ P+ R T KEA++H
Sbjct:  107 DDEDGHLIYHKGDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNRYGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLHEMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKSRKTKYFY--KG-----KLEWDEKSSSGKYV-------RENCK---------PLKKYMLS---------------DSEGH-QLFFNLLDYL---LEYDPEKRITAKEAMQH 437          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Medaka
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:101170635])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 267/422 (63.27%), Postives = 328/422 (77.73%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNN 1551
            PLT +QAMK +M ++S+FEHHE+F++ ++YF+G +AKK+ G+  G NN GYDD+ GSY  V HDH++YRYE+LK++GKGSFGQVVKA+DHKT   VALKMVRNEKRF +QA EEI+ILE LK QDKD++ N++H+LE+FTFRNH+CMTFELL++NLY LIKKNKFQGFSL LV+KFA+SIL CLD LHKN++IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILG +Y + IDMWS GCIL E+LTGYPL PGEDE DQLACIIE+LGMP Q  LD  KR+K F  SKGYPRYC + T ++   G T++N       G +S+RGK RG PGSK  ++ +   +  L                 F++FL +CLEW P  R TP +ALRH WLRR+LP+PP    
Sbjct:  124 PLTAEQAMKQFMSKMSSFEHHEVFSFSEVYFIGPSAKKRSGVLGGPNNGGYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKILDASKRAKNFVSSKGYPRYCTVTTLSD---GTTVLN-------GGRSRRGKVRGPPGSKVWSTALKGCDDPL-----------------FLDFLKQCLEWDPAHRMTPSQALRHSWLRRRLPKPPTGTT 518          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 259/419 (61.81%), Postives = 313/419 (74.70%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLK--DFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            PLTPDQA++LY  +LS  E  EI +YP +YFVG NAKK+  ++ G+NN GYDDE G Y HV HDH++YRYE LKI+GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE L  QD++   N+VH+LE+FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L ++++IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCIL E+LTGYPLFPGEDE DQLAC +E+LGMPP   L+Q KR+K F  SKG+PRYC   T     +G T+       L G +S+RGK RG P SK                   D  + LK  +   FI+F+ KCL+W P  R TP +ALRH WL R+LP+P
Sbjct:  149 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNT---LPTGATV-------LTGSRSRRGKMRGPPASK-------------------DWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLPKP 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 259/419 (61.81%), Postives = 313/419 (74.70%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLK--DFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            PLTPDQA++LY  +LS  E  EI +YP +YFVG NAKK+  ++ G+NN GYDDE G Y HV HDH++YRYE LKI+GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE L  QD++   N+VH+LE+FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L ++++IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCIL E+LTGYPLFPGEDE DQLAC +E+LGMPP   L+Q KR+K F  SKG+PRYC   T     +G T+       L G +S+RGK RG P SK                   D  + LK  +   FI+F+ KCL+W P  R TP +ALRH WL R+LP+P
Sbjct:  149 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNT---LPTGATV-------LTGSRSRRGKMRGPPASK-------------------DWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLPKP 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 259/419 (61.81%), Postives = 313/419 (74.70%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLK--DFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRP 1536
            PLTPDQA++LY  +LS  E  EI +YP +YFVG NAKK+  ++ G+NN GYDDE G Y HV HDH++YRYE LKI+GKGSFGQV K YDHK    +ALKMVRNEKRF +QA EEI+ILE L  QD++   N+VH+LE+FTFRNH+CMTFELL++NLY LIK+NKFQGFSL LV+KFA+SIL CL+ L ++++IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILG +Y + IDMWSFGCIL E+LTGYPLFPGEDE DQLAC +E+LGMPP   L+Q KR+K F  SKG+PRYC   T     +G T+       L G +S+RGK RG P SK                   D  + LK  +   FI+F+ KCL+W P  R TP +ALRH WL R+LP+P
Sbjct:   91 PLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNT---LPTGATV-------LTGSRSRRGKMRGPPASK-------------------DWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLPKP 480          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Medaka
Match: dyrk4 (dual specificity tyrosine-phosphorylation-regulated kinase 4 [Source:NCBI gene;Acc:101159741])

HSP 1 Score: 447.203 bits (1149), Expect = 1.582e-149
Identity = 212/410 (51.71%), Postives = 279/410 (68.05%), Query Frame = 1
Query:  286 PLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWL 1515
            P++P +A+  +  RL+ FE  EI  Y +++F+G  ++K  G     +N+GYDDEHGSY  V HDH++YR+E+L+++GKGSFGQV+K  DHKT   VA+KM+RN+KRF  QAL E+KILE +K +DKDN  N++H+ E+F FRNH+C++FELL +NLY LIKKN FQGFSL L+++FA+++L CL +LHK K+IHCDLKPENILL Q+G   IKV+DFGSSCY+ QR+YTYIQSRFYR+PEVILG  YS+ IDMWS GCIL E+ TGYPLFPGE E++Q+ACI+EVLGMPP +F+    R K FF SKG PR               I N            +GK R  P SK L++ +   +P                   F+ F+  CL W P  R TP E L+H+W+
Sbjct:  131 PMSPSEALNNFQERLTEFEQEEINAYAEVWFLGLGSQKIEGSQGAPHNSGYDDEHGSYIRVLHDHIAYRFEVLEVIGKGSFGQVLKCLDHKTNELVAIKMIRNKKRFHHQALVELKILEVIKKKDKDNLHNVIHMKEYFYFRNHLCISFELLGVNLYELIKKNNFQGFSLALIRRFAHALLRCLQMLHKEKIIHCDLKPENILLSQRGPGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELHTGYPLFPGESEVEQIACIMEVLGMPPNDFVQSASRRKLFFDSKGNPR--------------NITNS-----------KGKKR-RPNSKELSAALKTTDP------------------LFLEFIKGCLTWDPTKRMTPDEGLQHQWI 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Planmine SMEST
Match: SMESG000064198.1 (SMESG000064198.1)

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 502/503 (99.80%), Postives = 502/503 (99.80%), Query Frame = 1
Query:   58 MNAPDQLTTPSHLPSIDNEXXXXXXXXXXXXXXXQENQNELNKTNFHRPNLVKFPDVSVYNNLEKSNLHLIHNVPSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            MNAPDQLTTPSHLPSIDNEISTINSSKSVSVIK QENQNELNKTNFHRPNLVKFPDVSVYNNLEKSNLHLIHNVPSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK
Sbjct:    1 MNAPDQLTTPSHLPSIDNEISTINSSKSVSVIKCQENQNELNKTNFHRPNLVKFPDVSVYNNLEKSNLHLIHNVPSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 503          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Planmine SMEST
Match: SMESG000064198.1 (SMESG000064198.1)

HSP 1 Score: 901.738 bits (2329), Expect = 0.000e+0
Identity = 459/503 (91.25%), Postives = 459/503 (91.25%), Query Frame = 1
Query:   58 MNAPDQLTTPSHLPSIDNEXXXXXXXXXXXXXXXQENQNELNKTNFHRPNLVKFPDVSVYNNLEKSNLHLIHNVPSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 1566
            MNAPDQLTTPSHLPSIDNEISTINSSKSVSVIK QENQNELNKTNFHRPNLVKFPDVSVYNNLEKS                                           HNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK
Sbjct:    1 MNAPDQLTTPSHLPSIDNEISTINSSKSVSVIKCQENQNELNKTNFHRPNLVKFPDVSVYNNLEKS-------------------------------------------HNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNSISK 460          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Planmine SMEST
Match: SMESG000042409.1 (SMESG000042409.1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 276/418 (66.03%), Postives = 335/418 (80.14%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTN--FINFLLKCLEWVPDDRFTPKEALRHEWLRRKLP 1530
            +P+  + AMKLYM++L++FEHHEIF+YP+IYFVG NAKK++G+  G +N GYDDE  SY +V HDH++YR+E++KILGKGSFGQVVKAYDHK  ++VALKM+RNEKRF +QA EEI+ILE LK QD  +N NIVHILE FTFRNHVCMTFELLNINLY LIKKNKFQGFSL LV+KFA+SIL+CLDLLH+NK+IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQRIYTYIQSRFYRAPEVILG  Y++ IDMWSFGCIL E+ TG PLFPGEDE DQLACIIE+LG+PP++ ++  KR+K F  S+GYPRYC +E +T+              LKG +SKRGKYRG PG+KS+ S+                   LK+ ++  F++FL +CL+W+P DR TP+EAL+ EWLRRK P
Sbjct:  151 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGH----------IILKGNRSKRGKYRGPPGNKSIVSL-------------------LKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 539          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Planmine SMEST
Match: SMESG000042409.1 (SMESG000042409.1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 276/418 (66.03%), Postives = 335/418 (80.14%), Query Frame = 1
Query:  283 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTN--FINFLLKCLEWVPDDRFTPKEALRHEWLRRKLP 1530
            +P+  + AMKLYM++L++FEHHEIF+YP+IYFVG NAKK++G+  G +N GYDDE  SY +V HDH++YR+E++KILGKGSFGQVVKAYDHK  ++VALKM+RNEKRF +QA EEI+ILE LK QD  +N NIVHILE FTFRNHVCMTFELLNINLY LIKKNKFQGFSL LV+KFA+SIL+CLDLLH+NK+IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQRIYTYIQSRFYRAPEVILG  Y++ IDMWSFGCIL E+ TG PLFPGEDE DQLACIIE+LG+PP++ ++  KR+K F  S+GYPRYC +E +T+              LKG +SKRGKYRG PG+KS+ S+                   LK+ ++  F++FL +CL+W+P DR TP+EAL+ EWLRRK P
Sbjct:  105 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGH----------IILKGNRSKRGKYRGPPGNKSIVSL-------------------LKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 279/451 (61.86%), Postives = 341/451 (75.61%), Query Frame = 1
Query:  172 NELNKTNFHRPNLVKFPDVSVYNNLEKSNLHLIHNVPSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRK 1524
            N++N TN    +L K  D         S +    N+ + L+PD AM+ +M +L+T+EHHEIF+YP I+FVG NAKK+ G+  G NN GYDD+  SY HVAHDH++YRYE+LK+LGKGSFGQVVKA DHKTG  VA+KMVRNEKRF +QA EEI++LE LK QD D+N N++HI++ F FRNHVCMTFELL+INLY LIKKNKFQGFSL LV+KFAYSIL+CL+LL++NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC +HQRIYTYIQSRFYRAPEVILGGKY + IDMWSFGCIL E+ TGYP+FPGEDE DQLACI+E+LG PP    D CKR+K FF S+ YPRYC   T+ +   G  I       LKG +SKRG++RG P SK+L++ +           N D ++       F++F L+CL W+P+ R TPKEAL+H WLRRK
Sbjct:  112 NQIN-TNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDAD---GSVI-------LKGGRSKRGRFRGPPASKTLSTAL----------KNCDDQL-------FLDFTLRCLTWIPETRMTPKEALKHPWLRRK 534          
The following BLAST results are available for this feature:
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK20.000e+063.55dual specificity tyrosine phosphorylation regulate... [more]
DYRK20.000e+063.79dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+060.67dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+060.67dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+060.67dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbk-20.000e+059.86Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+059.86Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+059.86Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+059.86Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+059.72Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk31.411e-17661.87gene:FBgn0027101 transcript:FBtr0100406[more]
Dyrk31.411e-17661.87gene:FBgn0027101 transcript:FBtr0100404[more]
Dyrk31.411e-17661.87gene:FBgn0027101 transcript:FBtr0100402[more]
Dyrk25.102e-13347.71gene:FBgn0016930 transcript:FBtr0100447[more]
Dyrk25.102e-13347.71gene:FBgn0016930 transcript:FBtr0089289[more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+063.33dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+063.33dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+063.33dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+060.80dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+060.80dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK20.000e+065.42dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+062.50dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+062.50dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+062.50dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+062.50dual specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk20.000e+063.32dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk30.000e+060.91dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk46.512e-14249.52dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b3.096e-9242.78dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b8.745e-9242.78dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92630|DYRK2_HUMAN0.000e+063.55Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q5U4C9|DYRK2_MOUSE0.000e+063.32Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q5ZIU3|DYRK2_CHICK0.000e+063.08Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9XTF3|MBK2_CAEEL0.000e+059.86Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|A8WJR8|MBK2_CAEBR0.000e+059.62Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7JJH40.000e+067.84Dual specificity tyrosine-phosphorylation-regulate... [more]
G7YDV10.000e+067.84Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A1I8JL070.000e+066.67Protein kinase domain-containing protein OS=Macros... [more]
A0A183ARR50.000e+067.84Protein kinase domain-containing protein OS=Echino... [more]
A0A4S2LGD80.000e+067.84Protein kinase domain-containing protein OS=Opisth... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+064.57dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+060.14dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+060.14dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk42.105e-14948.95dual specificity tyrosine phosphorylation regulate... [more]
dyrk42.241e-14948.95dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+062.90dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+060.72dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa8.346e-8842.50dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
ENSPMAT00000007952.11.164e-7539.28pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-... [more]
ENSPMAT00000007958.15.063e-7439.49pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK11.860e-7440.00Serine-threonine protein kinase; component of a gl... [more]
PHO851.394e-3835.19Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KSS13.423e-3631.25Mitogen-activated protein kinase (MAPK); involved ... [more]
HOG12.805e-3433.62Mitogen-activated protein kinase involved in osmor... [more]
KNS11.266e-3327.32Protein kinase involved in negative regulation of ... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461440.000e+065.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362946.160e-14663.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451871.202e-8943.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492386.244e-5834.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337588.022e-5431.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+063.27dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+061.81dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+061.81dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+061.81dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk41.582e-14951.71dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064198.10.000e+099.80SMESG000064198.1[more]
SMESG000064198.10.000e+091.25SMESG000064198.1[more]
SMESG000042409.10.000e+066.03SMESG000042409.1[more]
SMESG000042409.10.000e+066.03SMESG000042409.1[more]
SMESG000058389.10.000e+061.86SMESG000058389.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029726 ID=SMED30029726|Name=Dual specificity tyrosine-phosphorylation-regulated kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1943bp
TACTAAGAAAATCTTAACAAATGTAAAAGATAAAACTGAATTTGGAGCAA
AGTATTAATGAATGCTCCAGATCAATTGACAACTCCTTCTCATTTACCAT
CGATAGATAATGAAATTTCAACTATAAATTCTTCTAAATCGGTCTCCGTT
ATTAAGTCTCAGGAAAACCAAAATGAGCTTAATAAGACAAATTTTCATAG
ACCGAATTTAGTGAAGTTTCCAGATGTTTCAGTTTATAATAATCTTGAAA
AAAGTAATCTTCATTTAATCCATAATGTTCCATCACCATTGACACCAGAT
CAAGCGATGAAATTATATATGCATAGGCTATCAACTTTTGAGCATCATGA
AATATTTAATTATCCTCAAATATATTTTGTAGGTCATAACGCGAAGAAAA
AGCATGGCATTTCAGTTGGTGCAAATAATAATGGTTATGACGATGAGCAT
GGGTCTTATCAACATGTTGCTCACGATCATGTATCCTATCGCTATGAAAT
TTTAAAAATTCTTGGTAAAGGAAGTTTCGGACAAGTTGTTAAAGCTTATG
ATCATAAAACCGGAATGTTTGTTGCTTTAAAAATGGTTCGAAATGAGAAA
CGATTTGCCAAACAGGCATTAGAGGAAATTAAAATTCTCGAACAACTCAA
AATCCAAGACAAAGACAATAATAAAAATATCGTTCACATTCTCGAACATT
TCACATTTCGCAACCATGTTTGCATGACATTTGAATTGCTCAACATTAAT
CTGTACAGTCTGATTAAGAAAAACAAATTTCAGGGATTTTCTTTGTTGCT
TGTGAAAAAATTTGCCTATTCTATTCTTGTCTGCTTGGATTTATTGCACA
AAAATAAGGTGATTCATTGTGACTTGAAGCCGGAAAATATTCTTTTGAAA
CAACAAGGTCGCAGTGGAATCAAGGTCATCGATTTCGGTTCAAGTTGCTA
TGATCACCAGAGAATTTATACGTATATTCAATCGAGATTTTATCGAGCGC
CTGAAGTGATTCTAGGCGGAAAATATAGTGTTCAGATTGACATGTGGAGT
TTTGGTTGTATTTTGGTAGAGATGTTGACTGGATATCCGCTTTTTCCGGG
CGAAGATGAAATGGACCAATTGGCGTGTATTATTGAAGTGCTTGGTATGC
CGCCTCAGAATTTTCTCGACCAATGTAAAAGAAGCAAAGAATTTTTCTGT
AGCAAAGGCTACCCAAGATATTGTCAATTGGAAACCGAAACCGAAACGCA
GTCTGGTAAAACAATAATCAATGGCGTTGTGTTTTATCTGAAAGGTTGCA
AATCTAAAAGAGGGAAATATCGGGGCTCGCCGGGTTCTAAGAGCCTGGCT
AGCATTGTCAATGCCATGAATCCAGATTTGAACTCTGATGCAAATATCGA
TTCAGAAATTCAATTGAAGGATTTTACAAATTTCATAAATTTCCTCCTAA
AATGTTTGGAGTGGGTGCCCGACGATCGATTTACACCGAAAGAAGCACTT
AGACACGAATGGTTACGTCGAAAACTCCCCAGGCCTCCTGATAACAATAA
CAATAGCATCTCAAAATGATTGGTTTTTCTCTATCAATAATACTCGAAAG
ATTATTTCCAGAATTTTCTTATCTTCTTTAAATTGAAAATTGATTATTTT
TTCCATGTTTTATTTCTTTATCGATTGATTTAGTGCTGGACTGATTTCCA
ATAGATTATGTTTTTTGTTTAAATTCTATGAAAATTATTCTACGGATTTT
AACAATATCAGTATTAAATTGAGTGGCTGTTATGATTGGTTTTTCAACAA
TTGCATTTTTATATAGAATTATGTTGTGGGATTTTTGTTTGAATTTGTTT
ATTTAGATGTCTCAATAATTTGGATGTTAAGTGCTCTTAAAGAATCAAAA
TGTCAGTCTAGGATTGTCTAGGATTGTCTAGGATTGTTGTTAT
back to top

protein sequence of SMED30029726-orf-1

>SMED30029726-orf-1 ID=SMED30029726-orf-1|Name=SMED30029726-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MNAPDQLTTPSHLPSIDNEISTINSSKSVSVIKSQENQNELNKTNFHRPN
LVKFPDVSVYNNLEKSNLHLIHNVPSPLTPDQAMKLYMHRLSTFEHHEIF
NYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILK
ILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQ
DKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVK
KFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDH
QRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGED
EMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSG
KTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSE
IQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNNNNS
ISK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042521DYRK
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030145manganese ion binding
GO:0043130ubiquitin binding
GO:0000166nucleotide binding
GO:0000287magnesium ion binding
GO:0004674protein serine/threonine kinase activity
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0004713protein tyrosine kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0006974cellular response to DNA damage stimulus
GO:0007224smoothened signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0045725positive regulation of glycogen biosynthetic process
GO:0051534negative regulation of NFAT protein import into nucleus
GO:1901796regulation of signal transduction by p53 class mediator
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0030529intracellular ribonucleoprotein complex
GO:0000151ubiquitin ligase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 174..204
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 202..486
e-value: 7.3E-122
score: 408.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 128..227
e-value: 7.3E-122
score: 408.7
NoneNo IPR availablePANTHERPTHR24058:SF112DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 3 HOMOLOG-RELATEDcoord: 42..499
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 42..499
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 146..486
e-value: 8.3E-90
score: 314.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 146..486
e-value: 7.6E-57
score: 192.7
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 146..486
score: 40.216
IPR042521Dual specificity tyrosine-phosphorylation-regulated kinaseGENE3DG3DSA:1.10.8.980coord: 56..120
e-value: 5.7E-18
score: 67.1
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 268..280
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 152..175
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 138..492