GYF domain-containing protein

Overview
NameGYF domain-containing protein
Smed IDSMED30029716
Length (bp)3804
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GYF domain-containing protein (SMED30029716) t-SNE clustered cells

Violin plots show distribution of expression levels for GYF domain-containing protein (SMED30029716) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GYF domain-containing protein (SMED30029716) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GYF domain-containing protein (SMED30029716) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029716

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30029716SMESG000052533.1 dd_Smed_v4_3448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029716SMESG000052533.1 dd_Smed_v4_3448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30029716SMESG000052533.1 dd_Smed_v4_3448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029716SMESG000052533.1 dd_Smed_v4_3448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029716SMESG000052533.1 dd_Smed_v4_3448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029716SMESG000052533.1 Contig12020newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029716SMESG000052533.1 Contig12020uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30029716SMESG000052533.1 dd_Smed_v6_3448_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30029716SMESG000052533.1 dd_Smed_v6_3448_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GYF domain-containing protein vs. Ensembl Human
Match: GIGYF1 (GRB10 interacting GYF protein 1 [Source:HGNC Symbol;Acc:HGNC:9126])

HSP 1 Score: 59.6918 bits (143), Expect = 4.411e-8
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRI 1149
            WFY+D     +GPF +++MA W   GYF+ +  V+R CDE F  L E   ++GR+
Sbjct:  477 WFYKDPQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVIKMWGRV 531          
BLAST of GYF domain-containing protein vs. Ensembl Human
Match: GIGYF1 (GRB10 interacting GYF protein 1 [Source:HGNC Symbol;Acc:HGNC:9126])

HSP 1 Score: 59.6918 bits (143), Expect = 4.411e-8
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRI 1149
            WFY+D     +GPF +++MA W   GYF+ +  V+R CDE F  L E   ++GR+
Sbjct:  477 WFYKDPQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVIKMWGRV 531          
BLAST of GYF domain-containing protein vs. Ensembl Human
Match: GIGYF2 (GRB10 interacting GYF protein 2 [Source:HGNC Symbol;Acc:HGNC:11960])

HSP 1 Score: 58.151 bits (139), Expect = 1.089e-7
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  958 PIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            P+       W+Y+D     +GPF +++MA W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  521 PLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVP 585          
BLAST of GYF domain-containing protein vs. Ensembl Human
Match: GIGYF2 (GRB10 interacting GYF protein 2 [Source:HGNC Symbol;Acc:HGNC:11960])

HSP 1 Score: 58.151 bits (139), Expect = 1.109e-7
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  958 PIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            P+       W+Y+D     +GPF +++MA W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  527 PLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVP 591          
BLAST of GYF domain-containing protein vs. Ensembl Human
Match: GIGYF2 (GRB10 interacting GYF protein 2 [Source:HGNC Symbol;Acc:HGNC:11960])

HSP 1 Score: 58.151 bits (139), Expect = 1.109e-7
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  958 PIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            P+       W+Y+D     +GPF +++MA W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  527 PLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVP 591          
BLAST of GYF domain-containing protein vs. Ensembl Fly
Match: Gyf (gene:FBgn0039936 transcript:FBtr0300882)

HSP 1 Score: 66.6254 bits (161), Expect = 1.622e-10
Identity = 41/107 (38.32%), Postives = 53/107 (49.53%), Query Frame = 1
Query:  979 DLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEY-RALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHR 1296
            +LWFYRD     +GPF + +M  W   GYFN   FVRR  D +F  L E  +  +G +PFT    +P     +PIELE   I +G      Q       SLS  PH+
Sbjct:  560 ELWFYRDPQANVQGPFSAVEMTEWYRAGYFNENLFVRRYSDNRFRPLGELIKFCHGNMPFTHSHLLP-----SPIELE--NIPVG------QIPAPLTASLSITPHK 653          
BLAST of GYF domain-containing protein vs. Ensembl Fly
Match: Gyf (gene:FBgn0039936 transcript:FBtr0300884)

HSP 1 Score: 66.6254 bits (161), Expect = 1.622e-10
Identity = 41/107 (38.32%), Postives = 53/107 (49.53%), Query Frame = 1
Query:  979 DLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEY-RALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHR 1296
            +LWFYRD     +GPF + +M  W   GYFN   FVRR  D +F  L E  +  +G +PFT    +P     +PIELE   I +G      Q       SLS  PH+
Sbjct:  560 ELWFYRDPQANVQGPFSAVEMTEWYRAGYFNENLFVRRYSDNRFRPLGELIKFCHGNMPFTHSHLLP-----SPIELE--NIPVG------QIPAPLTASLSITPHK 653          
BLAST of GYF domain-containing protein vs. Ensembl Fly
Match: Gyf (gene:FBgn0039936 transcript:FBtr0300885)

HSP 1 Score: 66.6254 bits (161), Expect = 1.666e-10
Identity = 41/107 (38.32%), Postives = 53/107 (49.53%), Query Frame = 1
Query:  979 DLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEY-RALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHR 1296
            +LWFYRD     +GPF + +M  W   GYFN   FVRR  D +F  L E  +  +G +PFT    +P     +PIELE   I +G      Q       SLS  PH+
Sbjct:  567 ELWFYRDPQANVQGPFSAVEMTEWYRAGYFNENLFVRRYSDNRFRPLGELIKFCHGNMPFTHSHLLP-----SPIELE--NIPVG------QIPAPLTASLSITPHK 660          
BLAST of GYF domain-containing protein vs. Ensembl Fly
Match: Gyf (gene:FBgn0039936 transcript:FBtr0300886)

HSP 1 Score: 66.6254 bits (161), Expect = 1.666e-10
Identity = 41/107 (38.32%), Postives = 53/107 (49.53%), Query Frame = 1
Query:  979 DLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEY-RALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHR 1296
            +LWFYRD     +GPF + +M  W   GYFN   FVRR  D +F  L E  +  +G +PFT    +P     +PIELE   I +G      Q       SLS  PH+
Sbjct:  567 ELWFYRDPQANVQGPFSAVEMTEWYRAGYFNENLFVRRYSDNRFRPLGELIKFCHGNMPFTHSHLLP-----SPIELE--NIPVG------QIPAPLTASLSITPHK 660          
BLAST of GYF domain-containing protein vs. Ensembl Zebrafish
Match: gigyf2 (GRB10 interacting GYF protein 2 [Source:NCBI gene;Acc:561830])

HSP 1 Score: 80.1073 bits (196), Expect = 1.771e-14
Identity = 33/66 (50.00%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPI 1182
            WFY+D     +GPF +++M+ W   GYF  T  V+R CDE F  L E   L+GR+PFT GPT+PPI
Sbjct:  559 WFYKDPQGEIQGPFNNQEMSEWFQAGYFTMTLQVKRGCDEMFQPLGEMIKLWGRVPFTPGPTLPPI 624          
BLAST of GYF domain-containing protein vs. Ensembl Zebrafish
Match: gigyf1b (GRB10 interacting GYF protein 1b [Source:ZFIN;Acc:ZDB-GENE-091204-310])

HSP 1 Score: 61.2326 bits (147), Expect = 8.883e-9
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPF 1155
            WFY+D     +GPF + +M  W   GYF     V+R CDE F  L E   ++GR+PF
Sbjct:  520 WFYKDPQGEIQGPFTTVEMCEWFQAGYFAMNLLVKRGCDEGFQPLGEVIKMWGRVPF 576          
BLAST of GYF domain-containing protein vs. Ensembl Zebrafish
Match: gigyf1b (GRB10 interacting GYF protein 1b [Source:ZFIN;Acc:ZDB-GENE-091204-310])

HSP 1 Score: 61.2326 bits (147), Expect = 9.644e-9
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPF 1155
            WFY+D     +GPF + +M  W   GYF     V+R CDE F  L E   ++GR+PF
Sbjct:  497 WFYKDPQGEIQGPFTTVEMCEWFQAGYFAMNLLVKRGCDEGFQPLGEVIKMWGRVPF 553          
BLAST of GYF domain-containing protein vs. Ensembl Zebrafish
Match: gigyf1b (GRB10 interacting GYF protein 1b [Source:ZFIN;Acc:ZDB-GENE-091204-310])

HSP 1 Score: 60.8474 bits (146), Expect = 1.022e-8
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPF 1155
            WFY+D     +GPF + +M  W   GYF     V+R CDE F  L E   ++GR+PF
Sbjct:  520 WFYKDPQGEIQGPFTTVEMCEWFQAGYFAMNLLVKRGCDEGFQPLGEVIKMWGRVPF 576          
BLAST of GYF domain-containing protein vs. Ensembl Zebrafish
Match: gigyf1a (GRB10 interacting GYF protein 1a [Source:ZFIN;Acc:ZDB-GENE-050809-79])

HSP 1 Score: 55.0694 bits (131), Expect = 6.304e-7
Identity = 23/56 (41.07%), Postives = 31/56 (55.36%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            WFY+D     +GPF + +M  W   GYF     V+R CDE F  L E   ++GR+P
Sbjct:  494 WFYKDPQGEIQGPFSTVEMCEWFQAGYFAMNLLVKRGCDEGFQPLGEVIKMWGRVP 549          
BLAST of GYF domain-containing protein vs. Ensembl Xenopus
Match: spin1 (spindlin 1 [Source:Xenbase;Acc:XB-GENE-954616])

HSP 1 Score: 67.3958 bits (163), Expect = 1.872e-10
Identity = 37/112 (33.04%), Postives = 55/112 (49.11%), Query Frame = 1
Query:  961 IKSPEFD---LWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHI 1287
            +K P  D    W+Y+D     +GPF + +MA W   GYF  T  +RR CD+ F  L +    +GR+PF+  PT  P  L    +L+P ++        RQQ I     + H+
Sbjct:  509 VKGPSLDNQQKWYYKDPQGEIQGPFSNREMAEWYQAGYFPMTLLLRRVCDDAFQSLGDIIKKWGRVPFSTPPT--PTRLG---DLDPERL-------SRQQEITALYQMHHL 608          
BLAST of GYF domain-containing protein vs. Ensembl Xenopus
Match: spin1 (spindlin 1 [Source:Xenbase;Acc:XB-GENE-954616])

HSP 1 Score: 64.6994 bits (156), Expect = 1.112e-9
Identity = 31/81 (38.27%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  961 IKSPEFD---LWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNT 1194
            +K P  D    W+Y+D     +GPF + +MA W   GYF  T  +RR CD+ F  L +    +GR+PF+  PT  P  L T
Sbjct:  482 VKGPSLDNQQKWYYKDPQGEIQGPFSNREMAEWYQAGYFPMTLLLRRVCDDAFQSLGDIIKKWGRVPFSTPPT--PTRLVT 560          
BLAST of GYF domain-containing protein vs. Ensembl Xenopus
Match: spin1 (spindlin 1 [Source:Xenbase;Acc:XB-GENE-954616])

HSP 1 Score: 64.3142 bits (155), Expect = 1.453e-9
Identity = 31/81 (38.27%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  961 IKSPEFD---LWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNT 1194
            +K P  D    W+Y+D     +GPF + +MA W   GYF  T  +RR CD+ F  L +    +GR+PF+  PT  P  L T
Sbjct:  491 VKGPSLDNQQKWYYKDPQGEIQGPFSNREMAEWYQAGYFPMTLLLRRVCDDAFQSLGDIIKKWGRVPFSTPPT--PTRLVT 569          
BLAST of GYF domain-containing protein vs. Ensembl Xenopus
Match: gigyf1 (GRB10 interacting GYF protein 1 [Source:NCBI gene;Acc:780058])

HSP 1 Score: 59.6918 bits (143), Expect = 3.540e-8
Identity = 23/55 (41.82%), Postives = 33/55 (60.00%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRI 1149
            WFY+D     +GPF +++MA W   GYF  +  V+R CDE F  L E   ++GR+
Sbjct:  489 WFYKDPQGEIQGPFTTQEMAEWCQAGYFTMSLLVKRGCDEGFQPLGEVIKMWGRV 543          
BLAST of GYF domain-containing protein vs. Ensembl Xenopus
Match: gigyf1 (GRB10 interacting GYF protein 1 [Source:NCBI gene;Acc:780058])

HSP 1 Score: 59.6918 bits (143), Expect = 3.879e-8
Identity = 23/55 (41.82%), Postives = 33/55 (60.00%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRI 1149
            WFY+D     +GPF +++MA W   GYF  +  V+R CDE F  L E   ++GR+
Sbjct:  471 WFYKDPQGEIQGPFTTQEMAEWCQAGYFTMSLLVKRGCDEGFQPLGEVIKMWGRV 525          
BLAST of GYF domain-containing protein vs. Ensembl Mouse
Match: Gigyf1 (GRB10 interacting GYF protein 1 [Source:MGI Symbol;Acc:MGI:1888677])

HSP 1 Score: 59.3066 bits (142), Expect = 3.448e-8
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRI 1149
            WFY+D     +GPF +++MA W   GYF+ +  V+R CDE F  L E   ++GR+
Sbjct:  479 WFYKDPQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVIKMWGRV 533          
BLAST of GYF domain-containing protein vs. Ensembl Mouse
Match: Gigyf2 (GRB10 interacting GYF protein 2 [Source:MGI Symbol;Acc:MGI:2138584])

HSP 1 Score: 58.5362 bits (140), Expect = 5.058e-8
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  958 PIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            P+       W+Y+D     +GPF +++MA W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  350 PLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVP 414          
BLAST of GYF domain-containing protein vs. Ensembl Mouse
Match: Gigyf2 (GRB10 interacting GYF protein 2 [Source:MGI Symbol;Acc:MGI:2138584])

HSP 1 Score: 58.151 bits (139), Expect = 8.335e-8
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  958 PIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            P+       W+Y+D     +GPF +++MA W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  522 PLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVP 586          
BLAST of GYF domain-containing protein vs. Ensembl Mouse
Match: Gigyf2 (GRB10 interacting GYF protein 2 [Source:MGI Symbol;Acc:MGI:2138584])

HSP 1 Score: 58.151 bits (139), Expect = 9.003e-8
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  958 PIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            P+       W+Y+D     +GPF +++MA W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  528 PLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVP 592          
BLAST of GYF domain-containing protein vs. Ensembl Mouse
Match: Gigyf2 (GRB10 interacting GYF protein 2 [Source:MGI Symbol;Acc:MGI:2138584])

HSP 1 Score: 58.151 bits (139), Expect = 9.003e-8
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  958 PIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            P+       W+Y+D     +GPF +++MA W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  528 PLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVP 592          
BLAST of GYF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4KME6|GGYF2_DANRE (GRB10-interacting GYF protein 2 OS=Danio rerio OX=7955 GN=gigyf2 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.337e-13
Identity = 33/66 (50.00%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPI 1182
            WFY+D     +GPF +++M+ W   GYF  T  V+R CDE F  L E   L+GR+PFT GPT+PPI
Sbjct:  559 WFYKDPQGEIQGPFNNQEMSEWFQAGYFTMTLQVKRGCDEMFQPLGEMIKLWGRVPFTPGPTLPPI 624          
BLAST of GYF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7KQM6|GGYF1_DROME (GIGYF family protein CG11148 OS=Drosophila melanogaster OX=7227 GN=CG11148 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 1.670e-9
Identity = 41/107 (38.32%), Postives = 53/107 (49.53%), Query Frame = 1
Query:  979 DLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEY-RALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHR 1296
            +LWFYRD     +GPF + +M  W   GYFN   FVRR  D +F  L E  +  +G +PFT    +P     +PIELE   I +G      Q       SLS  PH+
Sbjct:  567 ELWFYRDPQANVQGPFSAVEMTEWYRAGYFNENLFVRRYSDNRFRPLGELIKFCHGNMPFTHSHLLP-----SPIELE--NIPVG------QIPAPLTASLSITPHK 660          
BLAST of GYF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5U236|GGYF2_XENLA (GRB10-interacting GYF protein 2 OS=Xenopus laevis OX=8355 GN=gigyf2 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.850e-9
Identity = 29/73 (39.73%), Postives = 40/73 (54.79%), Query Frame = 1
Query:  961 IKSPEFD---LWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPT 1170
            +K P  D    W+Y+D     +GPF + +MA W   GYF  T  +RR CDE F  L +    +GR+PF+  PT
Sbjct:  480 VKGPSLDNQQKWYYKDPQGEIQGPFSNREMAEWYQAGYFPMTLLLRRVCDETFQPLGDIFKKWGRVPFSTPPT 552          
BLAST of GYF domain-containing protein vs. UniProt/SwissProt
Match: sp|O75420|GGYF1_HUMAN (GRB10-interacting GYF protein 1 OS=Homo sapiens OX=9606 GN=GIGYF1 PE=1 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 2.118e-7
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRI 1149
            WFY+D     +GPF +++MA W   GYF+ +  V+R CDE F  L E   ++GR+
Sbjct:  477 WFYKDPQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVIKMWGRV 531          
BLAST of GYF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99MR1|GGYF1_MOUSE (GRB10-interacting GYF protein 1 OS=Mus musculus OX=10090 GN=Gigyf1 PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 2.412e-7
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRI 1149
            WFY+D     +GPF +++MA W   GYF+ +  V+R CDE F  L E   ++GR+
Sbjct:  479 WFYKDPQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVIKMWGRV 533          
BLAST of GYF domain-containing protein vs. TrEMBL
Match: A0A1B6CPY8 (GYF domain-containing protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.19117 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.708e-13
Identity = 52/135 (38.52%), Postives = 71/135 (52.59%), Query Frame = 1
Query:  805 DTEMKSEIAKDELELNLDSYE---FPKSSIMSV---TPPLLESDAIPPESLFETQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLN 1191
            +T ++ +   D+L   L  YE    PKS++ SV   TP  +  + IP  +L         + + D WFYRD     +GPF S +MA W   GYF+    VRR CDEK+  L E  ALYG +PF +  +VPPI  N
Sbjct:  482 ETMLRMQEVADDLIAKLIDYEDKDVPKSAVTSVHQNTP--IVPNTIPSATL---------NSDTDKWFYRDPQGTIQGPFLSSEMAEWYKLGYFSSNLQVRRACDEKYSPLGELIALYGSVPFVSNSSVPPIKAN 605          
BLAST of GYF domain-containing protein vs. TrEMBL
Match: A0A0L8I8T7 (GYF domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028032mg PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.245e-12
Identity = 38/89 (42.70%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  928 PESLFETQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNT 1194
            P+   ETQVE   +   D WFYRD    E+GPF +E+M+ W + GYF     V+R CD+ +  L E     GR+PF AGP +PP   N 
Sbjct:  136 PKKSVETQVE---TSNHDEWFYRDPQGDEQGPFSTEEMSEWFSVGYFAMKLMVKRSCDDYYQPLGELVKRCGRVPFLAGPPIPPFKTNV 221          
BLAST of GYF domain-containing protein vs. TrEMBL
Match: A0A0L8I8Y9 (GYF domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028032mg PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.573e-12
Identity = 38/89 (42.70%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  928 PESLFETQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNT 1194
            P+   ETQVE   +   D WFYRD    E+GPF +E+M+ W + GYF     V+R CD+ +  L E     GR+PF AGP +PP   N 
Sbjct:  136 PKKSVETQVE---TSNHDEWFYRDPQGDEQGPFSTEEMSEWFSVGYFAMKLMVKRSCDDYYQPLGELVKRCGRVPFLAGPPIPPFKTNV 221          
BLAST of GYF domain-containing protein vs. TrEMBL
Match: K1PWC7 (PERQ amino acid-rich with GYF domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10005699 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.854e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEP 1212
            WFYRD     +GPF S +MA W + GYF    +VRR CD+KF  L E    +GR+PF  GP+ PP+ LN P   +P
Sbjct:  498 WFYRDPQGDTQGPFASNEMAEWFSAGYFTMDLYVRRGCDDKFSPLGELIKRWGRVPFLPGPSAPPL-LNVPPTSQP 572          
BLAST of GYF domain-containing protein vs. TrEMBL
Match: E2BGW3 (PERQ amino acid-rich with GYF domain-containing protein 2 OS=Harpegnathos saltator OX=610380 GN=EAI_14891 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 3.619e-12
Identity = 31/68 (45.59%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHL 1188
            WFYRD     +GPF + +MA W   GYF     VRR CDE++  L +   + GR+PFT GP++PP+ L
Sbjct:  548 WFYRDPQGEVQGPFLASEMAEWCKAGYFTAGLLVRRTCDERYYTLGDLIKMCGRVPFTPGPSIPPLKL 615          
BLAST of GYF domain-containing protein vs. Ensembl Cavefish
Match: gigyf1b (GRB10-interacting GYF protein 1-like [Source:NCBI gene;Acc:103030193])

HSP 1 Score: 61.6178 bits (148), Expect = 5.528e-9
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPF 1155
            WFY+D     +GPF   +M  W   GYF  T  V+R CDE F  L +   ++GR+PF
Sbjct:  496 WFYKDPQGEIQGPFSPVEMCEWFQAGYFTMTLLVKRGCDEGFQPLGDVIKMWGRVPF 552          
BLAST of GYF domain-containing protein vs. Ensembl Cavefish
Match: gigyf2 (GRB10 interacting GYF protein 2 [Source:NCBI gene;Acc:561830])

HSP 1 Score: 59.3066 bits (142), Expect = 3.075e-8
Identity = 24/56 (42.86%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            WFY+D     +GPF + +M+ W   GYF  T  V+R CDE F  L E   ++GR+P
Sbjct:  594 WFYKDPQGEIQGPFNNHEMSEWFQAGYFTMTLLVKRGCDEGFHPLGELVKMWGRVP 649          
BLAST of GYF domain-containing protein vs. Ensembl Cavefish
Match: gigyf2 (GRB10 interacting GYF protein 2 [Source:NCBI gene;Acc:561830])

HSP 1 Score: 59.3066 bits (142), Expect = 3.263e-8
Identity = 24/56 (42.86%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            WFY+D     +GPF + +M+ W   GYF  T  V+R CDE F  L E   ++GR+P
Sbjct:  594 WFYKDPQGEIQGPFNNHEMSEWFQAGYFTMTLLVKRGCDEGFHPLGELVKMWGRVP 649          
BLAST of GYF domain-containing protein vs. Ensembl Cavefish
Match: gigyf1a (GRB10 interacting GYF protein 1 [Source:NCBI gene;Acc:103030980])

HSP 1 Score: 55.0694 bits (131), Expect = 5.842e-7
Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            WFY+D     +GPF + +M  W   GYF+ +  V+R CDE F  L +   ++GR+P
Sbjct:  487 WFYKDPQGEIQGPFSTVEMCEWFQAGYFSMSLLVKRGCDEGFQPLGDVIKMWGRVP 542          
BLAST of GYF domain-containing protein vs. Ensembl Cavefish
Match: gigyf1a (GRB10 interacting GYF protein 1 [Source:NCBI gene;Acc:103030980])

HSP 1 Score: 54.6842 bits (130), Expect = 7.317e-7
Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            WFY+D     +GPF + +M  W   GYF+ +  V+R CDE F  L +   ++GR+P
Sbjct:  487 WFYKDPQGEIQGPFSTVEMCEWFQAGYFSMSLLVKRGCDEGFQPLGDVIKMWGRVP 542          
BLAST of GYF domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004025.1 (pep scaffold:Pmarinus_7.0:GL479268:15997:31586:-1 gene:ENSPMAG00000003681.1 transcript:ENSPMAT00000004025.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 8.604e-7
Identity = 20/43 (46.51%), Postives = 26/43 (60.47%), Query Frame = 1
Query: 1018 GPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGR 1146
            GPF +++MA W   GYF  T  V+R CDE F  L E   ++GR
Sbjct:    3 GPFTNQEMAEWFQAGYFTMTLLVKRGCDEGFQPLGEVIKMWGR 45          
BLAST of GYF domain-containing protein vs. Ensembl Nematostella
Match: EDO33168 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSZ9])

HSP 1 Score: 67.0106 bits (162), Expect = 4.333e-11
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPI 1182
            W+Y D    ++GPF + +MA+W   GYF+    +RR  DE F  L E    +GR+PF AGP  P +
Sbjct:  464 WYYTDPQGKQQGPFTNAEMADWFKHGYFSMNLMIRRMTDEVFQPLGELIKSWGRVPFHAGPQPPAL 529          
BLAST of GYF domain-containing protein vs. Ensembl Medaka
Match: gigyf2 (GRB10 interacting GYF protein 2 [Source:NCBI gene;Acc:101162074])

HSP 1 Score: 55.4546 bits (132), Expect = 4.885e-7
Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            W Y+D     +GPF +++M+ W   GYF  +  V+R CDE F  L E   ++GR+P
Sbjct:  539 WLYKDPQGEIQGPFSNQEMSEWFQAGYFTVSLLVKRGCDEVFQPLGEIMKIWGRVP 594          
BLAST of GYF domain-containing protein vs. Ensembl Medaka
Match: gigyf1a (GRB10 interacting GYF protein 1 [Source:NCBI gene;Acc:101159468])

HSP 1 Score: 54.6842 bits (130), Expect = 7.913e-7
Identity = 22/56 (39.29%), Postives = 32/56 (57.14%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            WFY+D     +GPF + +M  W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  535 WFYKDPQGEIQGPFTTVEMCEWFQAGYFTMSLLVKRGCDEGFQPLGDVIKMWGRVP 590          
BLAST of GYF domain-containing protein vs. Ensembl Medaka
Match: gigyf1a (GRB10 interacting GYF protein 1 [Source:NCBI gene;Acc:101159468])

HSP 1 Score: 54.299 bits (129), Expect = 1.019e-6
Identity = 22/56 (39.29%), Postives = 32/56 (57.14%), Query Frame = 1
Query:  985 WFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIP 1152
            WFY+D     +GPF + +M  W   GYF  +  V+R CDE F  L +   ++GR+P
Sbjct:  535 WFYKDPQGEIQGPFTTVEMCEWFQAGYFTMSLLVKRGCDEGFQPLGDVIKMWGRVP 590          
BLAST of GYF domain-containing protein vs. Planmine SMEST
Match: SMESG000052533.1 (SMESG000052533.1)

HSP 1 Score: 2035.77 bits (5273), Expect = 0.000e+0
Identity = 1064/1072 (99.25%), Postives = 1066/1072 (99.44%), Query Frame = 1
Query:   64 MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGKLIYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAKIFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDELELNLDSYEFPKSSIMSVTPPLLESDAIPPESLFETQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSXXXXXXXXXXXXXXXENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSDPPSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTESKPSDISVFTKDSDKSVKEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTESPSTWKSGQTLSQNVPPAAKSLVEIQXXXXXXXXXXXXXXXXXXVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETESDQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNXXXXXXXXXXXXXMVVIEAKFR 3279
            MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGK IYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAKIFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDEL  NLDSYEFPKSSIMSVTPPLLESDAIPPESLFE QVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSKDIKIQKKNKKTKAKENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSD PSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTESKPSDISVFTKDSDKSVKEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTE+PSTWKSGQTLSQNVPPAAKSL+EIQAEEALKAKKNKEIEKAMKVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETE DQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNSKSKSGKSKSKKKMVVIEAKFR
Sbjct:    1 MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGKSIYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAKIFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDEL--NLDSYEFPKSSIMSVTPPLLESDAIPPESLFEPQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSKDIKIQKKNKKTKAKENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSDSPSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTESKPSDISVFTKDSDKSVKEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTETPSTWKSGQTLSQNVPPAAKSLLEIQAEEALKAKKNKEIEKAMKVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETEFDQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNSKSKSGKSKSKKKMVVIEAKFR 1070          
BLAST of GYF domain-containing protein vs. Planmine SMEST
Match: SMESG000052533.1 (SMESG000052533.1)

HSP 1 Score: 2030.37 bits (5259), Expect = 0.000e+0
Identity = 1064/1073 (99.16%), Postives = 1066/1073 (99.35%), Query Frame = 1
Query:   64 MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGKLIYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAK-IFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDELELNLDSYEFPKSSIMSVTPPLLESDAIPPESLFETQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSXXXXXXXXXXXXXXXENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSDPPSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTESKPSDISVFTKDSDKSVKEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTESPSTWKSGQTLSQNVPPAAKSLVEIQXXXXXXXXXXXXXXXXXXVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETESDQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNXXXXXXXXXXXXXMVVIEAKFR 3279
            MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGK IYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAK IFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDEL  NLDSYEFPKSSIMSVTPPLLESDAIPPESLFE QVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSKDIKIQKKNKKTKAKENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSD PSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTESKPSDISVFTKDSDKSVKEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTE+PSTWKSGQTLSQNVPPAAKSL+EIQAEEALKAKKNKEIEKAMKVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETE DQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNSKSKSGKSKSKKKMVVIEAKFR
Sbjct:    1 MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGKSIYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAKQIFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDEL--NLDSYEFPKSSIMSVTPPLLESDAIPPESLFEPQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSKDIKIQKKNKKTKAKENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSDSPSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTESKPSDISVFTKDSDKSVKEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTETPSTWKSGQTLSQNVPPAAKSLLEIQAEEALKAKKNKEIEKAMKVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETEFDQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNSKSKSGKSKSKKKMVVIEAKFR 1071          
BLAST of GYF domain-containing protein vs. Planmine SMEST
Match: SMESG000052533.1 (SMESG000052533.1)

HSP 1 Score: 1993.39 bits (5163), Expect = 0.000e+0
Identity = 1047/1072 (97.67%), Postives = 1050/1072 (97.95%), Query Frame = 1
Query:   64 MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGKLIYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAKIFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDELELNLDSYEFPKSSIMSVTPPLLESDAIPPESLFETQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSXXXXXXXXXXXXXXXENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSDPPSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTESKPSDISVFTKDSDKSVKEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTESPSTWKSGQTLSQNVPPAAKSLVEIQXXXXXXXXXXXXXXXXXXVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETESDQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNXXXXXXXXXXXXXMVVIEAKFR 3279
            MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGK IYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAKIFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDEL  NLDSYEFPKSSIMSVTPPLLESDAIPPESLFE QVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSKDIKIQKKNKKTKAKENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSD PSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTE                +KEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTE+PSTWKSGQTLSQNVPPAAKSL+EIQAEEALKAKKNKEIEKAMKVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETE DQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNSKSKSGKSKSKKKMVVIEAKFR
Sbjct:    1 MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLHNNFIEENWCKRPLPKFVEIPESKGKSIYPKTKVRQRTLSNQSGEYEYQENYNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQWHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNSFNRSDKSGSTWSRKSESEINPRNAKIFGRNNVFKSGDQTEDIWQDDWDTEMKSEIAKDEL--NLDSYEFPKSSIMSVTPPLLESDAIPPESLFEPQVEPIKSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVINCAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQWRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINEPEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSADETNKWFSSKDIKIQKKNKKTKAKENNRSVKEEKKITPIPEAKPPEQPTDSRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSDSPSIWGPVKTAPSLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAAPQAQKLPNQLRTE----------------IKEQLPTLKESQLKVDGTVKSKSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVATKSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTETPSTWKSGQTLSQNVPPAAKSLLEIQAEEALKAKKNKEIEKAMKVNQIETNKVTSFKESLLKTTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQQAPVVSKKETEFDQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEMAIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNNSKSKSGKSKSKKKMVVIEAKFR 1054          
BLAST of GYF domain-containing protein vs. Planmine SMEST
Match: SMESG000025428.1 (SMESG000025428.1)

HSP 1 Score: 52.373 bits (124), Expect = 2.749e-6
Identity = 24/69 (34.78%), Postives = 37/69 (53.62%), Query Frame = 1
Query:  982 LWFYRDLSNIERGPFPSEDMANWLATG-YFNPTTFVRRKCDEKFLLLTEYRALYGRIPFTAGPT-VPPI 1182
            LW+Y D  +  +GPF  + M  W + G YF  +  +RRKCD +F  L +Y   +  +PF      +PP+
Sbjct:  187 LWYYLDPRHNVQGPFHDDQMFQWWSQGIYFQNSLLMRRKCDIEFSTLQDYSKRFNGVPFNRKDIRIPPL 255          
The following BLAST results are available for this feature:
BLAST of GYF domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GIGYF14.411e-841.82GRB10 interacting GYF protein 1 [Source:HGNC Symbo... [more]
GIGYF14.411e-841.82GRB10 interacting GYF protein 1 [Source:HGNC Symbo... [more]
GIGYF21.089e-735.38GRB10 interacting GYF protein 2 [Source:HGNC Symbo... [more]
GIGYF21.109e-735.38GRB10 interacting GYF protein 2 [Source:HGNC Symbo... [more]
GIGYF21.109e-735.38GRB10 interacting GYF protein 2 [Source:HGNC Symbo... [more]
back to top
BLAST of GYF domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GYF domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gyf1.622e-1038.32gene:FBgn0039936 transcript:FBtr0300882[more]
Gyf1.622e-1038.32gene:FBgn0039936 transcript:FBtr0300884[more]
Gyf1.666e-1038.32gene:FBgn0039936 transcript:FBtr0300885[more]
Gyf1.666e-1038.32gene:FBgn0039936 transcript:FBtr0300886[more]
back to top
BLAST of GYF domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gigyf21.771e-1450.00GRB10 interacting GYF protein 2 [Source:NCBI gene;... [more]
gigyf1b8.883e-942.11GRB10 interacting GYF protein 1b [Source:ZFIN;Acc:... [more]
gigyf1b9.644e-942.11GRB10 interacting GYF protein 1b [Source:ZFIN;Acc:... [more]
gigyf1b1.022e-842.11GRB10 interacting GYF protein 1b [Source:ZFIN;Acc:... [more]
gigyf1a6.304e-741.07GRB10 interacting GYF protein 1a [Source:ZFIN;Acc:... [more]
back to top
BLAST of GYF domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spin11.872e-1033.04spindlin 1 [Source:Xenbase;Acc:XB-GENE-954616][more]
spin11.112e-938.27spindlin 1 [Source:Xenbase;Acc:XB-GENE-954616][more]
spin11.453e-938.27spindlin 1 [Source:Xenbase;Acc:XB-GENE-954616][more]
gigyf13.540e-841.82GRB10 interacting GYF protein 1 [Source:NCBI gene;... [more]
gigyf13.879e-841.82GRB10 interacting GYF protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of GYF domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gigyf13.448e-841.82GRB10 interacting GYF protein 1 [Source:MGI Symbol... [more]
Gigyf25.058e-835.38GRB10 interacting GYF protein 2 [Source:MGI Symbol... [more]
Gigyf28.335e-835.38GRB10 interacting GYF protein 2 [Source:MGI Symbol... [more]
Gigyf29.003e-835.38GRB10 interacting GYF protein 2 [Source:MGI Symbol... [more]
Gigyf29.003e-835.38GRB10 interacting GYF protein 2 [Source:MGI Symbol... [more]
back to top
BLAST of GYF domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4KME6|GGYF2_DANRE1.337e-1350.00GRB10-interacting GYF protein 2 OS=Danio rerio OX=... [more]
sp|Q7KQM6|GGYF1_DROME1.670e-938.32GIGYF family protein CG11148 OS=Drosophila melanog... [more]
sp|Q5U236|GGYF2_XENLA1.850e-939.73GRB10-interacting GYF protein 2 OS=Xenopus laevis ... [more]
sp|O75420|GGYF1_HUMAN2.118e-741.82GRB10-interacting GYF protein 1 OS=Homo sapiens OX... [more]
sp|Q99MR1|GGYF1_MOUSE2.412e-741.82GRB10-interacting GYF protein 1 OS=Mus musculus OX... [more]
back to top
BLAST of GYF domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6CPY81.708e-1338.52GYF domain-containing protein (Fragment) OS=Clasto... [more]
A0A0L8I8T71.245e-1242.70GYF domain-containing protein (Fragment) OS=Octopu... [more]
A0A0L8I8Y91.573e-1242.70GYF domain-containing protein (Fragment) OS=Octopu... [more]
K1PWC71.854e-1247.37PERQ amino acid-rich with GYF domain-containing pr... [more]
E2BGW33.619e-1245.59PERQ amino acid-rich with GYF domain-containing pr... [more]
back to top
BLAST of GYF domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gigyf1b5.528e-942.11GRB10-interacting GYF protein 1-like [Source:NCBI ... [more]
gigyf23.075e-842.86GRB10 interacting GYF protein 2 [Source:NCBI gene;... [more]
gigyf23.263e-842.86GRB10 interacting GYF protein 2 [Source:NCBI gene;... [more]
gigyf1a5.842e-739.29GRB10 interacting GYF protein 1 [Source:NCBI gene;... [more]
gigyf1a7.317e-739.29GRB10 interacting GYF protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of GYF domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004025.18.604e-746.51pep scaffold:Pmarinus_7.0:GL479268:15997:31586:-1 ... [more]
back to top
BLAST of GYF domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GYF domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO331684.333e-1140.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GYF domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gigyf24.885e-739.29GRB10 interacting GYF protein 2 [Source:NCBI gene;... [more]
gigyf1a7.913e-739.29GRB10 interacting GYF protein 1 [Source:NCBI gene;... [more]
gigyf1a1.019e-639.29GRB10 interacting GYF protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of GYF domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000052533.10.000e+099.25SMESG000052533.1[more]
SMESG000052533.10.000e+099.16SMESG000052533.1[more]
SMESG000052533.10.000e+097.67SMESG000052533.1[more]
SMESG000025428.12.749e-634.78SMESG000025428.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029716 ID=SMED30029716|Name=GYF domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3804bp
CGTGTCGGCTGTTGTTAATTTGAAATTTGTCATTTATCACAATATTAACT
TTTAACAGAAAAAATGAGTACAGATAAATCTTTAGATATACCGCTAAATG
ATATAGTGAAACCAAAATCAAATAGAAAAATTTATCAAAGAGAAGATTTT
TTAAAATATTACAATTGTGCAGCTGAAATTCCTGACTATTTAAAGGACTT
TCAATTTCTGCATAATAATTTTATTGAAGAAAATTGGTGTAAAAGACCAT
TACCCAAATTTGTTGAAATTCCTGAATCTAAAGGAAAGTTGATCTACCCT
AAGACTAAGGTTCGACAGAGAACTTTAAGTAATCAATCTGGGGAATATGA
ATATCAAGAAAATTATAATAGGCAACGGAATTATACTAGTAATGGAAAAT
ATAATCGATTTGCAACTTCACCAAATGATACAATATCTAACGAAGAATTT
AAAATTGATTCTAATAATAAATTTATGAATTCCAATGATTTTCAAGACAA
TCTTGAGACTCAATGGCATAAAGTAGAACCAAGAGCAACTCGTTTTAATA
ATGCTTCTAAACCATATTCCCAAAATATCCAAGTGACGGAAAACCATTGG
AAAAAATGGACCAAAGATACCAATGTGACAATAGATAAAACTCATCGACA
ACATCAGAATTCATTCAACAGATCTGATAAATCTGGAAGTACTTGGTCAA
GAAAAAGCGAAAGTGAAATTAATCCAAGAAATGCAAAGATATTTGGTCGA
AATAACGTTTTTAAATCCGGAGATCAGACAGAGGATATATGGCAAGATGA
TTGGGATACTGAAATGAAATCTGAAATAGCTAAAGATGAGCTCGAATTAA
ATTTGGATTCTTATGAGTTTCCAAAATCGTCAATAATGTCAGTCACTCCT
CCTCTGTTAGAATCTGACGCAATACCGCCAGAATCTCTGTTTGAGACACA
AGTAGAGCCGATAAAATCACCGGAATTCGATTTATGGTTTTATCGTGATT
TATCCAATATAGAAAGGGGCCCATTTCCAAGTGAGGATATGGCCAATTGG
TTAGCTACAGGCTATTTTAATCCCACTACTTTTGTTCGGCGGAAATGCGA
TGAAAAGTTTTTATTACTTACAGAATATAGAGCACTTTACGGCAGAATTC
CGTTTACTGCCGGCCCTACAGTGCCTCCTATTCATCTTAATACACCAATT
GAACTTGAACCGAGCCAAATTCTTATTGGAGTGGAAAATAATTTCAGGCA
GCAGGTGATAAATTGTGCTGTTTCCTTATCACACATACCACACAGAGTTG
AGGAAAATATAAACGTTTCTCCTAATGCTATTATTGAAGAAAAACGTTTA
CTTGATGAAAGTAGAGCTGAATTAGAAAGGGAAAAAGAAAGAATGATTCA
AGAACAGATTCAATGGCGTTTAAGAGTTGAAGCAGATTTACGTGCTTCAA
TGAAAGCGGAATTAGATGCAAAATTGGCAGAAATGTTAAAGCAATCGATC
AATAATATCCAGCATGTTGAGTCAGCGGATCAAGTGATTCCAAATGATCA
TATTATCAATGAACCTGAGCAAACATCGATTGATGTGATAAATGAAGTAG
TAGAAGTTCAAGACATTGAACAATGCTCAATTGTTTTGGAGCCGAAATTG
GAACCAGTCGTTGATAAATGGGAAATAGATGAATCTAACATTGAACAAAT
GTTGAATTCAGCGGATGAAACCAATAAATGGTTCTCATCAAAAGATATCA
AAATTCAAAAGAAAAACAAAAAGACAAAGGCTAAAGAAAACAATAGAAGT
GTAAAGGAGGAAAAGAAAATAACTCCCATTCCTGAAGCGAAACCGCCTGA
ACAGCCAACTGACAGCAGGTTAATTATCGTTCCAAGGGAATCGGTGATGA
CGACAACCGGGAAAGAAAATGACAATGTATCTAAAGTGAGACCAATAAGA
ATAGAATTAGAAAATCGTAAATCTGACCCACCATCAATATGGGGTCCAGT
AAAAACCGCTCCATCTTTAATCCAAATACAGCTCGAGGAAAGTAATAAAG
CTAAGCAAGAAAAGAAATCGAATGAGTCGGAAATCCAATCAGCGGTTGTG
CAAAATACTTCACCAAAAGAAATTTTCAAAGTAGAACAGGTAAGGTCAAT
TTGGAATGCAGCTCCCCAAGCTCAAAAATTACCCAATCAATTGCGCACCG
AAAGTAAGCCGTCTGACATTTCTGTTTTTACGAAAGATTCCGATAAATCA
GTAAAAGAACAATTACCAACTCTAAAGGAATCTCAATTAAAAGTTGATGG
AACAGTAAAATCGAAGTCAATGGAAGTAGGAAATAGAAAAAGCAAGCAAT
TAAAATCAACAAATCAATCTGAATCCAACAAAACTCCATTATTTACTGAA
AAGGAAAAATCAATAAAAATAGATATGCCAGCTTTGATAAAACCTTCTCC
AGCAGTTGCAACCAAGTCGTTGCTGGAAATCCAGGCTGAAGAAACATTAA
AAGAAAAACAAGCTAAAGAGCAACAGGAAATTTCAAACATTTTAGTATCA
TCAAATAGCAGTCAAAATAAAACTGAGAGTCCTTCCACCTGGAAGTCAGG
CCAGACTTTGTCTCAAAATGTTCCTCCTGCAGCCAAATCACTTGTAGAAA
TTCAGGCCGAAGAAGCTTTGAAAGCGAAGAAAAATAAAGAAATTGAAAAG
GCAATGAAAGTCAATCAAATAGAAACGAATAAAGTTACATCGTTTAAGGA
GTCATTGTTGAAAACAACATCCAAGCCCGCTCAGATCCCAGTTGGAAAAT
CGATCTGGGATATGATCCCCGGGGAGGTTCCTGTAAATAAGGCTGCTGAG
TGCAATTCCAAACAGCAAAACCTCAAATTGAACCAAGAACCGGTTCATAA
ACAACAACAGCAACAAGCACCAGTTGTGTCGAAGAAAGAAACTGAATCCG
ACCAGCTGACCAAATGGTCTTTGAAAAGGTTAGCCAAATTTTCTGAAGAG
TTCGAATTGAATACTGTGATTGAGTTGTTGAAGGAAGTTCCAAACGAGGA
AGTGATGGAAATGGCTATCCAGCTGTTAGGGGATTCTAAATTCACCAGCA
ATTTCGTCCTGGAATTCATCACTAAACGACAAGAGCTTTCTGATAATCAA
GCTGGGGATACTTGGCAGACCGTGAAAAAATCGATTCCTTCTCCACCACC
AGCTGTAAACAATTCAAAATCTAAATCTGGAAAGTCGAAATCTAAAAAGA
AAATGGTTGTAATTGAAGCGAAATTCAGATGAGGATCAGCAACAGGAGCA
GGAGCAGCATTAGAGAGAATGAATAATAATGATATATAATATATAATGTG
TTTTTGTTGGTGTGGATTTATTGAGGCCATTTGACATATATAATGTTGTA
TATAATAATAATAATGATGTTCTAATGTGCTTGATGATCAGTAGCAACGG
TGATAGCAACGCATCATCGGTATGGAAAAGGCGGTATAGCACTGGGATTA
TTGCCATCATCTAGTAGCTGTGTTTATGTGTGTGTACATATTTGTATCTA
TGCTCTGTTGTTACTTGATCTTATTACTATTAATAATAATACATTTTTAA
TTGAACTAAATAGAATTTTAATATTTTTGATTTACCCTGTTTTTACTGCC
CTTTCTATAAATTATTATTATTATGATCACATTTTGTCTTGATGGTATAA
TTGATTGGATCGTGCGGATGGATCTGTATAAATGAGGCGTTTCTTTTAAA
TGATTATTTTAACTTACGATTTGTAAATAAAAAATGTTTATCTAGATCGG
AAGA
back to top

protein sequence of SMED30029716-orf-1

>SMED30029716-orf-1 ID=SMED30029716-orf-1|Name=SMED30029716-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1073bp
MSTDKSLDIPLNDIVKPKSNRKIYQREDFLKYYNCAAEIPDYLKDFQFLH
NNFIEENWCKRPLPKFVEIPESKGKLIYPKTKVRQRTLSNQSGEYEYQEN
YNRQRNYTSNGKYNRFATSPNDTISNEEFKIDSNNKFMNSNDFQDNLETQ
WHKVEPRATRFNNASKPYSQNIQVTENHWKKWTKDTNVTIDKTHRQHQNS
FNRSDKSGSTWSRKSESEINPRNAKIFGRNNVFKSGDQTEDIWQDDWDTE
MKSEIAKDELELNLDSYEFPKSSIMSVTPPLLESDAIPPESLFETQVEPI
KSPEFDLWFYRDLSNIERGPFPSEDMANWLATGYFNPTTFVRRKCDEKFL
LLTEYRALYGRIPFTAGPTVPPIHLNTPIELEPSQILIGVENNFRQQVIN
CAVSLSHIPHRVEENINVSPNAIIEEKRLLDESRAELEREKERMIQEQIQ
WRLRVEADLRASMKAELDAKLAEMLKQSINNIQHVESADQVIPNDHIINE
PEQTSIDVINEVVEVQDIEQCSIVLEPKLEPVVDKWEIDESNIEQMLNSA
DETNKWFSSKDIKIQKKNKKTKAKENNRSVKEEKKITPIPEAKPPEQPTD
SRLIIVPRESVMTTTGKENDNVSKVRPIRIELENRKSDPPSIWGPVKTAP
SLIQIQLEESNKAKQEKKSNESEIQSAVVQNTSPKEIFKVEQVRSIWNAA
PQAQKLPNQLRTESKPSDISVFTKDSDKSVKEQLPTLKESQLKVDGTVKS
KSMEVGNRKSKQLKSTNQSESNKTPLFTEKEKSIKIDMPALIKPSPAVAT
KSLLEIQAEETLKEKQAKEQQEISNILVSSNSSQNKTESPSTWKSGQTLS
QNVPPAAKSLVEIQAEEALKAKKNKEIEKAMKVNQIETNKVTSFKESLLK
TTSKPAQIPVGKSIWDMIPGEVPVNKAAECNSKQQNLKLNQEPVHKQQQQ
QAPVVSKKETESDQLTKWSLKRLAKFSEEFELNTVIELLKEVPNEEVMEM
AIQLLGDSKFTSNFVLEFITKRQELSDNQAGDTWQTVKKSIPSPPPAVNN
SKSKSGKSKSKKKMVVIEAKFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035445GYF-like_dom_sf
IPR003169GYF
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 421..452
NoneNo IPR availableCOILSCoilCoilcoord: 561..581
NoneNo IPR availableCOILSCoilCoilcoord: 799..819
NoneNo IPR availableCOILSCoilCoilcoord: 856..881
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 716..732
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 562..599
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 190..223
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1027..1070
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 757..772
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 202..217
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1027..1052
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 573..588
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 703..778
NoneNo IPR availablePANTHERPTHR14445:SF36GIGYF FAMILY PROTEIN CG11148coord: 121..448
NoneNo IPR availablePANTHERPTHR14445GRB10 INTERACTING GYF PROTEINcoord: 121..448
IPR003169GYF domainSMARTSM00444gyf_5coord: 304..359
e-value: 1.4E-5
score: 34.6
IPR003169GYF domainPFAMPF02213GYFcoord: 306..348
e-value: 5.3E-13
score: 48.4
IPR003169GYF domainPROSITEPS50829GYFcoord: 303..351
score: 11.594
IPR035445GYF-like domain superfamilyGENE3DG3DSA:3.30.1490.40coord: 293..363
e-value: 8.1E-13
score: 50.0
IPR035445GYF-like domain superfamilySUPERFAMILYSSF55277GYF domaincoord: 297..360