Rab GDP dissociation inhibitor

Overview
NameRab GDP dissociation inhibitor
Smed IDSMED30029709
Length (bp)1757
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rab GDP dissociation inhibitor (SMED30029709) t-SNE clustered cells

Violin plots show distribution of expression levels for Rab GDP dissociation inhibitor (SMED30029709) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rab GDP dissociation inhibitor (SMED30029709) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rab GDP dissociation inhibitor (SMED30029709) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029709

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029709SMESG000034594.1 Contig2264GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029709SMESG000034594.1 Contig2525GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029709SMESG000034594.1 dd_Smed_v4_476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029709SMESG000034594.1 dd_Smed_v4_476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029709SMESG000034594.1 dd_Smed_v4_476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
oocyteSMED30029709SMESG000034594.1 Contig2525GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30029709SMESG000034594.1 Contig2525GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30029709SMESG000034594.1 dd_Smed_v4_476_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Human
Match: GDI2 (GDP dissociation inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:4227])

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 289/441 (65.53%), Postives = 357/441 (80.95%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G+PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK  EGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ +  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKVIGV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +S+ H+VA+   +IA+V+TTVETK P++E++P L LL  IEQ F + SDL  P D G +S++FIS +YDATTHFETTC D+ +IYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGI--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Human
Match: GDI1 (GDP dissociation inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:4226])

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 284/441 (64.40%), Postives = 351/441 (79.59%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPLE LYK F     PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK +EGS+VYK G I+KVP  E EALA++LMGMFEKRRFRK L++   FD   P+T++ V  +P+T ++R VY  F + ++  DF GHA+ +Y  DDY+D+ P  E + R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPV+ I+  E GKV+GV++EGE+ARCK +I DP Y+ DRVRK G VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+ +TTVET +P++E++P L LL  I+Q F   SDL+EPID+G +S+VF S SYDATTHFETTC D+ DIYKR+ G  FDF     K
Sbjct:    1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQ-PCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIM-ENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Human
Match: GDI2 (GDP dissociation inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:4227])

HSP 1 Score: 457.988 bits (1177), Expect = 1.674e-157
Identity = 260/441 (58.96%), Postives = 321/441 (72.79%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G+PPES+GRGRDWNVDLIPKFLMA+G                                             LMG+FEKRRFRK L++   FD   P T++ +  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKVIGV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +S+ H+VA+   +IA+V+TTVETK P++E++P L LL  IEQ F + SDL  P D G +S++FIS +YDATTHFETTC D+ +IYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANG---------------------------------------------LMGLFEKRRFRKFLVYVANFDEKDPRTFEGI--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRK 392          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Human
Match: GDI2 (GDP dissociation inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:4227])

HSP 1 Score: 300.056 bits (767), Expect = 7.149e-98
Identity = 179/277 (64.62%), Postives = 221/277 (79.78%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGE 924
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G+PPES+GRGRDWNVDLIPKFLMA+           VTRYL+FK  EGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ +  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKVIGV++EGE
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMAN----------EVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGI--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVIGVKSEGE 263          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Human
Match: GDI2 (GDP dissociation inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:4227])

HSP 1 Score: 209.149 bits (531), Expect = 2.478e-64
Identity = 99/130 (76.15%), Postives = 115/130 (88.46%), Query Frame = 1
Query:  139 KECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLL 525
            KECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G+PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK  EGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L
Sbjct:   19 KECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFL 148          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Celegans
Match: gdi-1 (Rab GDP dissociation inhibitor [Source:UniProtKB/TrEMBL;Acc:E9P8A8])

HSP 1 Score: 508.064 bits (1307), Expect = 6.883e-177
Identity = 274/437 (62.70%), Postives = 345/437 (78.95%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC--GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFT 1401
            MD+EYD IVLGTGLKECI+SGM+SV GKKVLH+D+N+YYGG+SAS+TPLE LY+ F+     P + +GRGRDWNVDLIPKFLMA+G LVK+LIHTGVTRYLEFKSIE S+V K G I+KVP DE EALATSLMGMFEKRRF+K L+W   FD  K +T++ +  +P   T+++VYE FG+D NT DF GHA+ +Y +D++ ++ P   A+ +++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYML+KPV++IV  E GK IGV+   EI R K +  DP Y KDRV+K G V+RAIC+L HPIPNTN A S QIIIPQ QV R++DIY+ C S T+ V     ++A+V+TTVET NP+ E+ PGL LLG I + F   SD++EP D G +S++FIS SYDATTHFETTC+DVL++++R T  EFDFT
Sbjct:    1 MDEEYDAIVLGTGLKECIISGMLSVSGKKVLHIDRNNYYGGESASLTPLEQLYEKFHGPQAKPQQEMGRGRDWNVDLIPKFLMANGPLVKLLIHTGVTRYLEFKSIEASFVVKGGKIYKVPADEMEALATSLMGMFEKRRFKKFLVWVQQFDENKEDTWQGL--DPHNSTMQQVYEKFGLDENTADFTGHALALYRDDEHKNQ-PYAPAVEKIRLYSDSLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLDKPVDEIVM-ENGKAIGVKCGDEIVRGKQIYCDPSYAKDRVKKTGQVVRAICLLNHPIPNTNDAQSCQIIIPQKQVGRHYDIYISCCSNTNMVTPKGWYLAMVSTTVETANPEAEVLPGLQLLGAIAEKFIQISDVYEPSDLGSESQIFISQSYDATTHFETTCKDVLNMFERGTTKEFDFT 433          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Celegans
Match: gdi-1 (Rab GDP dissociation inhibitor [Source:UniProtKB/TrEMBL;Acc:E9P8A8])

HSP 1 Score: 508.064 bits (1307), Expect = 6.883e-177
Identity = 274/437 (62.70%), Postives = 345/437 (78.95%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC--GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFT 1401
            MD+EYD IVLGTGLKECI+SGM+SV GKKVLH+D+N+YYGG+SAS+TPLE LY+ F+     P + +GRGRDWNVDLIPKFLMA+G LVK+LIHTGVTRYLEFKSIE S+V K G I+KVP DE EALATSLMGMFEKRRF+K L+W   FD  K +T++ +  +P   T+++VYE FG+D NT DF GHA+ +Y +D++ ++ P   A+ +++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYML+KPV++IV  E GK IGV+   EI R K +  DP Y KDRV+K G V+RAIC+L HPIPNTN A S QIIIPQ QV R++DIY+ C S T+ V     ++A+V+TTVET NP+ E+ PGL LLG I + F   SD++EP D G +S++FIS SYDATTHFETTC+DVL++++R T  EFDFT
Sbjct:    1 MDEEYDAIVLGTGLKECIISGMLSVSGKKVLHIDRNNYYGGESASLTPLEQLYEKFHGPQAKPQQEMGRGRDWNVDLIPKFLMANGPLVKLLIHTGVTRYLEFKSIEASFVVKGGKIYKVPADEMEALATSLMGMFEKRRFKKFLVWVQQFDENKEDTWQGL--DPHNSTMQQVYEKFGLDENTADFTGHALALYRDDEHKNQ-PYAPAVEKIRLYSDSLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLDKPVDEIVM-ENGKAIGVKCGDEIVRGKQIYCDPSYAKDRVKKTGQVVRAICLLNHPIPNTNDAQSCQIIIPQKQVGRHYDIYISCCSNTNMVTPKGWYLAMVSTTVETANPEAEVLPGLQLLGAIAEKFIQISDVYEPSDLGSESQIFISQSYDATTHFETTCKDVLNMFERGTTKEFDFT 433          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Celegans
Match: gdi-1 (Rab GDP dissociation inhibitor [Source:UniProtKB/TrEMBL;Acc:E9P8A8])

HSP 1 Score: 498.434 bits (1282), Expect = 6.170e-173
Identity = 274/452 (60.62%), Postives = 345/452 (76.33%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC--GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNH---------------DIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFT 1401
            MD+EYD IVLGTGLKECI+SGM+SV GKKVLH+D+N+YYGG+SAS+TPLE LY+ F+     P + +GRGRDWNVDLIPKFLMA+G LVK+LIHTGVTRYLEFKSIE S+V K G I+KVP DE EALATSLMGMFEKRRF+K L+W   FD  K +T++ +  +P   T+++VYE FG+D NT DF GHA+ +Y +D++ ++ P   A+ +++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYML+KPV++IV  E GK IGV+   EI R K +  DP Y KDRV+K G V+RAIC+L HPIPNTN A S QIIIPQ QV R++               DIY+ C S T+ V     ++A+V+TTVET NP+ E+ PGL LLG I + F   SD++EP D G +S++FIS SYDATTHFETTC+DVL++++R T  EFDFT
Sbjct:    1 MDEEYDAIVLGTGLKECIISGMLSVSGKKVLHIDRNNYYGGESASLTPLEQLYEKFHGPQAKPQQEMGRGRDWNVDLIPKFLMANGPLVKLLIHTGVTRYLEFKSIEASFVVKGGKIYKVPADEMEALATSLMGMFEKRRFKKFLVWVQQFDENKEDTWQGL--DPHNSTMQQVYEKFGLDENTADFTGHALALYRDDEHKNQ-PYAPAVEKIRLYSDSLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLDKPVDEIVM-ENGKAIGVKCGDEIVRGKQIYCDPSYAKDRVKKTGQVVRAICLLNHPIPNTNDAQSCQIIIPQKQVGRHYGKFIVLEKQRVAQKRDIYISCCSNTNMVTPKGWYLAMVSTTVETANPEAEVLPGLQLLGAIAEKFIQISDVYEPSDLGSESQIFISQSYDATTHFETTCKDVLNMFERGTTKEFDFT 448          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Celegans
Match: gdi-1 (Rab GDP dissociation inhibitor [Source:UniProtKB/TrEMBL;Acc:E9P8A8])

HSP 1 Score: 107.842 bits (268), Expect = 6.358e-28
Identity = 50/84 (59.52%), Postives = 67/84 (79.76%), Query Frame = 1
Query: 1150 FIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFT 1401
            ++A+V+TTVET NP+ E+ PGL LLG I + F   SD++EP D G +S++FIS SYDATTHFETTC+DVL++++R T  EFDFT
Sbjct:    8 YLAMVSTTVETANPEAEVLPGLQLLGAIAEKFIQISDVYEPSDLGSESQIFISQSYDATTHFETTCKDVLNMFERGTTKEFDFT 91          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Celegans
Match: gdi-1 (Rab GDP dissociation inhibitor [Source:UniProtKB/TrEMBL;Acc:E9P8A8])

HSP 1 Score: 107.842 bits (268), Expect = 6.358e-28
Identity = 50/84 (59.52%), Postives = 67/84 (79.76%), Query Frame = 1
Query: 1150 FIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFT 1401
            ++A+V+TTVET NP+ E+ PGL LLG I + F   SD++EP D G +S++FIS SYDATTHFETTC+DVL++++R T  EFDFT
Sbjct:    8 YLAMVSTTVETANPEAEVLPGLQLLGAIAEKFIQISDVYEPSDLGSESQIFISQSYDATTHFETTCKDVLNMFERGTTKEFDFT 91          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Fly
Match: Gdi (gene:FBgn0004868 transcript:FBtr0306169)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 281/445 (63.15%), Postives = 350/445 (78.65%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSE 1431
            M++EYD IVLGTGLKECILSGM+SV GKKVLH+D+N YYGG+SASITPLE L++ +    P E  GRGRDWNVDLIPKFLMA+G LVK+LIHTGVTRYLEFKSIEGSYVYK G I KVP D+KEALA+ LMGMFEKRRFR  L++   F    P+T+K+   +P    ++ +Y+ FG+D+NTQDF GHA+ ++ +D+Y+++ PA   IRR++LYS SL++YGKSPYLYP+YGLGELPQGFARLSA++GGTYML+KP+++IV  E GKV+GV++  E+A+CK V  DP YV ++VRK G VIR ICIL HP+ +T   LSTQIIIPQ QV R  DIYV  VS TH VA+   F+ +V+TTVET+NP+ E+KPGL+LL  I Q F T SD  EPID+G +S++FIS SYDATTHFETTC DVL+I+KR TG  FDF+K   + G  E
Sbjct:    1 MNEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFQRYGLEPPGERFGRGRDWNVDLIPKFLMANGQLVKLLIHTGVTRYLEFKSIEGSYVYKGGKIAKVPVDQKEALASDLMGMFEKRRFRNFLIYVQDFREDDPKTWKDF--DPTKANMQGLYDKFGLDKNTQDFTGHALALFRDDEYLNE-PAVNTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDKPIDEIVLGEGGKVVGVRSGEEVAKCKQVYCDPSYVPEKVRKRGKVIRCICILDHPVASTKDGLSTQIIIPQKQVGRKSDIYVSLVSSTHQVAAKGWFVGMVSTTVETENPEVEIKPGLDLLEPIAQKFVTISDYLEPIDDGSESQIFISESYDATTHFETTCLDVLNIFKRGTGETFDFSKIKHELGDEE 442          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Fly
Match: Gdi (gene:FBgn0004868 transcript:FBtr0079862)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 281/445 (63.15%), Postives = 350/445 (78.65%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSE 1431
            M++EYD IVLGTGLKECILSGM+SV GKKVLH+D+N YYGG+SASITPLE L++ +    P E  GRGRDWNVDLIPKFLMA+G LVK+LIHTGVTRYLEFKSIEGSYVYK G I KVP D+KEALA+ LMGMFEKRRFR  L++   F    P+T+K+   +P    ++ +Y+ FG+D+NTQDF GHA+ ++ +D+Y+++ PA   IRR++LYS SL++YGKSPYLYP+YGLGELPQGFARLSA++GGTYML+KP+++IV  E GKV+GV++  E+A+CK V  DP YV ++VRK G VIR ICIL HP+ +T   LSTQIIIPQ QV R  DIYV  VS TH VA+   F+ +V+TTVET+NP+ E+KPGL+LL  I Q F T SD  EPID+G +S++FIS SYDATTHFETTC DVL+I+KR TG  FDF+K   + G  E
Sbjct:    1 MNEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFQRYGLEPPGERFGRGRDWNVDLIPKFLMANGQLVKLLIHTGVTRYLEFKSIEGSYVYKGGKIAKVPVDQKEALASDLMGMFEKRRFRNFLIYVQDFREDDPKTWKDF--DPTKANMQGLYDKFGLDKNTQDFTGHALALFRDDEYLNE-PAVNTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDKPIDEIVLGEGGKVVGVRSGEEVAKCKQVYCDPSYVPEKVRKRGKVIRCICILDHPVASTKDGLSTQIIIPQKQVGRKSDIYVSLVSSTHQVAAKGWFVGMVSTTVETENPEVEIKPGLDLLEPIAQKFVTISDYLEPIDDGSESQIFISESYDATTHFETTCLDVLNIFKRGTGETFDFSKIKHELGDEE 442          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Fly
Match: Gdi (gene:FBgn0004868 transcript:FBtr0345433)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 281/445 (63.15%), Postives = 350/445 (78.65%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSE 1431
            M++EYD IVLGTGLKECILSGM+SV GKKVLH+D+N YYGG+SASITPLE L++ +    P E  GRGRDWNVDLIPKFLMA+G LVK+LIHTGVTRYLEFKSIEGSYVYK G I KVP D+KEALA+ LMGMFEKRRFR  L++   F    P+T+K+   +P    ++ +Y+ FG+D+NTQDF GHA+ ++ +D+Y+++ PA   IRR++LYS SL++YGKSPYLYP+YGLGELPQGFARLSA++GGTYML+KP+++IV  E GKV+GV++  E+A+CK V  DP YV ++VRK G VIR ICIL HP+ +T   LSTQIIIPQ QV R  DIYV  VS TH VA+   F+ +V+TTVET+NP+ E+KPGL+LL  I Q F T SD  EPID+G +S++FIS SYDATTHFETTC DVL+I+KR TG  FDF+K   + G  E
Sbjct:    1 MNEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFQRYGLEPPGERFGRGRDWNVDLIPKFLMANGQLVKLLIHTGVTRYLEFKSIEGSYVYKGGKIAKVPVDQKEALASDLMGMFEKRRFRNFLIYVQDFREDDPKTWKDF--DPTKANMQGLYDKFGLDKNTQDFTGHALALFRDDEYLNE-PAVNTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDKPIDEIVLGEGGKVVGVRSGEEVAKCKQVYCDPSYVPEKVRKRGKVIRCICILDHPVASTKDGLSTQIIIPQKQVGRKSDIYVSLVSSTHQVAAKGWFVGMVSTTVETENPEVEIKPGLDLLEPIAQKFVTISDYLEPIDDGSESQIFISESYDATTHFETTCLDVLNIFKRGTGETFDFSKIKHELGDEE 442          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Fly
Match: Rep (gene:FBgn0026378 transcript:FBtr0086462)

HSP 1 Score: 106.686 bits (265), Expect = 4.186e-24
Identity = 102/346 (29.48%), Postives = 162/346 (46.82%), Query Frame = 1
Query:   91 NTMDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPES----------------------------LGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPA-EEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGY--VKDRVRKVGSVIRAICILTHPIPN 1035
            + + +++D++V+GTG  E  ++   S  GK VLH+D N+YY GD  S   ++ L    +    P S                            L + R +++DL P+ L A G LV++LI + + RY EF++++   +   G I  VPC   +   T  + + EKR   K L    C D  + +  ++ L        R   E+    R T+     + CV         S + EE ++R Q +  SL +YG +P+L+P+YG GELPQ F RL AV+GG Y L + V+ I  D       + + G+  R K V+S PGY  V   +     + R + I + P+ N
Sbjct:    3 DDLPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYY-GDVWSSFSMDALCARLDQEVEPHSALRNARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLCPRILYAAGELVQLLIKSNICRYAEFRAVDHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFL--TACNDYGEDKCNEDSLEFRG----RTFLEYLQAQRVTEKI---SSCVMQAIAMCGPSTSFEEGMQRTQRFLGSLGRYGNTPFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKTLRAKNVVSAPGYTPVSKGIELKPHISRGLFISSSPLGN 338          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Zebrafish
Match: gdi2 (GDP dissociation inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2485])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 291/441 (65.99%), Postives = 361/441 (81.86%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV GKKVLHMD+N YYGG+SASITPLE+L+K F+  G+PPES+G+GRDWNVDLIPKFLMA+G LV++L+ T VTRYL+FK IEGS+VYK+G+I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P+T + V  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+IV  E GKV+GV++EGEIARCK +I DP Y+KDRV KVG VIR ICIL+HPI NT+ A S QIIIPQNQVNR HDIYVC +SY H+VA+   +IA+V+TTVET +P++E+KP L+LL  +EQ F + SDL+ P D G DS++FIS SYDATTHFETTC D+ DIYKR+TG EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVKGKKVLHMDRNSYYGGESASITPLEDLFKRFSLPGSPPESMGKGRDWNVDLIPKFLMANGQLVRMLLITQVTRYLDFKVIEGSFVYKKGSIYKVPSTETEALASSLMGLFEKRRFRKFLVFVANFDENDPKTMEGV--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCIETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIVI-ENGKVVGVKSEGEIARCKQLICDPSYIKDRVNKVGQVIRVICILSHPIKNTSDANSCQIIIPQNQVNRKHDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEKEIKPALDLLEPVEQKFVSISDLYSPTDVGSDSQIFISRSYDATTHFETTCDDIKDIYKRMTGTEFDFAEMERK 437          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Zebrafish
Match: gdi1 (GDP dissociation inhibitor 1 [Source:ZFIN;Acc:ZDB-GENE-050522-504])

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 283/450 (62.89%), Postives = 357/450 (79.33%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCG-APPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTG--LSEDE 1437
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPLE LYK F    +PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK +EGS+VYK G I+KVP  E EALA++LMGMFEKRRFRK L++   FD   P+T++ V  +PK  T+ +VY+ F + ++  DF GHA+ +Y  DDY+++ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPV++IV  E G V+GV++EG++ARCK +I DP Y+ +RV KVG V+R IC+L+HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+V+TTVET +P+ E++P L LL  I+Q F   SD++EP D+G +S+VF S SYDATTHFETTC D+ DIYKR+TG++FDF     K      EDE
Sbjct:    1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFGISDSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPKLTTMGEVYKKFDLGQDVIDFTGHALALYRTDDYLEQ-PCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDEIVM-EGGHVVGVKSEGQVARCKQLICDPSYIPERVHKVGQVVRVICVLSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETSDPEAEIEPALELLEPIDQKFVAISDMYEPTDDGTESQVFASRSYDATTHFETTCNDIKDIYKRMTGSDFDFENMKRKQNDVFGEDE 446          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Zebrafish
Match: gdi2 (GDP dissociation inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2485])

HSP 1 Score: 507.294 bits (1305), Expect = 2.283e-176
Identity = 277/432 (64.12%), Postives = 345/432 (79.86%), Query Frame = 1
Query:  142 ECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMA------DGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            ECILSG+MSV GKKVLHMD+N YYGG+SASITPLE+L+K F+  G+PPES+G+GRDWNVDLIPKFLM+         LV++L+ T VTRYL+FK IEGS+VYK+G+I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P+T + V  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+IV  E GKV+GV++EGEIARCK +I DP Y+KDRV KVG VIR ICIL+HPI NT+ A S QIIIPQNQVNR HDIYVC +SY H+VA+   +IA+V+TTVET +P++E+KP L+LL  +EQ F + SDL+ P D G DS++FIS SYDATTHFETTC D+ DIYKR+TG EFDF +   K
Sbjct:    7 ECILSGIMSVKGKKVLHMDRNSYYGGESASITPLEDLFKRFSLPGSPPESMGKGRDWNVDLIPKFLMSCFNTWEFSQLVRMLLITQVTRYLDFKVIEGSFVYKKGSIYKVPSTETEALASSLMGLFEKRRFRKFLVFVANFDENDPKTMEGV--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCIETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIVI-ENGKVVGVKSEGEIARCKQLICDPSYIKDRVNKVGQVIRVICILSHPIKNTSDANSCQIIIPQNQVNRKHDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEKEIKPALDLLEPVEQKFVSISDLYSPTDVGSDSQIFISRSYDATTHFETTCDDIKDIYKRMTGTEFDFAEMERK 434          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Zebrafish
Match: zgc:112334 (zgc:112334 [Source:ZFIN;Acc:ZDB-GENE-050809-120])

HSP 1 Score: 431.795 bits (1109), Expect = 9.040e-147
Identity = 238/429 (55.48%), Postives = 328/429 (76.46%), Query Frame = 1
Query:  106 EYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEF 1392
            E+DVIVLGTGLKEC+LSG+MS +GKKVLH+D N YYGG+SASI+PLE LY  F   AP + +GRG+DWNVDLIPKFL+A+G LVK+L+++ VTRYL+FK +EG++VYK G I KVP  E E  A+ LMGMF+KRRFRK L + + FD + P T+ ++  +P+  ++R+V+ HF +  +  +F GHA+ ++ ND+Y+++ P    I R++LYS SL++Y  SPYLYPL+GLGELPQGF RLSAV+G +++LN+ VE++V  E G+V  V++EGE+ RCK +ISDP Y+ +RV+KVG V+R +C+L HPI NT+ A S QIIIPQ Q+NR  D+YVC VSYTH+VAS   +IA V+T VET NP++E++ GL LL  I + F + S+L  P D+G  S++FIS SYD +TH +T   D++D+Y+RITG+EF
Sbjct:    3 EFDVIVLGTGLKECVLSGLMSANGKKVLHLDSNPYYGGESASISPLEELYSRFRVPAPDKLMGRGKDWNVDLIPKFLLANGQLVKMLLYSEVTRYLDFKVVEGNFVYKGGKIHKVPITEAETQASDLMGMFDKRRFRKFLSFVLNFDESDPRTHHDM--DPRNTSMREVFRHFDLGDDVVEFTGHALALHANDEYLEQ-PCLLTINRIKLYSESLARYSLSPYLYPLFGLGELPQGFVRLSAVYGNSFLLNRRVEEVVL-EGGRVAAVRSEGEVFRCKQLISDPSYLPERVKKVGRVVRVLCLLNHPIKNTHEANSCQIIIPQAQLNRKSDVYVCLVSYTHNVASEGKYIACVSTMVETGNPEKEVQAGLALLEPILEKFLSVSNLMVPADDGRRSQIFISRSYDPSTHLQTDTEDIMDLYRRITGSEF 427          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Zebrafish
Match: chm (CHM Rab escort protein [Source:ZFIN;Acc:ZDB-GENE-030318-2])

HSP 1 Score: 89.3521 bits (220), Expect = 3.096e-18
Identity = 77/234 (32.91%), Postives = 127/234 (54.27%), Query Frame = 1
Query:  289 LGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYD-EQGKVIGV-QAEGEIARCKAVISDPGYVKDRVRK 984
            L  GR +N+DL+ K + + GALV +LI + V+RY EFK+I      + G + +VPC   +  A+  + + EKR   K L + + F+   PE Y++    P ++ ++    +  +  N QDF+  +I +        ++  EE ++  Q +   L +YG +P+L+PLYGLGE+PQ F R+ AVFGG Y L   V+ +V D E  KV  V    G+   C   + +  Y+++  R+
Sbjct:  208 LKEGRRFNIDLVSKLMYSRGALVDLLIKSNVSRYAEFKNIGRILTCRNGKVEQVPCSRADVFASKQLTVVEKRMLMKFLTFCLDFE-QHPEEYQDYSEKPFSEFLK----NKKLTENLQDFVLLSIAM-----VTQQTLTEEGLKATQHFLRCLGRYGNTPFLFPLYGLGEIPQCFCRMCAVFGGIYCLRHSVQCLVVDKESNKVKAVIDTRGQKIGCSHFVVEDSYIREEQRE 431          

HSP 2 Score: 50.8322 bits (120), Expect = 3.579e-6
Identity = 20/47 (42.55%), Postives = 33/47 (70.21%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASIT 237
            +  ++DV++LGTGL E +++   S  G+ VLH+D+ +YY G+ AS T
Sbjct:    6 LPSQFDVVILGTGLTESVIAAACSRVGQSVLHLDRRNYYAGNWASFT 52          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Xenopus
Match: maats1 (MYCBP associated and testis expressed 1 [Source:Xenbase;Acc:XB-GENE-995086])

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 285/441 (64.63%), Postives = 351/441 (79.59%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK FN  G+PPE +GRGRDWNVDLIPKFLMA+G LVK+L+ T VTRYL+FK IEGS+VYK G I+KVP  E EAL +SLMGMFEKRRF+K L +   FD    +T + V  +PK  T+R VY+ F + ++  DF GHA+ +Y  D+Y+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E++V  E GK++GV++EGE+ARCK +I DP YV DRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+V+TTVET +P+ E+KP L LL  IEQ F + SD++ P D G DS++FIS +YD TTHFETTC D+ DIYKR+ G+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNSYYGGESASITPLEDLYKRFNIPGSPPECMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYLDFKVIEGSFVYKGGKIYKVPSTEAEALTSSLMGMFEKRRFKKFLSYVANFDENDSKTLECV--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDEYLDQ-PCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEELVM-ENGKIVGVKSEGEVARCKQLICDPSYVSDRVTKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEREIKPVLELLEPIEQKFVSISDMYAPTDVGTDSQIFISRTYDPTTHFETTCNDIKDIYKRMMGSEFDFEEMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Xenopus
Match: maats1 (MYCBP associated and testis expressed 1 [Source:Xenbase;Acc:XB-GENE-995086])

HSP 1 Score: 502.671 bits (1293), Expect = 1.632e-174
Identity = 273/426 (64.08%), Postives = 337/426 (79.11%), Query Frame = 1
Query:  142 ECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK FN  G+PPE +GRGRDWNVDLIPKFLMA+G LVK+L+ T VTRYL+FK IEGS+VYK G I+KVP  E EAL +SLMGMFEKRRF+K L +   FD    +T + V  +PK  T+R VY+ F + ++  DF GHA+ +Y  D+Y+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E++V  E GK++GV++EGE+ARCK +I DP YV DRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+V+TTVET +P+ E+KP L LL  IEQ F + SD++ P D G DS++FIS +YD TTHFETTC D+ DIYKR+ G+EFDF +   K
Sbjct:    8 ECILSGIMSVNGKKVLHMDRNSYYGGESASITPLEDLYKRFNIPGSPPECMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYLDFKVIEGSFVYKGGKIYKVPSTEAEALTSSLMGMFEKRRFKKFLSYVANFDENDSKTLECV--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDEYLDQ-PCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEELVM-ENGKIVGVKSEGEVARCKQLICDPSYVSDRVTKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEREIKPVLELLEPIEQKFVSISDMYAPTDVGTDSQIFISRTYDPTTHFETTCNDIKDIYKRMMGSEFDFEEMKRK 429          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Xenopus
Match: ENSXETT00000042531.1 (rab GDP dissociation inhibitor beta-like [Source:NCBI gene;Acc:101730580])

HSP 1 Score: 488.419 bits (1256), Expect = 9.454e-169
Identity = 261/439 (59.45%), Postives = 342/439 (77.90%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHS 1413
            M++ YDVIVLGTGLKEC+LSG+MSV+GKKVLH+D+NDYYGG++ASITPLE LY+ F    PPE +GRGR+WNVDL+PKFLMA+G LVK+L++T VTRY++FK ++GSYVYK G I KVPC E+EALA+ LMG+FEKRRFRK L++ + F+    +T  ++  +P   T+R++Y  F +      F GHA+ +Y  DDY+D  P  E I R++LY  SL+KY KSPYLYPLYGLGELPQGFARLSA+FGG YMLNKPV++I+  E G+V+GV++EGEIA CK +I DP YV D+V+K G VIRAICIL+HPI +TN   S QIIIPQ QVNR  DIYVC VS +H VAS+  ++A+++TTVET++P++E++P L LL  ++Q F + +D F P  +G  +++FIS SYDATTHFETTC D+ D++KR+TGA  DF+   S
Sbjct:    1 MEEMYDVIVLGTGLKECVLSGIMSVNGKKVLHIDRNDYYGGETASITPLEELYRRFKVNGPPEPMGRGREWNVDLVPKFLMANGQLVKMLLYTEVTRYIDFKVVDGSYVYKAGKIHKVPCTEEEALASDLMGIFEKRRFRKFLLFVVNFNEQCAKTQYDI--DPTKTTMRELYRRFDLGPEVMAFTGHALALYRTDDYLD-LPCLETINRIKLYCESLAKYSKSPYLYPLYGLGELPQGFARLSALFGGIYMLNKPVDEILM-EDGQVVGVKSEGEIAHCKQLICDPSYVPDQVKKTGRVIRAICILSHPIRDTNECTSCQIIIPQTQVNRKSDIYVCMVSCSHCVASDGKYVAIISTTVETEDPEKEIQPALELLEPVDQKFVSINDQFIPKHDGTKNQIFISRSYDATTHFETTCDDIKDMFKRMTGATLDFSDMWS 435          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Xenopus
Match: cnnm3 (cyclin and CBS domain divalent metal cation transport mediator 3 [Source:Xenbase;Acc:XB-GENE-981953])

HSP 1 Score: 476.093 bits (1224), Expect = 9.751e-164
Identity = 271/459 (59.04%), Postives = 335/459 (72.98%), Query Frame = 1
Query:  163 MSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCG-APPESLGRGRDWNVDLIPKFLMADG-------------------------------ALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTG--LSEDE 1437
            MSV+GKKVLHMD+N YYGG+S+SITPLE LYK F+    PPES+GRGRDWNVDLIPKFLMA+G                                LVK+L++T VTRYL+FK IEGS+VYK G I+KVP  E EALA++LMGMFEKRRFRK L++   FD   P+T++ V  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNK V++IV  E+G+V+GV++EGE+ARCK +I DP YV DRVRK G VIR IC+L HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+V+TTVET  P++E++P L LL  I+Q F   SDLFE I++G +S+VF S SYDATTHFETTC D+ DIYKR+TG +FDF     K      EDE
Sbjct:    1 MSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFDMADGPPESMGRGRDWNVDLIPKFLMANGKLTCRGWGDCIVNVGVWGHPSIQLGSKVKSCQLVKMLLYTEVTRYLDFKVIEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPKDTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKSVDEIVM-EKGRVVGVKSEGEVARCKQLICDPSYVADRVRKAGQVIRVICVLNHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETAEPEKEIEPALELLEPIDQKFVAISDLFESIEDGTESQVFCSRSYDATTHFETTCNDIKDIYKRMTGTDFDFENMKRKQNDVFGEDE 455          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Xenopus
Match: ENSXETT00000042546.1 (rab GDP dissociation inhibitor beta-like [Source:NCBI gene;Acc:101730580])

HSP 1 Score: 464.922 bits (1195), Expect = 6.925e-160
Identity = 249/424 (58.73%), Postives = 328/424 (77.36%), Query Frame = 1
Query:  142 ECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHS 1413
            EC+LSG+MSV+GKKVLH+D+NDYYGG++ASITPLE LY+ F    PPE +GRGR+WNVDL+PKFLMA+G LVK+L++T VTRY++FK ++GSYVYK G I KVPC E+EALA+ LMG+FEKRRFRK L++ + F+    +T  ++  +P   T+R++Y  F +      F GHA+ +Y  DDY+D  P  E I R++LY  SL+KY KSPYLYPLYGLGELPQGFARLSA+FGG YMLNKPV++I+  E G+V+GV++EGEIA CK +I DP YV D+V+K G VIRAICIL+HPI +TN   S QIIIPQ QVNR  DIYVC VS +H VAS+  ++A+++TTVET++P++E++P L LL  ++Q F + +D F P  +G  +++FIS SYDATTHFETTC D+ D++KR+TGA  DF+   S
Sbjct:    2 ECVLSGIMSVNGKKVLHIDRNDYYGGETASITPLEELYRRFKVNGPPEPMGRGREWNVDLVPKFLMANGQLVKMLLYTEVTRYIDFKVVDGSYVYKAGKIHKVPCTEEEALASDLMGIFEKRRFRKFLLFVVNFNEQCAKTQYDI--DPTKTTMRELYRRFDLGPEVMAFTGHALALYRTDDYLD-LPCLETINRIKLYCESLAKYSKSPYLYPLYGLGELPQGFARLSALFGGIYMLNKPVDEILM-EDGQVVGVKSEGEIAHCKQLICDPSYVPDQVKKTGRVIRAICILSHPIRDTNECTSCQIIIPQTQVNRKSDIYVCMVSCSHCVASDGKYVAIISTTVETEDPEKEIQPALELLEPVDQKFVSINDQFIPKHDGTKNQIFISRSYDATTHFETTCDDIKDMFKRMTGATLDFSDMWS 421          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Mouse
Match: Gdi2 (guanosine diphosphate (GDP) dissociation inhibitor 2 [Source:MGI Symbol;Acc:MGI:99845])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 289/441 (65.53%), Postives = 356/441 (80.73%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G PP S+GRGRDWNVDLIPKFLMA+G LVK+L+ T VTRY++FK IEGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ V  +PK  ++R VY+ F + ++  DF GH++ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKV+GV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +S+ H+VA+   +IA+V+TTVETK P++E++P L LL  IEQ F + SDLF P D G DS++FIS +YDATTHFETTC D+ DIYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGV--DPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQ-PCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Mouse
Match: Gdi1 (guanosine diphosphate (GDP) dissociation inhibitor 1 [Source:MGI Symbol;Acc:MGI:99846])

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 283/441 (64.17%), Postives = 350/441 (79.37%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFN-CGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPLE LYK F     PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK +EGS+VYK G I+KVP  E EALA++LMGMFEKRRFRK L++   FD   P+T++ V  +P+  ++R VY  F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPV+ I+  E GKV+GV++EGE+ARCK +I DP Y+ DRV+K G VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+ +TTVET  P++E++P L LL  I+Q F   SDL+EPID+G +S+VF S SYDATTHFETTC D+ DIYKR+ G+ FDF     K
Sbjct:    1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQILEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPQNTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQ-PCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIM-ENGKVVGVKSEGEVARCKQLICDPSYIPDRVQKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETAEPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDIYKRMAGSAFDFENMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Mouse
Match: Gdi2 (guanosine diphosphate (GDP) dissociation inhibitor 2 [Source:MGI Symbol;Acc:MGI:99845])

HSP 1 Score: 455.292 bits (1170), Expect = 2.135e-156
Identity = 259/441 (58.73%), Postives = 321/441 (72.79%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL                                     LYK F   G PP S+GRGRDWNVDLIPKFLMA+G LVK+L+ T VTRY++FK IEGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ V  +PK  ++R VY+ F + ++  DF GH++ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKV+GV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +S+ H+VA+   +IA+V+TTVETK P++E++P L LL  IEQ F + SDLF P D G DS++FIS +YDATTHFETTC D+ DIYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGL------------------------------------TLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGV--DPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQ-PCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRK 401          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Mouse
Match: Gdi2 (guanosine diphosphate (GDP) dissociation inhibitor 2 [Source:MGI Symbol;Acc:MGI:99845])

HSP 1 Score: 380.948 bits (977), Expect = 1.265e-128
Identity = 219/332 (65.96%), Postives = 265/332 (79.82%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNR 1089
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G PP S+GRGRDWNVDLIPKFLMA+           VTRY++FK IEGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ V  +PK  ++R VY+ F + ++  DF GH++ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKV+GV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANE----------VTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGV--DPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQ-PCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNR 318          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Mouse
Match: Gdi1 (guanosine diphosphate (GDP) dissociation inhibitor 1 [Source:MGI Symbol;Acc:MGI:99846])

HSP 1 Score: 171.014 bits (432), Expect = 4.993e-50
Identity = 86/169 (50.89%), Postives = 106/169 (62.72%), Query Frame = 1
Query:  910 QAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            ++EGE+ARCK +I DP Y+ DRV+K G VIR ICIL+HPI NTN A S QIIIPQNQVNR  +                              P++E++P L LL  I+Q F   SDL+EPID+G +S+VF S SYDATTHFETTC D+ DIYKR+ G+ FDF     K
Sbjct:    1 KSEGEVARCKQLICDPSYIPDRVQKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSE------------------------------PEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDIYKRMAGSAFDFENMKRK 139          
BLAST of Rab GDP dissociation inhibitor vs. UniProt/SwissProt
Match: sp|P50395|GDIB_HUMAN (Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 289/441 (65.53%), Postives = 357/441 (80.95%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G+PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK  EGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ +  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKVIGV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +S+ H+VA+   +IA+V+TTVETK P++E++P L LL  IEQ F + SDL  P D G +S++FIS +YDATTHFETTC D+ +IYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGI--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. UniProt/SwissProt
Match: sp|P50399|GDIB_RAT (Rab GDP dissociation inhibitor beta OS=Rattus norvegicus OX=10116 GN=Gdi2 PE=1 SV=2)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 289/441 (65.53%), Postives = 356/441 (80.73%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G PP S+GRGRDWNVDLIPKFLMA+G LVK+L+ T VTRY++FK IEGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ V  +PK  ++R VY+ F + ++  DF GH++ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKV+GV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +S+ H+VA+   +IA+V+TTVETK P++E++P L LL  IEQ F + SDLF P D G DS++FIS +YDATTHFETTC D+ DIYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGV--DPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQ-PCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. UniProt/SwissProt
Match: sp|Q61598|GDIB_MOUSE (Rab GDP dissociation inhibitor beta OS=Mus musculus OX=10090 GN=Gdi2 PE=1 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 289/441 (65.53%), Postives = 356/441 (80.73%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK F   G PP S+GRGRDWNVDLIPKFLMA+G LVK+L+ T VTRY++FK IEGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ V  +PK  ++R VY+ F + ++  DF GH++ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKV+GV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +S+ H+VA+   +IA+V+TTVETK P++E++P L LL  IEQ F + SDLF P D G DS++FIS +YDATTHFETTC D+ DIYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGV--DPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQ-PCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. UniProt/SwissProt
Match: sp|Q5RCE1|GDIB_PONAB (Rab GDP dissociation inhibitor beta OS=Pongo abelii OX=9601 GN=GDI2 PE=2 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 288/441 (65.31%), Postives = 356/441 (80.73%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK +   G+PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK  EGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ +  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKVIGV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +S+ H+VA+   +IA+V+TTVETK P++E++P L LL  IEQ F + SDL  P D G +S +FIS +YDATTHFETTC D+ +IYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRYKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGI--DPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESLIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. UniProt/SwissProt
Match: sp|Q6Q7J2|GDIB_PIG (Rab GDP dissociation inhibitor beta OS=Sus scrofa OX=9823 GN=GDI2 PE=2 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 290/441 (65.76%), Postives = 354/441 (80.27%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+SASITPLE+LYK FN  GAPP S+GRGRDWNVDLIPKFLMA+G LVK+L+ T VTRYL+FK  EGS+VYK G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P T++ V  +PK   +R+VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I+  + GKVIGV++EGEIARCK +I DP YVKDRV KVG VIR ICIL+HPI NT+ A S QIIIPQNQVNR  DIYVC +S  H+VA+   +IA+ +TTVETK P++E++P L LL  IEQ F + SDL  P D G DS++FIS +YDATTHFETTC D+ DIYKR+TG+EFDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFNIPGAPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDENDPRTFEGV--DPKKTAMREVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIV-QNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTSDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIASTTVETKEPEKEIRPALELLKPIEQKFVSISDLLVPKDLGTDSQIFISRTYDATTHFETTCGDIKDIYKRMTGSEFDFEEMKRK 437          
BLAST of Rab GDP dissociation inhibitor vs. TrEMBL
Match: A0A1I8HMS2 (Rab GDP dissociation inhibitor OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 319/447 (71.36%), Postives = 371/447 (83.00%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE 1437
            MD EYD+IVLGTGLKECILSG+MSV GKKVLHMD+N+YYGGDSASITPL +L+ MF  G PP  L + RDWNVDLIPKFLMA+GALVK+L+ TGVTRYLEFKS+EGSYVYK G I KVPC+EKEALA+SLMGMFEKRRFRK L+WA   D     T++ +  +   DTV+  YE FGVD+NT DF GHAIC+YLND Y+  SPA EAIRR++LYS SL++YG SPYLYP+YGLGELPQGFARLSAV+GGTYMLNKP  +IV+DE G V GVQ+EG++A+CKAVI DP Y  DRVRKVGSVIRAICIL HPIP+T   LS QIIIPQNQVNR +DIYVC VSY H+VAS PNFIA+V+T VET NP+EEL+PGLNLLG I+QIFY ESDL EP D+G  S+V+IS SYDATTHFETTCRDVLD+Y+R+ G +FDF+K   K   +ED+
Sbjct:    1 MDVEYDIIVLGTGLKECILSGLMSVSGKKVLHMDRNNYYGGDSASITPLNDLFGMFKMGDPPAYLEKFRDWNVDLIPKFLMANGALVKLLLFTGVTRYLEFKSVEGSYVYKGGKIHKVPCNEKEALASSLMGMFEKRRFRKFLIWAQNIDENNRATWEGI--DIHKDTVKAAYEKFGVDQNTTDFTGHAICLYLNDGYM-SSPAIEAIRRIKLYSESLARYGSSPYLYPMYGLGELPQGFARLSAVYGGTYMLNKPDAEIVFDETGAVAGVQSEGQVAKCKAVICDPNYATDRVRKVGSVIRAICILRHPIPDTGDKLSAQIIIPQNQVNRKNDIYVCAVSYAHNVASKPNFIAMVSTIVETANPREELRPGLNLLGPIDQIFYKESDLLEPTDSGEKSKVYISKSYDATTHFETTCRDVLDVYERLMGEKFDFSKVQDKIVNAEDD 444          
BLAST of Rab GDP dissociation inhibitor vs. TrEMBL
Match: A0A1I8HNF9 (Rab GDP dissociation inhibitor OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017167g1 PE=3 SV=1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 318/447 (71.14%), Postives = 371/447 (83.00%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE 1437
            MD EYD+IVLGTGLKECILSG+MSV GKKVLHMD+N+YYGGDSASITPL +L+ MF  G PP  L + RDWNVDLIPKFLMA+GALVK+L+ TGVTRYLEFKS+EGSYVYK G I KVPC+EKEALA+SLMGMFEKRRFRK L+WA   D     T++ +  +   DTV+  Y+ FGVD+NT DF GHAIC+YLND Y+  SPA EAIRR++LYS SL++YG SPYLYP+YGLGELPQGFARLSAV+GGTYMLNKP  +IV+DE G V GVQ+EG++A+CKAVI DP Y  DRVRKVGSVIRAICIL HPIP+T   LS QIIIPQNQVNR +DIYVC VSY H+VAS PNFIA+V+T VET NP+EEL+PGLNLLG I+QIFY ESDL EP D+G  S+V+IS SYDATTHFETTCRDVLD+Y+R+ G +FDF+K   K   +ED+
Sbjct:    1 MDVEYDIIVLGTGLKECILSGLMSVSGKKVLHMDRNNYYGGDSASITPLNDLFGMFKMGDPPAYLEKFRDWNVDLIPKFLMANGALVKLLLFTGVTRYLEFKSVEGSYVYKGGKIHKVPCNEKEALASSLMGMFEKRRFRKFLIWAQNIDENNRATWEGI--DIHKDTVKAAYDKFGVDQNTTDFTGHAICLYLNDGYM-SSPAIEAIRRIKLYSESLARYGSSPYLYPMYGLGELPQGFARLSAVYGGTYMLNKPDAEIVFDETGAVAGVQSEGQVAKCKAVICDPNYATDRVRKVGSVIRAICILRHPIPDTGDKLSAQIIIPQNQVNRKNDIYVCAVSYAHNVASKPNFIAMVSTIVETANPREELRPGLNLLGPIDQIFYKESDLLEPTDSGEKSKVYISKSYDATTHFETTCRDVLDVYERLMGEKFDFSKVQDKIVNAEDD 444          
BLAST of Rab GDP dissociation inhibitor vs. TrEMBL
Match: A0A267EHB9 (Rab GDP dissociation inhibitor OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000591g1 PE=3 SV=1)

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 305/447 (68.23%), Postives = 357/447 (79.87%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE 1437
            MD EYD+IVLGTGLKECILSG+MSV GKKVLHMD+N+YYGGDSASITPL +L+ MF  G PP  L + RDWNVDLIPKFLMA+GALVK+L+ TGVTRYLEFKS+EGSYVYK G I KVPC+EKEALA+SLMGMFEKRRFRK L+WA   D     T++ +  +   DTV+  YE FGVD+NT DF GHAIC+YLND Y+  SPA EAIRR++LYS SL+       +Y L  L +    FARLSAV+GGTYMLNKP  +IV+DE G V GVQ+EG++A+CKAVI DP Y  DRVRKVGSVIRAICIL HPIP+T   LS QIIIPQNQVNR +DIYVC VSY H+VAS PNFIA+V+T VET NP+EEL+PGLNLLG I+QIFY ESDL EP D+G  S+V+IS SYDATTHFETTCRDVLD+Y+R+ G +FDF+K   K   +ED+
Sbjct:    1 MDVEYDIIVLGTGLKECILSGLMSVSGKKVLHMDRNNYYGGDSASITPLNDLFGMFKMGDPPAYLEKFRDWNVDLIPKFLMANGALVKLLLFTGVTRYLEFKSVEGSYVYKGGKIHKVPCNEKEALASSLMGMFEKRRFRKFLIWAQNIDENNRATWEGI--DIHKDTVKAAYEKFGVDQNTTDFTGHAICLYLNDGYM-SSPAIEAIRRIKLYSESLASSPYLYPMYGLGELPQG---FARLSAVYGGTYMLNKPDAEIVFDETGAVAGVQSEGQVAKCKAVICDPNYATDRVRKVGSVIRAICILRHPIPDTGDKLSAQIIIPQNQVNRKNDIYVCAVSYAHNVASKPNFIAMVSTIVETANPREELRPGLNLLGPIDQIFYKESDLLEPTDSGEKSKVYISKSYDATTHFETTCRDVLDVYERLMGEKFDFSKVQDKIVNAEDD 441          
BLAST of Rab GDP dissociation inhibitor vs. TrEMBL
Match: Q9Y0A4 (Rab GDP dissociation inhibitor OS=Branchiostoma floridae OX=7739 GN=rab-GDI PE=2 SV=1)

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 294/449 (65.48%), Postives = 365/449 (81.29%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGA--IFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE 1437
            MD+ YDVIVLGTGLKECILSG++SV GKKVLHMD+N YYGG+SASITPLE LY+ F  G+PPES+GRGRDWNVDLIPKFLMA+G LVK+LIH+GVTRYLEFKS EGSYVYK G   I KVP  EKEAL+TSLMGMFEKRR+RK LMW    D + P+T+ ++  +    T+++VY HFG+D NT DF GHA+ ++ +D+Y  +S   + IRR++LYS SL++YGK+PYLYPLYGLGELPQGFARLSA++GGTYML+KP  KI +DE GKV GV+++GE A+C AV+ DPGY  D+V+KVG V+R ICIL+HP+PNT  +LS Q+IIPQNQV+R  DIYVCCVS+ H+VAS   F+A+ +TTVET NP+ ELKP LNLLG I+Q F + SDL+EPI++G +S++F+S++YDATTHFETTC D+LDIYKR TG EFDFTK   +     DE
Sbjct:    1 MDETYDVIVLGTGLKECILSGLLSVSGKKVLHMDRNKYYGGESASITPLEELYEKFGLGSPPESMGRGRDWNVDLIPKFLMANGMLVKLLIHSGVTRYLEFKSCEGSYVYKSGGNKIHKVPVTEKEALSTSLMGMFEKRRYRKFLMWVNDIDESNPKTHGDI--DIGKATMQEVYTHFGLDENTADFTGHALALWRDDNYKQQS-CIDTIRRIKLYSESLARYGKTPYLYPLYGLGELPQGFARLSAIYGGTYMLDKPECKIHFDENGKVTGVESDGETAKCSAVVCDPGYAGDKVKKVGQVVRCICILSHPVPNTKDSLSCQLIIPQNQVDRKSDIYVCCVSHAHNVASKGKFLAICSTTVETDNPEAELKPALNLLGPIDQKFVSVSDLYEPIEDGTNSKLFVSSTYDATTHFETTCLDILDIYKRYTGEEFDFTKVADQIQTVADE 446          
BLAST of Rab GDP dissociation inhibitor vs. TrEMBL
Match: Q8MY04 (Rab GDP dissociation inhibitor OS=Branchiostoma belcheri OX=7741 GN=bbGDPI PE=2 SV=1)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 292/447 (65.32%), Postives = 364/447 (81.43%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE 1437
            MD+ YDVIVLGTGLKECILSG++SV GKKVLHMD+N YYGG+SASITPLE LY+ F  G+PPE++GRGRDWNVDLIPKFLMA+G LVK+LIHTGVTRYLEFKS EGSYVYK G + KVP  EKEAL+TSLMGMFEKRR+RK L+W    D + PET+K +  + +  T+++VY +FG+D+NT DF GHA+ ++ +D+Y ++S   + IRR++LYS SL++YGK+PYLYPLYGLGELPQGFARLSA++GGTYML+K    I +DE+GKVIGV++ GE+A+C AV+ DP Y  D+V+KVG V+R ICIL+HP+PNT  +LS Q+IIPQNQV+R  DIYVCCVSY H+VAS   F+A+ +TTVET NP+ ELKP L LLG I+Q F + SDLFEPID+G +S++F+ST+YDATTHFETTC D+LDIYKR  G  FDFTK   +     DE
Sbjct:    1 MDETYDVIVLGTGLKECILSGLLSVSGKKVLHMDRNKYYGGESASITPLEELYEKFGLGSPPETMGRGRDWNVDLIPKFLMANGMLVKLLIHTGVTRYLEFKSCEGSYVYKAGKVHKVPVTEKEALSTSLMGMFEKRRYRKFLIWVNDLDESNPETHKPI--DIEKATMQEVYTNFGLDKNTADFTGHALALWRDDNYKEQS-CVDTIRRIKLYSESLARYGKTPYLYPLYGLGELPQGFARLSAIYGGTYMLDKEGCTIKFDEEGKVIGVESAGEVAKCSAVVCDPSYAADKVKKVGQVVRCICILSHPVPNTKDSLSCQLIIPQNQVDRKSDIYVCCVSYAHNVASKGKFLAICSTTVETDNPEAELKPALRLLGPIDQKFVSVSDLFEPIDDGPNSKLFVSTTYDATTHFETTCLDILDIYKRYYGEAFDFTKVADQIQTVADE 444          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Cavefish
Match: gdi2 (rab GDP dissociation inhibitor beta-like [Source:NCBI gene;Acc:103022887])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 289/441 (65.53%), Postives = 360/441 (81.63%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            M++EYDVIVLGTGL ECILSG+MSV GKKVLHMD+N YYGGDSASITPLE+L+K F+  G+PPES+G+GRDWNVDLIPKFLMA+G LV++L+ T VTRYL+FK IEGS+VYK+G I+KVP  E EALA+SLMG+FEKRRFRK L++   FD   P+T + V  +PK  T+R+VY+ F + ++  DF GHAI +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I++ E GKV+GV++EGEIARCK +I DP YV DR + VG VIR ICIL+HPI +T+ A S QIIIPQNQVNR HDIYVC +SY H+VA+   +IA+V+TTVET +P++E+KP L+LL  IEQ F + SDL+ P D G +S+VFIS SYDATTHFETTC D+ DIYKR+TG +FDF +   K
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVKGKKVLHMDRNSYYGGDSASITPLEDLFKRFSLPGSPPESMGKGRDWNVDLIPKFLMANGQLVRMLLITQVTRYLDFKVIEGSFVYKKGGIYKVPSTETEALASSLMGLFEKRRFRKFLVFVANFDENDPKTMEGV--DPKKTTMREVYKKFDLGQDVIDFTGHAIALYRTDDYLDQ-PCIETINRVKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIF-ENGKVVGVKSEGEIARCKQLICDPSYVSDRAKVVGKVIRVICILSHPIKSTSDANSCQIIIPQNQVNRKHDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEKEIKPALDLLEPIEQKFVSISDLYAPTDVGAESQVFISRSYDATTHFETTCDDIKDIYKRMTGTDFDFAEMERK 437          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Cavefish
Match: ENSAMXT00000035821.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:2051930:2068576:1 gene:ENSAMXG00000009105.2 transcript:ENSAMXT00000035821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 285/435 (65.52%), Postives = 355/435 (81.61%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDF 1398
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPLE LYK F+   +PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK +EGS+VYK G I+KVP  E EALA++LMGMFEKRRFRK L++   FD   P+T++ V  +PKT T+R VY+ F + ++  DF GHA+ +Y  DDY+D++   E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPVE+IV  E G+V+GV++EGE+ARCK +I DP YV+DRVRK G VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+V+TTVET +P+ E++P L LL  I+Q F   SDL+E  D+G +S++F S +YDATTHFETTC D+ DIYKR+TG +FDF
Sbjct:  172 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFDLPDSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTESEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPKTTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQA-CLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVEEIVM-EGGRVVGVKSEGEVARCKQLICDPSYVQDRVRKAGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRTSDIYVCMISYAHNVAAQGKYIAIVSTTVETSDPEAEIQPALELLEPIDQKFVAISDLYEASDDGSESQIFCSRAYDATTHFETTCNDIKDIYKRMTGTDFDF 602          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Cavefish
Match: gdi1 (rab GDP dissociation inhibitor alpha [Source:NCBI gene;Acc:103044697])

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 289/450 (64.22%), Postives = 354/450 (78.67%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCG-APPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTG--LSEDE 1437
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPLE LYK F     P ES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK +EGS+VYK G I+KVP  E EALA++LMGMFEKRRFRK L++   FD   P+T++ V  +PK  T+ +VY+ F + ++  DF GHA+ +Y  DDY+++ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPV++IV  E G VIGV++EGEIARCK +I DP Y+ DRVRK G VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+V+TTVET  P+ E++P L LL  I+Q F   SD++EP D+G DS+VF S SYDATTHFETTC D+ DIYKR+TG++FDF     K      EDE
Sbjct:    1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFELSDGPAESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPKQTTMGEVYKKFDLGQDVIDFTGHALALYRTDDYLEQ-PCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDEIVM-EGGHVIGVKSEGEIARCKQLICDPSYIPDRVRKAGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETAEPEAEIEPALELLEPIDQKFMAISDMYEPTDDGSDSQVFASRSYDATTHFETTCNDIKDIYKRMTGSDFDFENMKRKQNDVFGEDE 446          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Cavefish
Match: ENSAMXT00000040009.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:2052447:2068576:1 gene:ENSAMXG00000009105.2 transcript:ENSAMXT00000040009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 449.899 bits (1156), Expect = 6.880e-154
Identity = 256/435 (58.85%), Postives = 317/435 (72.87%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDF 1398
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPLE LYK F+   +PPES+GRGRDWNVDLIPKFLMA+                                              LMGMFEKRRFRK L++   FD   P+T++ V  +PKT T+R VY+ F + ++  DF GHA+ +Y  DDY+D++   E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPVE+IV  E G+V+GV++EGE+ARCK +I DP YV+DRVRK G VIR ICIL+HPI NTN A S QIIIPQNQVNR  DIYVC +SY H+VA+   +IA+V+TTVET +P+ E++P L LL  I+Q F   SDL+E  D+G +S++F S +YDATTHFETTC D+ DIYKR+TG +FDF
Sbjct:    1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFDLPDSPPESMGRGRDWNVDLIPKFLMAN---------------------------------------------DLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPKTTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQA-CLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVEEIVM-EGGRVVGVKSEGEVARCKQLICDPSYVQDRVRKAGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRTSDIYVCMISYAHNVAAQGKYIAIVSTTVETSDPEAEIQPALELLEPIDQKFVAISDLYEASDDGSESQIFCSRAYDATTHFETTCNDIKDIYKRMTGTDFDF 386          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Cavefish
Match: gdi2 (rab GDP dissociation inhibitor beta-like [Source:NCBI gene;Acc:103022887])

HSP 1 Score: 436.032 bits (1120), Expect = 3.110e-149
Identity = 248/426 (58.22%), Postives = 309/426 (72.54%), Query Frame = 1
Query:  142 ECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            ECILSG+MSV GKKVLHMD+N YYGGDSASITPLE+L+K F+  G+PPES+G+GRDWNVDLIPKFLMA+G                                             LMG+FEKRRFRK L++   FD   P+T + V  +PK  T+R+VY+ F + ++  DF GHAI +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+I++ E GKV+GV++EGEIARCK +I DP YV DR + VG VIR ICIL+HPI +T+ A S QIIIPQNQVNR HDIYVC +SY H+VA+   +IA+V+TTVET +P++E+KP L+LL  IEQ F + SDL+ P D G +S+VFIS SYDATTHFETTC D+ DIYKR+TG +FDF +   K
Sbjct:   10 ECILSGIMSVKGKKVLHMDRNSYYGGDSASITPLEDLFKRFSLPGSPPESMGKGRDWNVDLIPKFLMANG---------------------------------------------LMGLFEKRRFRKFLVFVANFDENDPKTMEGV--DPKKTTMREVYKKFDLGQDVIDFTGHAIALYRTDDYLDQ-PCIETINRVKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIF-ENGKVVGVKSEGEIARCKQLICDPSYVSDRAKVVGKVIRVICILSHPIKSTSDANSCQIIIPQNQVNRKHDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEKEIKPALDLLEPIEQKFVSISDLYAPTDVGAESQVFISRSYDATTHFETTCDDIKDIYKRMTGTDFDFAEMERK 386          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001710.1 (pep scaffold:Pmarinus_7.0:GL479722:1:16370:1 gene:ENSPMAG00000001527.1 transcript:ENSPMAT00000001710.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 282/441 (63.95%), Postives = 354/441 (80.27%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGA-PPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGGDSASITPLE LYK F   A PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK ++GS+VYK G I+KVP  E EALA++LMGMFEKRRFRK L++   FD  +P +++ V  +P+T T+R VY+ F + ++  DF GHA+ +Y  DDY+D+ P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPVE+IV  E G+V+GV++EG++ARCK VI D  Y  D V+K G V+R ICIL+HPI +TN A S QIIIPQ QVNR  DIYVC +S+ H+VA+   +IA+V+TTVET++P+ E+ P L LL  I+Q F T  D++EP D G++S++FIS SYDATTHFETTC D+ DIYKR+TGA+FDF +   K
Sbjct:   17 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNSYYGGDSASITPLEELYKRFTLPAGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVDGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVAEFDEKEPNSHQGV--DPQTTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQ-PCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVEEIVM-ENGRVVGVKSEGQVARCKQVICDASYAADYVKKSGQVVRVICILSHPIKDTNDANSCQIIIPQTQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETEDPEAEVLPALQLLEPIDQKFVTVCDMYEPTDLGLESQIFISRSYDATTHFETTCNDIKDIYKRVTGADFDFEEVKRK 453          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007791.1 (pep scaffold:Pmarinus_7.0:GL476823:1480:6964:-1 gene:ENSPMAG00000007041.1 transcript:ENSPMAT00000007791.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 297.36 bits (760), Expect = 9.192e-98
Identity = 175/266 (65.79%), Postives = 217/266 (81.58%), Query Frame = 1
Query:  139 KECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIAR 933
            +ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPL +LYK FN  G PP S+G GRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK +EGSYVYK G I KVP  E EALA+ LMGMFEKRRFRK L++   F+   P+TY+ V  +PK  T+R V++ F + ++  DF GH++ +Y  DDY+DK P  EA+ R++LYS SL+KYGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPVE+IV  E GKV+GV++EGE+ R
Sbjct:    1 QECILSGIMSVNGKKVLHMDRNSYYGGESSSITPLGDLYKRFNIPGEPPTSMGNGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSYVYKGGKIHKVPSTETEALASGLMGMFEKRRFRKFLVFVANFEENDPQTYQGV--DPKATTMRDVFKKFDLGQDVIDFTGHSLALYRTDDYLDK-PCLEALNRIKLYSESLAKYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVEEIVM-ENGKVLGVKSEGEVRR 262          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Yeast
Match: GDI1 (GDP dissociation inhibitor; regulates vesicle traffic in secretory pathways by regulating the dissociation of GDP from the Sec4/Ypt/rab family of GTP binding proteins [Source:SGD;Acc:S000000938])

HSP 1 Score: 397.127 bits (1019), Expect = 4.278e-134
Identity = 223/437 (51.03%), Postives = 312/437 (71.40%), Query Frame = 1
Query:   94 TMDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPES-----LGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYD-EQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGS-VIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITG 1383
            T+D +YDVIVLGTG+ ECILSG++SVDGKKVLH+DK D+YGG++AS+T L  LY+ F      +       G+ RDWNVDLIPKFLMA+G L  ILIHT VTRY++FK + GSYV+KQG I+KVP +E EA+++ LMG+FEKRR +K L W   +      T++ +  +   +T+ +VY  FG+  +T++FIGHA+ ++ NDDY+ + PA  +  R+ LY  S+++YGKSPYLYP+YGLGELPQGFARLSA++GGTYML+ P+++++Y  + GK  GV+ +    +   VI+DP Y  ++ +  G  VIRAICIL HP+PNT+ A S QIIIPQ+Q+ R  DIYV  VS  H+V S  +++A+++T +ET  P  EL+P   LLG IE+ F   ++LFEP ++G    +++S SYDA++HFE+   DV DIY R+TG
Sbjct:    5 TIDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVT-LSQLYEKFKQNPISKEERESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGL--DLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYL-QQPARPSFERILLYCQSVARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKTKLGTFKAPLVIADPTYFPEKCKSTGQRVIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGHYLAIISTIIETDKPHIELEPAFKLLGPIEEKFMGIAELFEPREDGSKDNIYLSRSYDASSHFESMTDDVKDIYFRVTG 437          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Yeast
Match: MRS6 (Rab escort protein; forms a complex with the Ras-like small GTPase Ypt1p that is required for the prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p); sequence similarity to mammalian choroideraemia gene; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000005897])

HSP 1 Score: 85.8853 bits (211), Expect = 4.590e-18
Identity = 99/335 (29.55%), Postives = 157/335 (46.87%), Query Frame = 1
Query:   94 TMDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASIT--PLENLYKMFNCGA----------PPESLGRG----RDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNT--QDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXX-XXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIV-YDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVG----SVIRAICILTHP 1026
            T  D+ DV++ GTG+ E +L+  ++  G  VLH+DKNDYYG  SA++T   ++      N G+              +G G    RD+ +DL PK L A   L+ ILI + V +YLEF+S+   + Y+     K+   ++E      + +  KR   K + + + ++  + E ++       +D +    E F +++    +      +C  LN     K P  EA++R++ Y  S   YG  P L     G GEL QGF R +AV G TY LN   EK+V ++   KV   Q   ++   + VI  P       + V      V R  CI+ +P
Sbjct:   42 TTPDKVDVLIAGTGMVESVLAAALAWQGSNVLHIDKNDYYGDTSATLTVDQIKRWVNEVNEGSVSCYKNAKLYVSTLIGSGKYSSRDFGIDLSPKILFAKSDLLSILIKSRVHQYLEFQSLSNFHTYENDCFEKLTNTKQEIFTDQNLPLMTKRNLMKFIKFVLNWE-AQTEIWQPYAERTMSDFLG---EKFKLEKPQVFELIFSIGLCYDLN----VKVP--EALQRIRRYLTSFDVYGPFPALCSKYGGPGELSQGFCRSAAVGGATYKLN---EKLVSFNPTTKVATFQDGSKVEVSEKVIISPTQAPKDSKHVPQQQYQVHRLTCIVENP 363          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Nematostella
Match: EDO44348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW44])

HSP 1 Score: 506.908 bits (1304), Expect = 9.197e-177
Identity = 273/444 (61.49%), Postives = 339/444 (76.35%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESL----GRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSK 1416
            MDDEYDVIVLGTGLKECILSG +SV GKKVLHMD   +YGG++AS+TPL  L+  FN   P E +    GR RDWNVDL+PKF+MA G LVKILI +GVTRYLEFKSI GSYVY+   I+KVPCDEKEAL +SLMG+ EKRRFR  L+W   F I  P+T+K +  +P+ +T+ +VY+ FG+D NT DF+GHA+ + +ND Y D+ P  + + +++LY+ SLS+YGKSPYLYPLYGLGE+PQGFARLSA++GGTYML+KP+E IVYD++G V GV ++GE AR K V+ D  Y  D+V+KVG V+R IC+L HPIPNT  A S QIIIPQNQVNR HDIYV CVSY +  A+   FIA V TTVET NP+ ELKPGLNLLG I + F + SDL EPID+G  S+VFI  S DA +HF   C+D+ D+Y+RITG  FDF+K  ++
Sbjct:    1 MDDEYDVIVLGTGLKECILSGALSVAGKKVLHMDSQKFYGGETASLTPLSQLFDKFNRSMPKEEIEKRFGRERDWNVDLVPKFIMAGGNLVKILIGSGVTRYLEFKSIGGSYVYRGNKIYKVPCDEKEALNSSLMGLLEKRRFRNFLLWVQDFKIEDPKTWKGI--DPQKNTMTEVYQKFGLDANTADFVGHAMALEINDSYKDQ-PFGQTVEKIKLYNESLSRYGKSPYLYPLYGLGEIPQGFARLSAIYGGTYMLDKPIEAIVYDDEGVVKGVTSQGETARAKIVLGDSSYFPDKVKKVGQVVRCICLLNHPIPNTADAPSCQIIIPQNQVNRKHDIYVACVSYDNFAAAKGFFIASVMTTVETSNPEAELKPGLNLLGPIMEKFVSVSDLNEPIDDGSKSKVFIPKSCDALSHFNKDCQDIEDLYERITGEPFDFSKLQTQ 441          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Nematostella
Match: EDO31457 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXV1])

HSP 1 Score: 481.871 bits (1239), Expect = 6.992e-167
Identity = 259/438 (59.13%), Postives = 341/438 (77.85%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFN-CGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGV-TRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLT---NPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFD 1395
            MD EYD +VLGTGLKEC+LSG++S++ KKVLHMD+N YYGGD AS+ PL  LY+ F     P +SLG+ RD+NVDLIPKFLMADG LVKIL+HTGV T+Y+ FK IEGS+VY+ G++ KVP +EKEAL +SLMG+FEKRRFR  L++A+  +     T+K+      +PK  T+  V++ + + ++T DF GHAI +Y +D+Y+ K P EEAI R++LY  SLSKYG SPY+YP+YGLGELPQGFARL AV+GGTYML+K +++++  E G V GV+ +GE+A+ K VI DP Y  DRVR +G V+R ICIL+HPI NTN   S Q+IIPQNQVNRN DIY+CCVS T+ V     ++A+V+TTVET +P++EL+PGL LLGKI++ F + S+L+EP+D+G +S++ IS SYDATTHFETTC D++D+YKRITG EFD
Sbjct:    1 MDAEYDYVVLGTGLKECVLSGLLSLNKKKVLHMDRNKYYGGDCASLHPLNQLYETFGRTDFPGDSLGKPRDYNVDLIPKFLMADGTLVKILVHTGVATKYMNFKQIEGSFVYRGGSVHKVPANEKEALNSSLMGIFEKRRFRNFLIFALGVEPENASTWKDYAGGNFDPKKTTMNDVFKAYDLSQDTADFTGHAIALYRDDEYMSK-PCEEAIMRIKLYYQSLSKYGGSPYIYPVYGLGELPQGFARLCAVWGGTYMLDKAIDEVIM-ENGVVKGVKTQGEVAKAKVVIGDPSYFPDRVRSIGKVVRCICILSHPIANTNNKQSCQLIIPQNQVNRNSDIYICCVSQTNLVTPKDKYLAIVSTTVETADPEKELEPGLKLLGKIDEKFVSVSNLYEPLDDGTESKIVISKSYDATTHFETTCDDIMDMYKRITGEEFD 436          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Nematostella
Match: EDO49686 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFZ7])

HSP 1 Score: 90.8929 bits (224), Expect = 2.765e-19
Identity = 89/262 (33.97%), Postives = 137/262 (52.29%), Query Frame = 1
Query:  301 RDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKP-ETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDY-IDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYD-EQGKVIGVQAEGEIARCKAVISDPGYVKDRVRK--VGSVIRAICILTHPIPNTNGALSTQIIIP 1071
            R +N+DL PK L++ GALV+ LI   ++ Y EFK++     + +G++  VPC   +  ++ L+ + EKR   K L +  C D  +  E YK     P  + ++       +  N Q F+ HAI +   D   ID       +   Q + +SL +YG SP+++PLYGLGELPQ + R+ AVFGG Y L K  E IV D ++ K + V +EG+  +CK +I +  Y+    R+    SV RA+ I    I        T + +P
Sbjct:  221 RQFNIDLAPKLLLSRGALVESLISANISHYAEFKAVNQILTFLEGSMEAVPCSRSDVFSSKLIPVIEKRLLMKFLTF--CLDHNEHLEEYKPFEDKPFVEFLKSRR----MTPNLQHFVIHAIAMVKPDALTID------GLNAAQSFLMSLGRYGNSPFIWPLYGLGELPQAYCRMCAVFGGLYCLRKSAESIVVDTKEKKCVKVVSEGQELKCKWLIMEHTYLPSEWREPSTQSVSRAVFITDKSIKQAKEENVTMLTMP 470          

HSP 2 Score: 56.6102 bits (135), Expect = 2.162e-8
Identity = 25/44 (56.82%), Postives = 31/44 (70.45%), Query Frame = 1
Query:  106 EYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASIT 237
            EYD IVLGTGL E +++  +S  G KVLH+D+NDYY    AS T
Sbjct:    7 EYDAIVLGTGLPEAVVAAALSRIGLKVLHLDRNDYYSSQWASFT 50          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Medaka
Match: gdi1 (GDP dissociation inhibitor 1 [Source:NCBI gene;Acc:101171993])

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 295/450 (65.56%), Postives = 358/450 (79.56%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTG--LSEDE 1437
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPLE LYK FN   +PPES+GRGRDWNVDLIPKFLMA+G LVK+L++T VTRYL+FK +EGS+VYK G I+KVP  E EALA++LMGMFEKRRFRK L++   FD   P+T++ V  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D  P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPVE+IV  E GKV+GV++EGE+ARCK +I DP Y+ DRVRKVG VIR ICIL+HPI NTN A S QIIIPQNQVNRN DIYVC +SY H+VA+   +IA+V+TTVET  P+ E++P L LL  I+Q F   SDL+EP D+G +S+VF S SYDATTHFETTC D+ DIYKR+TG +FDF     K      EDE
Sbjct:    1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFNLQDSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPKATTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLD-VPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVEEIVM-EGGKVVGVKSEGEVARCKQLICDPSYISDRVRKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRNSDIYVCMISYAHNVAAQGKYIAIVSTTVETSEPETEIEPALELLEPIDQKFVAISDLYEPTDDGTESQVFASRSYDATTHFETTCNDIKDIYKRMTGTDFDFENMKRKQNDVFGEDE 446          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Medaka
Match: gdi2 (rab GDP dissociation inhibitor beta [Source:NCBI gene;Acc:101168509])

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 280/437 (64.07%), Postives = 353/437 (80.78%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTK 1404
            M++EYDVIVLGTGL ECILSG+MSV GK+VLHMD+N YYG +SASITPLE+LYK FN  G PP+S+G+GRDWNVDLIPKFLMA+G LV++L+ T VTRYL+FK IEGSYVYK G I KVP  E EALA+SLMG+FEKRRFRK L++   FD   P+T ++V  +P+  T+R +++ F + +   DF GH++ +Y  DDY+D+ P  + I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKP+E+IV  E+GKV+GV++EGEIARCK +I DP YV DRVRKVG VIR ICI+ HPI NT    S QIIIPQNQVNR HDIYVC +S+ H+VA+   +IA+ +TTVET NP++E+KP L+LL  IEQ F + SD +EP D G DS++FIS +YDATTHFETTC D+ DIY+R+TG++F+F +
Sbjct:    1 MNEEYDVIVLGTGLTECILSGIMSVKGKRVLHMDRNSYYGAESASITPLEDLYKRFNIPGNPPDSMGKGRDWNVDLIPKFLMANGQLVRMLLITQVTRYLDFKVIEGSYVYKGGKIHKVPSTETEALASSLMGLFEKRRFRKFLIFVSNFDENDPKTMEDV--DPQKTTMRAIFQKFSLGQEVMDFTGHSLALYRTDDYLDQ-PCIQTINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIVI-EKGKVVGVKSEGEIARCKQLICDPSYVMDRVRKVGQVIRVICIMNHPIANTGDINSCQIIIPQNQVNRKHDIYVCMISFAHNVAAQGKYIAIASTTVETGNPEKEIKPALDLLEPIEQKFVSISDQYEPTDAGTDSQIFISRTYDATTHFETTCDDIKDIYRRMTGSDFNFAE 433          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Medaka
Match: gdi1 (GDP dissociation inhibitor 1 [Source:NCBI gene;Acc:101171993])

HSP 1 Score: 462.225 bits (1188), Expect = 2.067e-159
Identity = 266/450 (59.11%), Postives = 320/450 (71.11%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNC-GAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTG--LSEDE 1437
            MD+EYDVIVLGTGL ECILSG+MSV+GKKVLHMD+N YYGG+S+SITPLE LYK FN   +PPES+GRGRDWNVDLIPKFLMA+                                              LMGMFEKRRFRK L++   FD   P+T++ V  +PK  T+R VY+ F + ++  DF GHA+ +Y  DDY+D  P  E I R++LYS SL++YGKSPYLYPLYGLGELPQGFARLSA++GGTYMLNKPVE+IV  E GKV+GV++EGE+ARCK +I DP Y+ DRVRKVG VIR ICIL+HPI NTN A S QIIIPQNQVNRN DIYVC +SY H+VA+   +IA+V+TTVET  P+ E++P L LL  I+Q F   SDL+EP D+G +S+VF S SYDATTHFETTC D+ DIYKR+TG +FDF     K      EDE
Sbjct:    1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFNLQDSPPESMGRGRDWNVDLIPKFLMAN---------------------------------------------DLMGMFEKRRFRKFLVFVANFDENDPKTFEGV--DPKATTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLD-VPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVEEIVM-EGGKVVGVKSEGEVARCKQLICDPSYISDRVRKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRNSDIYVCMISYAHNVAAQGKYIAIVSTTVETSEPETEIEPALELLEPIDQKFVAISDLYEPTDDGTESQVFASRSYDATTHFETTCNDIKDIYKRMTGTDFDFENMKRKQNDVFGEDE 401          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Medaka
Match: zgc:112334 (zgc:112334 [Source:ZFIN;Acc:ZDB-GENE-050809-120])

HSP 1 Score: 254.218 bits (648), Expect = 1.001e-80
Identity = 117/209 (55.98%), Postives = 161/209 (77.03%), Query Frame = 1
Query:  106 EYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQ 732
            EYD+IVLGTGLKEC+LSG+MS+ GKKVLH+DKN YYGG+SASI+PLE LY+ F    PP+S+GRG++WNVDLIPKF +A G LVKIL+HT VTRY++FK +EGSYVYK G + KVP  E++A  + LMGMF+KRRFRKLL + + F+   P T+++V  +P+  T R+++  F + ++  DF GHAI ++ N+ Y+D+ P  + I R++
Sbjct:    3 EYDIIVLGTGLKECVLSGLMSLSGKKVLHIDKNPYYGGESASISPLEELYRRFKVHGPPKSMGRGKEWNVDLIPKFFLATGELVKILLHTEVTRYMDFKVVEGSYVYKAGKLHKVPATEEDAQTSDLMGMFDKRRFRKLLNFVLNFESRNPRTHQDV--DPEKTTTRELFSRFDLGQDVIDFTGHAIALHCNESYLDQ-PCLDTINRIK 208          
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Medaka
Match: chm (rab proteins geranylgeranyltransferase component A 1 [Source:NCBI gene;Acc:101158129])

HSP 1 Score: 85.1149 bits (209), Expect = 6.245e-17
Identity = 83/272 (30.51%), Postives = 138/272 (50.74%), Query Frame = 1
Query:  289 LGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQG---KVIGVQAEGEIARCKAVISDPGYVKDR---VRKVGSVIRAICILTHPI-PNTNGALSTQIIIPQNQV 1083
            L  GR +N+DL+ K L + G+LV +LI + V+RY EFK++     Y+ G + +VPC   +  A+  + + EKR+  + L    C + T  E  +   + P +    K  +   +  N Q F+ H+I +   D     +P E  +   + +  SL +YG SP+L+P+YGLGE+PQ F R+SAVFGG Y L   V  ++ D+     K + + + G+   C   + + GY+  R         + RAI I    + P+ +    + + IP  +V
Sbjct:  185 LKEGRRFNIDLVSKLLFSRGSLVDLLIRSNVSRYTEFKNVTRILTYRHGNLQQVPCSRADVFASRQLSVVEKRKLMRFL--TSCIEET--EMDQAYSSQPYS----KYLQDQQLGENLQHFLLHSIAMVTED-----TPTEAGLASTRHFLRSLGRYGNSPFLFPVYGLGEIPQCFCRMSAVFGGIYCLRHSVSCLIVDKDANRCKAV-IDSRGQRISCSHFVVEDGYLGSRSSVTTPTRLLSRAILITDSSVLPSDSEQQVSMVTIPPGEV 442          

HSP 2 Score: 53.9138 bits (128), Expect = 4.079e-7
Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASIT--PLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIH 372
            +  E+DV++LGTGL E +++   S  G++VLH+D+  YY  + AS T   L    +    G  PE   +G+DW+       L+ DG   + LIH
Sbjct:    6 LPSEFDVVILGTGLAESVVAAACSRVGQRVLHLDRRSYYAANWASFTFNALLTWIQEQQEGPQPE---QGKDWSS------LLNDG---EELIH 87          
BLAST of Rab GDP dissociation inhibitor vs. Planmine SMEST
Match: SMESG000034594.1 (SMESG000034594.1)

HSP 1 Score: 862.833 bits (2228), Expect = 0.000e+0
Identity = 447/447 (100.00%), Postives = 447/447 (100.00%), Query Frame = 1
Query:   97 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE 1437
            MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQLYSLSLSKYGKSPYLYPLYGLGELPQGFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE
Sbjct:    1 MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLENLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYIDKSPAEEAIRRMQLYSLSLSKYGKSPYLYPLYGLGELPQGFARLSAVFGGTYMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSVIRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNPNFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSRVFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE 447          
BLAST of Rab GDP dissociation inhibitor vs. Planmine SMEST
Match: SMESG000013972.1 (SMESG000013972.1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.892e-16
Identity = 85/302 (28.15%), Postives = 135/302 (44.70%), Query Frame = 1
Query:  103 DEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSA--SITPLE----------------NLYKM-----------FNCGAPPESLGRG-----------------RDWNVDLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMW--AMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAI--CVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLN 858
            + +D ++ GTG+ E +LS  +S  G +VLH+DKNDYYGG S    ++ LE                N+Y             +N  A  E+ G                   R +  ++ P+ L ++   V  LI + VTRYLEFK I          I  +P +  + + T +  + +KR+    L W   +  D    + Y+N   NP       ++E    ++N   F    I  C+ +  + ++    +E I R+Q +  S +K+G  P ++P YG GE+ Q F R+SAVFG  Y LN
Sbjct:    6 NNFDYVIYGTGIVESVLSAALSTTGHRVLHLDKNDYYGGYSGCFRLSELERLLDKWKNTTASDDNDNIYTETEGYVKFVTYNWNVHAEVETNGNDNLILSNNWTEETIRKFVRGFEFEIFPRILFSESRTVDALIQSDVTRYLEFKFISKFATLNDDKIIPIPINRSDIVKTRVFSLRQKRQLTSFLEWCYTVKLDDMIVQKYEN---NP-------LFELMRTEKNIDIFTEKIIIECMAMAPENVE---TKEGISRIQRFLYSFNKFGPYPIMWPNYGCGEISQAFCRMSAVFGSIYSLN 294          
BLAST of Rab GDP dissociation inhibitor vs. Planmine SMEST
Match: SMESG000013972.1 (SMESG000013972.1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.859e-16
Identity = 85/305 (27.87%), Postives = 135/305 (44.26%), Query Frame = 1
Query:  103 DEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSA--SITPLENLYKMF--------NCGAPPESLGRGR----DWNV-----------------------------------DLIPKFLMADGALVKILIHTGVTRYLEFKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMW--AMCFDITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAI--CVYLNDDYIDKSPAEEAIRRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXFARLSAVFGGTYMLN 858
            + +D ++ GTG+ E +LS  +S  G +VLH+DKNDYYGG S    ++ LE L   +        N     E+ G  +    +WNV                                   ++ P+ L ++   V  LI + VTRYLEFK I          I  +P +  + + T +  + +KR+    L W   +  D    + Y+N   NP       ++E    ++N   F    I  C+ +  + ++    +E I R+Q +  S +K+G  P ++P YG GE+ Q F R+SAVFG  Y LN
Sbjct:    6 NNFDYVIYGTGIVESVLSAALSTTGHRVLHLDKNDYYGGYSGCFRLSELERLLDKWKNTTASDDNDNIYTETEGYVKFVTYNWNVHTNSAEVETNGNDNLILSNNWTEETIRKFVRGFEFEIFPRILFSESRTVDALIQSDVTRYLEFKFISKFATLNDDKIIPIPINRSDIVKTRVFSLRQKRQLTSFLEWCYTVKLDDMIVQKYEN---NP-------LFELMRTEKNIDIFTEKIIIECMAMAPENVE---TKEGISRIQRFLYSFNKFGPYPIMWPNYGCGEISQAFCRMSAVFGSIYSLN 297          
The following BLAST results are available for this feature:
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GDI20.000e+065.53GDP dissociation inhibitor 2 [Source:HGNC Symbol;A... [more]
GDI10.000e+064.40GDP dissociation inhibitor 1 [Source:HGNC Symbol;A... [more]
GDI21.674e-15758.96GDP dissociation inhibitor 2 [Source:HGNC Symbol;A... [more]
GDI27.149e-9864.62GDP dissociation inhibitor 2 [Source:HGNC Symbol;A... [more]
GDI22.478e-6476.15GDP dissociation inhibitor 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdi-16.883e-17762.70Rab GDP dissociation inhibitor [Source:UniProtKB/... [more]
gdi-16.883e-17762.70Rab GDP dissociation inhibitor [Source:UniProtKB/... [more]
gdi-16.170e-17360.62Rab GDP dissociation inhibitor [Source:UniProtKB/... [more]
gdi-16.358e-2859.52Rab GDP dissociation inhibitor [Source:UniProtKB/... [more]
gdi-16.358e-2859.52Rab GDP dissociation inhibitor [Source:UniProtKB/... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gdi0.000e+063.15gene:FBgn0004868 transcript:FBtr0306169[more]
Gdi0.000e+063.15gene:FBgn0004868 transcript:FBtr0079862[more]
Gdi0.000e+063.15gene:FBgn0004868 transcript:FBtr0345433[more]
Rep4.186e-2429.48gene:FBgn0026378 transcript:FBtr0086462[more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdi20.000e+065.99GDP dissociation inhibitor 2 [Source:ZFIN;Acc:ZDB-... [more]
gdi10.000e+062.89GDP dissociation inhibitor 1 [Source:ZFIN;Acc:ZDB-... [more]
gdi22.283e-17664.12GDP dissociation inhibitor 2 [Source:ZFIN;Acc:ZDB-... [more]
zgc:1123349.040e-14755.48zgc:112334 [Source:ZFIN;Acc:ZDB-GENE-050809-120][more]
chm3.096e-1832.91CHM Rab escort protein [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
maats10.000e+064.63MYCBP associated and testis expressed 1 [Source:Xe... [more]
maats11.632e-17464.08MYCBP associated and testis expressed 1 [Source:Xe... [more]
ENSXETT00000042531.19.454e-16959.45rab GDP dissociation inhibitor beta-like [Source:N... [more]
cnnm39.751e-16459.04cyclin and CBS domain divalent metal cation transp... [more]
ENSXETT00000042546.16.925e-16058.73rab GDP dissociation inhibitor beta-like [Source:N... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gdi20.000e+065.53guanosine diphosphate (GDP) dissociation inhibitor... [more]
Gdi10.000e+064.17guanosine diphosphate (GDP) dissociation inhibitor... [more]
Gdi22.135e-15658.73guanosine diphosphate (GDP) dissociation inhibitor... [more]
Gdi21.265e-12865.96guanosine diphosphate (GDP) dissociation inhibitor... [more]
Gdi14.993e-5050.89guanosine diphosphate (GDP) dissociation inhibitor... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50395|GDIB_HUMAN0.000e+065.53Rab GDP dissociation inhibitor beta OS=Homo sapien... [more]
sp|P50399|GDIB_RAT0.000e+065.53Rab GDP dissociation inhibitor beta OS=Rattus norv... [more]
sp|Q61598|GDIB_MOUSE0.000e+065.53Rab GDP dissociation inhibitor beta OS=Mus musculu... [more]
sp|Q5RCE1|GDIB_PONAB0.000e+065.31Rab GDP dissociation inhibitor beta OS=Pongo abeli... [more]
sp|Q6Q7J2|GDIB_PIG0.000e+065.76Rab GDP dissociation inhibitor beta OS=Sus scrofa ... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HMS20.000e+071.36Rab GDP dissociation inhibitor OS=Macrostomum lign... [more]
A0A1I8HNF90.000e+071.14Rab GDP dissociation inhibitor OS=Macrostomum lign... [more]
A0A267EHB90.000e+068.23Rab GDP dissociation inhibitor OS=Macrostomum lign... [more]
Q9Y0A40.000e+065.48Rab GDP dissociation inhibitor OS=Branchiostoma fl... [more]
Q8MY040.000e+065.32Rab GDP dissociation inhibitor OS=Branchiostoma be... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdi20.000e+065.53rab GDP dissociation inhibitor beta-like [Source:N... [more]
ENSAMXT00000035821.10.000e+065.52pep primary_assembly:Astyanax_mexicanus-2.0:15:205... [more]
gdi10.000e+064.22rab GDP dissociation inhibitor alpha [Source:NCBI ... [more]
ENSAMXT00000040009.16.880e-15458.85pep primary_assembly:Astyanax_mexicanus-2.0:15:205... [more]
gdi23.110e-14958.22rab GDP dissociation inhibitor beta-like [Source:N... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001710.10.000e+063.95pep scaffold:Pmarinus_7.0:GL479722:1:16370:1 gene:... [more]
ENSPMAT00000007791.19.192e-9865.79pep scaffold:Pmarinus_7.0:GL476823:1480:6964:-1 ge... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GDI14.278e-13451.03GDP dissociation inhibitor; regulates vesicle traf... [more]
MRS64.590e-1829.55Rab escort protein; forms a complex with the Ras-l... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO443489.197e-17761.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314576.992e-16759.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496862.765e-1933.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdi10.000e+065.56GDP dissociation inhibitor 1 [Source:NCBI gene;Acc... [more]
gdi20.000e+064.07rab GDP dissociation inhibitor beta [Source:NCBI g... [more]
gdi12.067e-15959.11GDP dissociation inhibitor 1 [Source:NCBI gene;Acc... [more]
zgc:1123341.001e-8055.98zgc:112334 [Source:ZFIN;Acc:ZDB-GENE-050809-120][more]
chm6.245e-1730.51rab proteins geranylgeranyltransferase component A... [more]
back to top
BLAST of Rab GDP dissociation inhibitor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000034594.10.000e+0100.00SMESG000034594.1[more]
SMESG000013972.11.892e-1628.15SMESG000013972.1[more]
SMESG000013972.14.859e-1627.87SMESG000013972.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029709 ID=SMED30029709|Name=Rab GDP dissociation inhibitor|organism=Schmidtea mediterranea sexual|type=transcript|length=1757bp
CCACAATACTATTTGTTTAAGTGATCTTTTTATTATTTATTAATTCTGAA
ACTTCAACGATAACAATTTGTAAATAAGGAATATTAATACAATACAATGG
ATGACGAATACGATGTTATTGTTTTAGGAACAGGGCTTAAAGAATGTATT
TTGAGTGGTATGATGTCAGTTGATGGAAAGAAGGTATTGCACATGGATAA
AAATGATTATTATGGAGGTGATAGTGCATCAATCACACCATTAGAAAATT
TGTATAAAATGTTCAATTGTGGAGCTCCACCGGAAAGTCTAGGCCGTGGT
CGTGATTGGAATGTTGATTTAATTCCAAAATTTTTGATGGCGGATGGTGC
ACTTGTAAAAATATTGATCCATACCGGTGTAACTCGTTACCTTGAATTCA
AATCTATTGAAGGAAGCTATGTTTACAAGCAGGGTGCAATATTCAAAGTT
CCATGTGACGAAAAAGAGGCATTAGCAACTAGTCTCATGGGAATGTTTGA
AAAGCGCAGATTTCGAAAACTATTGATGTGGGCCATGTGTTTTGATATTA
CTAAACCCGAAACATACAAGAACGTTCTGACAAATCCAAAAACTGATACT
GTCAGAAAGGTCTACGAACATTTTGGAGTTGATCGAAATACCCAGGATTT
CATTGGTCATGCAATTTGCGTCTATTTGAATGATGATTACATTGATAAAA
GCCCAGCTGAGGAGGCTATTAGAAGAATGCAACTATATAGCCTGAGTTTA
TCGAAATACGGGAAATCACCTTATCTATATCCATTATACGGTCTTGGTGA
GCTCCCCCAGGGATTTGCCCGGCTGAGTGCGGTATTCGGTGGAACGTATA
TGTTGAACAAGCCAGTCGAAAAGATAGTCTATGACGAGCAGGGAAAGGTG
ATTGGAGTGCAAGCAGAAGGGGAAATAGCTCGTTGCAAGGCAGTTATCAG
TGATCCGGGATATGTCAAGGATAGAGTGAGGAAAGTCGGATCGGTAATTC
GAGCCATCTGCATTTTGACACATCCGATTCCGAATACGAACGGAGCTCTG
TCAACTCAAATAATCATTCCTCAGAATCAAGTCAACAGGAACCATGACAT
TTACGTCTGTTGTGTCTCCTATACACATAGCGTTGCGTCCAATCCAAATT
TCATCGCTCTGGTGGCCACAACTGTAGAAACCAAAAATCCAAAAGAAGAA
CTGAAACCGGGACTGAATTTATTGGGTAAAATTGAGCAAATTTTCTACAC
GGAAAGTGATTTATTTGAGCCAATAGATAATGGAGTTGATAGCCGAGTGT
TCATCTCAACCAGCTACGATGCTACAACCCATTTTGAAACGACCTGTCGA
GACGTGCTTGACATCTACAAACGAATCACTGGCGCTGAATTTGATTTCAC
TAAAGCCCATTCGAAAACCGGTCTGTCAGAAGACGAGTAGAAATCAATCA
ATATTGATTACACGTCAAAATGTGATTCGTCGTGATTTATTTACTGTCGG
CTAGTTATTTGACTGCTCTGTGTGTCTGTGAGTATGAGTATGTGTGCAAT
TGTTACAGTTTGACTAATTGTATCTGTGTGTGCCGGAACCGTTGCGGTTA
CGTTATGAACATGTCTCCAAATTATTCTTGATTGTGGCATAATAATTATT
ACTATTATAAAAAATCAATCTGCGGACATGATAGATACTAATAATAATAA
TAATAATAATAATAATAATAATAATAATAATAATAATAATAATAATAATA
ATAATAA
back to top

protein sequence of SMED30029709-orf-1

>SMED30029709-orf-1 ID=SMED30029709-orf-1|Name=SMED30029709-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=448bp
MDDEYDVIVLGTGLKECILSGMMSVDGKKVLHMDKNDYYGGDSASITPLE
NLYKMFNCGAPPESLGRGRDWNVDLIPKFLMADGALVKILIHTGVTRYLE
FKSIEGSYVYKQGAIFKVPCDEKEALATSLMGMFEKRRFRKLLMWAMCFD
ITKPETYKNVLTNPKTDTVRKVYEHFGVDRNTQDFIGHAICVYLNDDYID
KSPAEEAIRRMQLYSLSLSKYGKSPYLYPLYGLGELPQGFARLSAVFGGT
YMLNKPVEKIVYDEQGKVIGVQAEGEIARCKAVISDPGYVKDRVRKVGSV
IRAICILTHPIPNTNGALSTQIIIPQNQVNRNHDIYVCCVSYTHSVASNP
NFIALVATTVETKNPKEELKPGLNLLGKIEQIFYTESDLFEPIDNGVDSR
VFISTSYDATTHFETTCRDVLDIYKRITGAEFDFTKAHSKTGLSEDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR000806RabGDI
IPR018203GDP_dissociation_inhibitor
IPR023753FAD/NAD-binding_dom
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0007264small GTPase mediated signal transduction
GO:0055114oxidation-reduction process
GO:0043547positive regulation of GTPase activity
GO:0050790regulation of catalytic activity
Vocabulary: molecular function
TermDefinition
GO:0005093Rab GDP-dissociation inhibitor activity
GO:0005092GDP-dissociation inhibitor activity
GO:0016491oxidoreductase activity
GO:0005096GTPase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018203GDP dissociation inhibitorPRINTSPR00891RABGDIREPcoord: 86..102
score: 68.91
coord: 135..150
score: 45.09
coord: 214..231
score: 60.71
coord: 6..24
score: 79.51
coord: 232..253
score: 84.9
coord: 24..41
score: 78.77
coord: 69..86
score: 73.02
IPR018203GDP dissociation inhibitorPFAMPF00996GDIcoord: 1..437
e-value: 9.6E-210
score: 696.6
IPR018203GDP dissociation inhibitorPANTHERPTHR11787RAB GDP-DISSOCIATION INHIBITORcoord: 1..439
IPR000806Rab GDI proteinPRINTSPR00892RABGDIcoord: 282..296
score: 52.75
coord: 125..140
score: 74.46
coord: 325..341
score: 63.94
coord: 16..28
score: 78.6
coord: 350..368
score: 50.34
coord: 184..198
score: 56.52
coord: 75..88
score: 73.29
coord: 383..402
score: 40.0
coord: 404..424
score: 75.78
NoneNo IPR availableGENE3DG3DSA:3.30.519.10coord: 58..399
e-value: 1.4E-192
score: 641.8
NoneNo IPR availableGENE3DG3DSA:1.10.405.10coord: 126..233
e-value: 1.4E-192
score: 641.8
NoneNo IPR availablePANTHERPTHR11787:SF8RAB GDP DISSOCIATION INHIBITORcoord: 1..439
NoneNo IPR availableSUPERFAMILYSSF54373FAD-linked reductases, C-terminal domaincoord: 294..391
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 4..429
e-value: 1.4E-192
score: 641.8
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 392..436
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 1..317