SMED30029705

Overview
NameSMED30029705
Smed IDSMED30029705
Length (bp)1574
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30029705 (SMED30029705) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30029705 (SMED30029705) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30029705 (SMED30029705) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30029705 (SMED30029705) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029705

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029705h1SMcG0018484 SmedASXL_015699SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30029705h1SMcG0003471 Contig1356newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029705h1SMcG0003471 Contig1356uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029705h1SMcG0018484 Contig1356newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029705h1SMcG0018484 Contig1356uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30029705h1SMcG0018484 dd_Smed_v4_12459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029705h1SMcG0018484 dd_Smed_v4_12459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029705h1SMcG0018484 dd_Smed_v4_12459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029705h1SMcG0018484 dd_Smed_v4_12459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029705h1SMcG0018484 dd_Smed_v6_12459_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30029705 vs. TrEMBL
Match: A0A419Q0G8 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_3134s PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 6.923e-17
Identity = 102/364 (28.02%), Postives = 155/364 (42.58%), Query Frame = 2
Query:  350 VPSHKMLIENDLMDHPTGTLKKTQLSLSASSLLERK-RSFTRSFIKQTKNRNYSMDTGRP------SSMPKRFSP-------YKLMIVD-EHGQPFYVQKINRDSVKTIISRPDSLTKDNLVLTRPHDRNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXYFASENLYVL-----SQKMHHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANECHL-KAIMKSRDYMPMTN----ELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWF--VLYLIKYVF 1360
            VPS       D +D  +G LK    S  A+S+     RS T SF+     RN   D  +P       + P +  P       +K   +D EHG P         SV + I  PDS             + T + +   CQ+ +LL+IM+IVLG S T  G  LH     L +++C +WA+  L  +G+I   F  EN   L     S  M      L ++    S ++CL+ASI+SG  GN I+   + C + +   ++++    +     E  CC +    D                     N C C +   +   +Y  ++C+YL SS+KD+ +L  +LM V  G  +WF  VL   +YV 
Sbjct:  355 VPSLAHRRHTDGIDPKSGLLKPLVFSRRANSVSSYLLRSPTGSFLISPAERNICSDCHQPLFFCTCGNSPNKCDPTLAPNTSFKPSGIDIEHGSP--------PSVGSPICPPDS-------------QETARGLC-FCQLHVLLVIMQIVLGMSTTALGFYLHWKIPLLPLEECAFWAAIPLSFTGIIGSLFCFENRCQLFNRSYSVSMRRATGILTLI----SCVLCLVASIFSGQKGNVIASSGHPCQIVRPTTQTKNATQSSGLPEYEHQCCSDTSSLDGH-------------------NVCQCLNMRNQVIWSYHKITCRYLISSVKDYLILQSALMAVAAGVCLWFWVVLTEQRYVL 673          
BLAST of SMED30029705 vs. TrEMBL
Match: A0A4S2MH70 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000928 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.086e-16
Identity = 98/363 (27.00%), Postives = 156/363 (42.98%), Query Frame = 2
Query:  350 VPSHKMLIENDLMDHPTGTLKKTQLSLSASSLLERK-RSFTRSFIKQTKNRNYSMDTGR----------PSSMPKRFSP---YKLMIVD-EHGQPFYVQKINRDSVKTIISRPDSLTKDNLVLTRPHDRNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXYFASENLYVLSQKMHHIYTFLVILFSG----TSSIICLMASIYSGVHGNWISFHANECH-LKAIMKSRDYMPMTN----ELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWF--VLYLIKYVF 1360
            VPS       D +D   G LK    S  A+S+     RS T SF+     RN   D  +          P+ +    +P   ++   +D E G P         SV + +  PDS             + T + +   CQ+ +LL+IM+IVLG S T  G  LH     L +++C +WA+  L  +G+I   F  EN     Q+ +  Y+  +   +G     S ++CL+ASI+SG  GN I+   + C  ++   ++++    +     E  CC +  G D                     N C C +   +   +Y  ++C+YL SS+KD+ +L  +LM V  G  +WF  VL   +YV 
Sbjct:  355 VPSLAHRRHTDGIDPKPGLLKPLVFSRRANSVSSYLLRSPTGSFLISPAERNICSDCHQSLFFCTCGTSPNKLDPTLAPNTSFRFPGIDIEQGSP--------PSVGSPVCPPDS-------------QETARGLC-FCQLHVLLVIMQIVLGVSTTALGFYLHWKIPLLPLEECAFWAAIPLSFTGMIGSLFCFEN---RCQRFNRSYSVSMRRATGILSLISCVLCLVASIFSGQKGNVIATSGHPCQSIRLTTQTKNATQSSGLPEYEHQCCSDTSGLDGH-------------------NVCQCLNMRNQVIWSYHKITCRYLISSVKDYLILQSALMAVAAGVCLWFWVVLTEQRYVL 673          
BLAST of SMED30029705 vs. TrEMBL
Match: A0A4E0RIR9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000341 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.641e-14
Identity = 66/219 (30.14%), Postives = 113/219 (51.60%), Query Frame = 2
Query:  716 LCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXYFASENLYVLSQKMHHIYTFLVILFSGT----SSIICLMASIYSGVHGNWISFHANECHLKAIMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNS---CGCFDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIK 1351
             CQ+ +LL+ M+I LG + T  GL L      L +++C +WA+  + ++GL   YF  +    +S+K   I T  +   +G     S I+CL+ASI+SG  G+ I+ +  +C    I  +  Y    + +    N     ++K  ++ G  +    +  D  S   C CF+   +   +Y G++C+YLFSS+KD+ +L  +LM VG G  +WF + L +
Sbjct:  537 FCQLIVLLVSMQISLGLAATGLGLYLRWRVPLLPLEECSFWAALPITITGLFGTYFCFQRR--ISRKNPQI-TLAIRRIAGALSLISCILCLVASIFSGQKGSLIATYGTDC----IPSNPLYSIHNSSIKNNDNSNNNQEKKTDYDLGFEQQCCIDGVDRMSEPLCQCFNVRNQLMWSYRGIACRYLFSSVKDYLILQSALMAVGTGVCLWFWVVLTE 748          
BLAST of SMED30029705 vs. TrEMBL
Match: A0A504YEC9 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_08303 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.824e-14
Identity = 67/235 (28.51%), Postives = 111/235 (47.23%), Query Frame = 2
Query:  716 LCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXYFASENLYVLSQKMHHIYTFLVILFSGT----SSIICLMASIYSGVHGNWISFHANEC-------------------HLKAIMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIK 1351
             CQ+ +LL+ M+I LG + T  GL L      L +++C +WA+  + ++G I  YF  +    +S+K   I T  +   +G     S I+CL+ASI+SG  G+ I+ +  +C                      ++ +  DY  +  E  CC +  G D+  E                   C CF+   +   +Y G++C+YLFSS+KD+ +L  +LM VG G  +WF + L +
Sbjct:  538 FCQLIVLLVSMQISLGLAATGLGLYLRWRVPLLPLEECSFWAALPISITGFIGTYFCFQRR--ISRKNPQI-TLAIRRIAGVLSLISCILCLVASIFSGQKGSLIATYGTDCIPSNPLYSVHNSSIKNNNNSNNSLERKPDYD-LGFEQQCCID--GVDRMSEPL-----------------CQCFNVRNQLMWSYRGIACRYLFSSVKDYLILQSALMAVGTGVCLWFWVVLTE 749          
BLAST of SMED30029705 vs. TrEMBL
Match: A0A1S8X932 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_01139 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.406e-13
Identity = 68/244 (27.87%), Postives = 104/244 (42.62%), Query Frame = 2
Query:  716 LCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXY--------------FASENLYVLSQKMHHIYTFLVI-LFSGTSSIICLMASIYSGVHGNWISFHANEC-------HLKAIMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWF--VLYLIKYVFNRHSP 1375
             CQ+ +LL+IM+IVLG S T  G  LH     L +++C +WA+       +   Y              F  EN   L  + H +       + +  S ++CL+ASI+SG  GN I+   + C       H K + +S   +P   E  CC +    D                     N C C +   +   +Y  ++C+YL SS+KD+ +L  +LM V  G  +WF  VL   +YV     P
Sbjct:  470 FCQLHVLLVIMQIVLGMSTTALGFYLHWKIPLLPLEECAFWAAIPGTNLLVCFSYLTFQLSFTGIIGSVFCFENRCQLFNRSHSVSMRRATGILTLISCVLCLVASIFSGQKGNVIASSGHPCQVVRPTTHTKNVTQSL-ALP-EYEHQCCSDTSSLDGH-------------------NVCQCLNMRNQVIWSYHKITCRYLISSVKDYLILQSALMAVAAGVCLWFWVVLTEQRYVLGAIPP 692          
BLAST of SMED30029705 vs. Planmine SMEST
Match: SMESG000061752.1 (SMESG000061752.1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 453/455 (99.56%), Postives = 454/455 (99.78%), Query Frame = 2
Query:  152 MDFPVIVIDSNSNSIKDSEEGIDYLRPSVKDDYNFLVKNSLQIQSKSNDDGDSGIHGSSEVFGPSPVPSHKMLIENDLMDHPTGTLKKTQLSLSASSLLERKRSFTRSFIKQTKNRNYSMDTGRPSSMPKRFSPYKLMIVDEHGQPFYVQKINRDSVKTIISRPDSLTKDNLVLTRPHDRNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXYFASENLYVLSQKMHHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANECHLKAIMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIKYVFNRHSPNATELKRERSRVLSIADHDKADSDIYQKHLPSPLIPVASKKGWHNPC 1516
            MDFPVIVIDSNSNSIKDSEEGIDYLRPSVKDDYNFLVKNSLQIQSKSNDDGDSGIHGSSEVFGPSPVPSHKMLIENDLMDHPTGTLKKTQLSLSASSLLERKRSFTRSFIKQTKNRNYSMDTGRPSSMPKRFSPYKLMIVDEHGQPFYVQKINRDSVKTIISRPDSLTKDNLVLTRPHDRNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWASSIL+VSGLISIYFASENLYVLSQKMHHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANECHLKAIMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPER YVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIKYVFNRHSPNATELKRERSRVLSIADHDKADSDIYQKHLPSPLIPVASKKGWHNPC
Sbjct:    1 MDFPVIVIDSNSNSIKDSEEGIDYLRPSVKDDYNFLVKNSLQIQSKSNDDGDSGIHGSSEVFGPSPVPSHKMLIENDLMDHPTGTLKKTQLSLSASSLLERKRSFTRSFIKQTKNRNYSMDTGRPSSMPKRFSPYKLMIVDEHGQPFYVQKINRDSVKTIISRPDSLTKDNLVLTRPHDRNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWASSILMVSGLISIYFASENLYVLSQKMHHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANECHLKAIMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPERIYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIKYVFNRHSPNATELKRERSRVLSIADHDKADSDIYQKHLPSPLIPVASKKGWHNPC 455          
BLAST of SMED30029705 vs. Planmine SMEST
Match: SMESG000033408.1 (SMESG000033408.1)

HSP 1 Score: 132.494 bits (332), Expect = 2.405e-33
Identity = 132/459 (28.76%), Postives = 212/459 (46.19%), Query Frame = 2
Query:  152 MDFPVIVIDSNSNSIKDSEEGIDYLRPSVKDDYNFLVKNSLQIQSKSN-DDGDSGIHGSSEVFGPSPVPSHKMLIENDLMDHPTGTLKKTQLSLSASSLLERKRSFTRSFIKQTKNRNYSMDTGRPSSMPKRFSPY--KLMIVDEHGQPFYVQKINRDSVK----TIISRPDSLTKDNLVLTRPHDRNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXY-FASENLYVLSQKMHHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANECHLKAIMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSAL----KP--ERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIKYVFNRHSPNATELKRERSRVLSIADHDKADSDIYQKHLPSPLIPV 1486
            M  P I+IDS++ S   + +   Y    +K +     + S  +  KSN DD DSGIH S+++F P                  +  L   +LSL      + K+    S ++       S+DT R         P   +      H +  +      DS+K     I  R + + K  +  T+P   + +     LC+I++LL+ MKI+LGS++T  G+ L   SKS+++KDC +WA   LL SGL  ++ +   N      K+ ++ T    + S   SI+CL++SI+SGVHGNWIS H++ C  K      D +     L CC+         +I   GI      N + +++C C ++      KP    TY  L+C+Y+FS+LKD+ +L C+LMGVG G  +W    L++    R   + +   + RS   +  D +            SP+IP+
Sbjct:   15 MKMPEIIIDSDNESTTKNYDNESYNNCFLKANR----EESNHLTCKSNLDDADSGIHESNDIFLPGI----------------SSVLHPNRLSLR-----DMKKRSNLSEVRSYSTNCLSVDTNRYKEGLGMIDPRLCRNCSTKSHSKKQF------DSIKREPNEIPYRINEIVK--ISETKPKINSRDSLQHRLCKIRVLLVCMKILLGSTMTGLGIFLLMASKSIKVKDCAFWAGGPLLFSGLFEVFIYNWRNKLRKRMKICYLMTIACGVISFICSILCLLSSIFSGVHGNWISGHSDNCLSKDDNNQNDML-----LACCY---------DIHTKGI------NSSINSTCFCREARENIYSKPIITMTYENLNCRYVFSALKDYLILQCALMGVGSGVCLW----LLQMTIQRLIQDCSTTSQTRSGQPNTDDQNSVGQ--------SPVIPL 408          
BLAST of SMED30029705 vs. Planmine SMEST
Match: SMESG000033408.1 (SMESG000033408.1)

HSP 1 Score: 132.109 bits (331), Expect = 2.442e-33
Identity = 132/459 (28.76%), Postives = 212/459 (46.19%), Query Frame = 2
Query:  152 MDFPVIVIDSNSNSIKDSEEGIDYLRPSVKDDYNFLVKNSLQIQSKSN-DDGDSGIHGSSEVFGPSPVPSHKMLIENDLMDHPTGTLKKTQLSLSASSLLERKRSFTRSFIKQTKNRNYSMDTGRPSSMPKRFSPY--KLMIVDEHGQPFYVQKINRDSVK----TIISRPDSLTKDNLVLTRPHDRNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXY-FASENLYVLSQKMHHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANECHLKAIMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSAL----KP--ERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIKYVFNRHSPNATELKRERSRVLSIADHDKADSDIYQKHLPSPLIPV 1486
            M  P I+IDS++ S   + +   Y    +K +     + S  +  KSN DD DSGIH S+++F P                  +  L   +LSL      + K+    S ++       S+DT R         P   +      H +  +      DS+K     I  R + + K  +  T+P   + +     LC+I++LL+ MKI+LGS++T  G+ L   SKS+++KDC +WA   LL SGL  ++ +   N      K+ ++ T    + S   SI+CL++SI+SGVHGNWIS H++ C  K      D +     L CC+         +I   GI      N + +++C C ++      KP    TY  L+C+Y+FS+LKD+ +L C+LMGVG G  +W    L++    R   + +   + RS   +  D +            SP+IP+
Sbjct:   14 MKMPEIIIDSDNESTTKNYDNESYNNCFLKANR----EESNHLTCKSNLDDADSGIHESNDIFLPGI----------------SSVLHPNRLSLR-----DMKKRSNLSEVRSYSTNCLSVDTNRYKEGLGMIDPRLCRNCSTKSHSKKQF------DSIKREPNEIPYRINEIVK--ISETKPKINSRDSLQHRLCKIRVLLVCMKILLGSTMTGLGIFLLMASKSIKVKDCAFWAGGPLLFSGLFEVFIYNWRNKLRKRMKICYLMTIACGVISFICSILCLLSSIFSGVHGNWISGHSDNCLSKDDNNQNDML-----LACCY---------DIHTKGI------NSSINSTCFCREARENIYSKPIITMTYENLNCRYVFSALKDYLILQCALMGVGSGVCLW----LLQMTIQRLIQDCSTTSQTRSGQPNTDDQNSVGQ--------SPVIPL 407          
BLAST of SMED30029705 vs. Planmine SMEST
Match: SMESG000071184.1 (SMESG000071184.1)

HSP 1 Score: 108.612 bits (270), Expect = 1.169e-25
Identity = 86/274 (31.39%), Postives = 136/274 (49.64%), Query Frame = 2
Query:  689 RNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXYFASENLYVLSQKM-HHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANEC----HLKAIMKSRDYMPMTNELNCC--FNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIKYVFNRHSPN--ATELKRERSRVLSIADHDKADSDIYQKHLPSPLIP 1483
            ++ EK   ++C+I +LL++M++ LGSS+   GL LH  S +L +KDC YWA+  LL++G + +YF S    V  + +   I       FS   S++C +AS +SG HGNW++++   C    H  +   S    P T   +CC     P     K I   G  R  I N + S S   ++    P  +Y  ++C Y+FSSLKD+ +L C+L  V  G  IW  + +     +  + N   T     R R+ ++ D    D+D    HL +  +P
Sbjct:   97 QSKEKLELHICRINVLLVMMQLGLGSSMAALGLYLHNLSPALTLKDCPYWAAFPLLLTGFLGLYFCSAEQKVFKKDLVSMIVRNTSAAFSIVCSLLCSLASGFSGHHGNWLAYYCKVCPANLHETSEKHSIHNHPTT---SCCQTLQIP-----KLICECGYYRE-ITNHSISISYNKWN----PLISYHNVNCYYVFSSLKDYLILQCALYAVAAGVSIWLSVLIWSQRVHDQNKNIIITRNSYARRRIKAMQDFINEDTDEISDHLNNNSVP 357          
BLAST of SMED30029705 vs. Planmine SMEST
Match: SMESG000071184.1 (SMESG000071184.1)

HSP 1 Score: 108.612 bits (270), Expect = 1.197e-25
Identity = 86/274 (31.39%), Postives = 136/274 (49.64%), Query Frame = 2
Query:  689 RNTEKFVSNLCQIQLLLIIMKIVLGSSITIFGLNLHGFSKSLQMKDCGYWAXXXXXXXXXXXXYFASENLYVLSQKM-HHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANEC----HLKAIMKSRDYMPMTNELNCC--FNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGCFDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIKYVFNRHSPN--ATELKRERSRVLSIADHDKADSDIYQKHLPSPLIP 1483
            ++ EK   ++C+I +LL++M++ LGSS+   GL LH  S +L +KDC YWA+  LL++G + +YF S    V  + +   I       FS   S++C +AS +SG HGNW++++   C    H  +   S    P T   +CC     P     K I   G  R  I N + S S   ++    P  +Y  ++C Y+FSSLKD+ +L C+L  V  G  IW  + +     +  + N   T     R R+ ++ D    D+D    HL +  +P
Sbjct:   94 QSKEKLELHICRINVLLVMMQLGLGSSMAALGLYLHNLSPALTLKDCPYWAAFPLLLTGFLGLYFCSAEQKVFKKDLVSMIVRNTSAAFSIVCSLLCSLASGFSGHHGNWLAYYCKVCPANLHETSEKHSIHNHPTT---SCCQTLQIP-----KLICECGYYRE-ITNHSISISYNKWN----PLISYHNVNCYYVFSSLKDYLILQCALYAVAAGVSIWLSVLIWSQRVHDQNKNIIITRNSYARRRIKAMQDFINEDTDEISDHLNNNSVP 354          
The following BLAST results are available for this feature:
BLAST of SMED30029705 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419Q0G86.923e-1728.02Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A4S2MH707.086e-1627.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0RIR93.641e-1430.14Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A504YEC94.824e-1428.51Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A1S8X9324.406e-1327.87Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of SMED30029705 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029705 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061752.10.000e+099.56SMESG000061752.1[more]
SMESG000033408.12.405e-3328.76SMESG000033408.1[more]
SMESG000033408.12.442e-3328.76SMESG000033408.1[more]
SMESG000071184.11.169e-2531.39SMESG000071184.1[more]
SMESG000071184.11.197e-2531.39SMESG000071184.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029705 ID=SMED30029705|Name=SMED30029705|organism=Schmidtea mediterranea sexual|type=transcript|length=1574bp
GGATTTCAAAAAAATTCTCTTCCCAATTATGGAAATCTTGCTACGTATTC
TGTGGGTAATTTTATAAGAAAACTTTAACATAAAATATTTTCAAAGCATC
GGTTTCATCGAAGACGCGACACGAGAGAAACTTGATTGAAATTCGTGAAA
AATGGATTTTCCCGTTATTGTAATCGATTCGAATTCCAATTCCATCAAAG
ACAGCGAAGAAGGAATCGATTATTTGCGACCGTCAGTAAAGGACGATTAT
AATTTCTTGGTGAAAAACTCTTTGCAAATACAATCAAAATCAAACGATGA
TGGAGATTCAGGAATCCACGGATCAAGTGAGGTGTTCGGTCCGAGTCCGG
TTCCCAGTCACAAAATGCTCATTGAAAACGATTTGATGGATCATCCAACT
GGAACTCTAAAGAAAACGCAATTAAGTTTATCGGCTAGCAGTTTGTTGGA
GAGAAAACGAAGTTTTACTCGGTCATTCATTAAGCAAACGAAAAATAGAA
ACTATTCCATGGACACTGGTAGACCATCAAGTATGCCAAAACGATTCAGT
CCATATAAGCTTATGATAGTTGATGAGCATGGTCAGCCATTCTACGTACA
GAAAATAAACAGAGATTCAGTAAAGACTATAATTAGTCGACCGGATAGTT
TGACAAAAGACAACTTGGTGTTAACACGTCCTCATGATCGGAATACCGAG
AAATTCGTCAGCAATCTTTGTCAAATCCAACTTCTTTTAATTATCATGAA
AATAGTTCTTGGAAGTTCAATCACAATTTTTGGTTTAAATCTTCATGGAT
TTTCTAAGTCTCTCCAAATGAAAGATTGCGGCTATTGGGCATCATCCATA
TTACTGGTTTCTGGATTGATTTCAATTTATTTTGCCAGTGAAAATCTGTA
CGTTCTTAGTCAAAAAATGCATCATATCTATACGTTTTTAGTAATTTTAT
TCTCCGGTACCTCTTCAATAATCTGTCTGATGGCCAGCATTTATTCCGGC
GTCCATGGCAACTGGATATCATTTCACGCAAACGAATGCCATCTTAAAGC
AATCATGAAATCAAGGGATTATATGCCCATGACAAACGAATTAAATTGTT
GTTTTAATTTCCCTGGAAAAGATAAACAAAAGGAAATATTCAATTATGGA
ATTATCAGAAATTTAATTGACAATCAAACAGACAGCAACTCGTGTGGCTG
TTTTGATTCAGCTTTGAAACCTGAAAGAACTTATGTTGGCTTGAGTTGCA
AATATTTGTTTTCATCTTTAAAAGATCATTTTGTGCTGATTTGCTCCTTA
ATGGGGGTTGGATGTGGCTGTGAAATTTGGTTTGTTCTTTATTTGATAAA
ATACGTTTTCAATCGTCATTCTCCGAATGCGACTGAACTGAAAAGAGAGC
GATCTCGAGTTCTGTCGATAGCAGACCATGATAAGGCTGACAGTGACATT
TATCAAAAGCATCTTCCATCTCCGTTGATACCAGTGGCAAGCAAGAAGGG
TTGGCATAATCCATGTTGACAAATATAATTTTGATTCATCACATGTATGC
AGTAGATTTACTGTTTAATTTCAG
back to top

protein sequence of SMED30029705-orf-1

>SMED30029705-orf-1 ID=SMED30029705-orf-1|Name=SMED30029705-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=456bp
MDFPVIVIDSNSNSIKDSEEGIDYLRPSVKDDYNFLVKNSLQIQSKSNDD
GDSGIHGSSEVFGPSPVPSHKMLIENDLMDHPTGTLKKTQLSLSASSLLE
RKRSFTRSFIKQTKNRNYSMDTGRPSSMPKRFSPYKLMIVDEHGQPFYVQ
KINRDSVKTIISRPDSLTKDNLVLTRPHDRNTEKFVSNLCQIQLLLIIMK
IVLGSSITIFGLNLHGFSKSLQMKDCGYWASSILLVSGLISIYFASENLY
VLSQKMHHIYTFLVILFSGTSSIICLMASIYSGVHGNWISFHANECHLKA
IMKSRDYMPMTNELNCCFNFPGKDKQKEIFNYGIIRNLIDNQTDSNSCGC
FDSALKPERTYVGLSCKYLFSSLKDHFVLICSLMGVGCGCEIWFVLYLIK
YVFNRHSPNATELKRERSRVLSIADHDKADSDIYQKHLPSPLIPVASKKG
WHNPC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 259..281
NoneNo IPR availableTMHMMTMhelixcoord: 227..246
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 377..399