patched-like protein

Overview
Namepatched-like protein (ACZ64511.1)
Smed IDSMED30029695
Length (bp)4428
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of patched-like protein (SMED30029695) t-SNE clustered cells

Violin plots show distribution of expression levels for patched-like protein (SMED30029695) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of patched-like protein (SMED30029695) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for patched-like protein (SMED30029695) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of patched-like protein vs. Ensembl Human
Match: PTCH1 (patched 1 [Source:HGNC Symbol;Acc:HGNC:9585])

HSP 1 Score: 222.246 bits (565), Expect = 7.789e-58
Identity = 238/948 (25.11%), Postives = 428/948 (45.15%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKPSYESIV-NEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINP------VDLSPRSE------------------PSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP    N+   KP   ++V N GC  +      + + + +G   K++ G       LQT   L +   + E  K    ++++ W E K   ++  W              R Y+E +    A+  +Q++   SF   T + +  +      D +++   + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC     T    +      P+ Y     ++         S  F       + + V    E +P          PRSE                   STS +  L S   ++    LEP   K       W       K +   ++    ++ VI + L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN    K WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR+I S YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  154 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAW-------------QRTYVEVVHQSVAQNSTQKVL--SFTTTTLDDILKSF----SDVSVIR--VASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCF----TSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYT-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1039          
BLAST of patched-like protein vs. Ensembl Human
Match: PTCH1 (patched 1 [Source:HGNC Symbol;Acc:HGNC:9585])

HSP 1 Score: 222.246 bits (565), Expect = 7.789e-58
Identity = 238/948 (25.11%), Postives = 428/948 (45.15%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKPSYESIV-NEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINP------VDLSPRSE------------------PSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP    N+   KP   ++V N GC  +      + + + +G   K++ G       LQT   L +   + E  K    ++++ W E K   ++  W              R Y+E +    A+  +Q++   SF   T + +  +      D +++   + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC     T    +      P+ Y     ++         S  F       + + V    E +P          PRSE                   STS +  L S   ++    LEP   K       W       K +   ++    ++ VI + L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN    K WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR+I S YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  154 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAW-------------QRTYVEVVHQSVAQNSTQKVL--SFTTTTLDDILKSF----SDVSVIR--VASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCF----TSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYT-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1039          
BLAST of patched-like protein vs. Ensembl Human
Match: PTCH1 (patched 1 [Source:HGNC Symbol;Acc:HGNC:9585])

HSP 1 Score: 222.246 bits (565), Expect = 7.965e-58
Identity = 238/948 (25.11%), Postives = 428/948 (45.15%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKPSYESIV-NEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINP------VDLSPRSE------------------PSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP    N+   KP   ++V N GC  +      + + + +G   K++ G       LQT   L +   + E  K    ++++ W E K   ++  W              R Y+E +    A+  +Q++   SF   T + +  +      D +++   + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC     T    +      P+ Y     ++         S  F       + + V    E +P          PRSE                   STS +  L S   ++    LEP   K       W       K +   ++    ++ VI + L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN    K WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR+I S YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  219 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAW-------------QRTYVEVVHQSVAQNSTQKVL--SFTTTTLDDILKSF----SDVSVIR--VASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCF----TSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYT-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1104          
BLAST of patched-like protein vs. Ensembl Human
Match: PTCH1 (patched 1 [Source:HGNC Symbol;Acc:HGNC:9585])

HSP 1 Score: 221.861 bits (564), Expect = 8.496e-58
Identity = 238/948 (25.11%), Postives = 428/948 (45.15%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKPSYESIV-NEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINP------VDLSPRSE------------------PSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP    N+   KP   ++V N GC  +      + + + +G   K++ G       LQT   L +   + E  K    ++++ W E K   ++  W              R Y+E +    A+  +Q++   SF   T + +  +      D +++   + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC     T    +      P+ Y     ++         S  F       + + V    E +P          PRSE                   STS +  L S   ++    LEP   K       W       K +   ++    ++ VI + L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN    K WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR+I S YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:   69 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAW-------------QRTYVEVVHQSVAQNSTQKVL--SFTTTTLDDILKSF----SDVSVIR--VASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCF----TSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYT-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 954          
BLAST of patched-like protein vs. Ensembl Human
Match: PTCH1 (patched 1 [Source:HGNC Symbol;Acc:HGNC:9585])

HSP 1 Score: 221.861 bits (564), Expect = 8.496e-58
Identity = 238/948 (25.11%), Postives = 428/948 (45.15%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKPSYESIV-NEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINP------VDLSPRSE------------------PSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP    N+   KP   ++V N GC  +      + + + +G   K++ G       LQT   L +   + E  K    ++++ W E K   ++  W              R Y+E +    A+  +Q++   SF   T + +  +      D +++   + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC     T    +      P+ Y     ++         S  F       + + V    E +P          PRSE                   STS +  L S   ++    LEP   K       W       K +   ++    ++ VI + L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN    K WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR+I S YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:   69 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAW-------------QRTYVEVVHQSVAQNSTQKVL--SFTTTTLDDILKSF----SDVSVIR--VASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCF----TSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYT-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 954          
BLAST of patched-like protein vs. Ensembl Celegans
Match: ptc-1 (pep chromosome:WBcel235:II:7895625:7900484:1 gene:WBGene00004208.1 transcript:ZK675.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ptc-1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.224e-15
Identity = 109/478 (22.80%), Postives = 188/478 (39.33%), Query Frame = 1
Query: 2314 GLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTK--EFEYTNNQDILLQLHQEIDNLHHVALLENG----KFWLSSFIGWLERIQSDFDRDV-KNKLILANGT-WSRNASKNGLLVMTLMVQDGESIN-YKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTV-----DNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEEL-DFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMF-VISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSD 3693
            GL    + P  +    +++   + F F     V K    +Y + Q  +    Q I +  +V   +N     K+WL     WL  IQ  FD +V K    L +GT    N S++  L   LM   G       ++   RLV  +G ++   FY +L  W ++  + Y       +P    + +     +NF P+                    PL +    ++  G +    + D +K +RS+  R+T+   LP  P G  FT  EQYL L   L+    I+ I +F VIS+L  N + A ++  +L   +      FM L  I LN  S V  + + G+G  F++ ++VS++                      ++  T ++RT                          V+R F  VP     FST LG+  +  ++  F+ + F ++    +   ++N   L P+   +  P+ +
Sbjct:  786 GLELGDVLPEHTAPAQFLRARDKYFSFYPMFAVIKGPNIDYAHQQRQIDNYRQSIGSSKYVIKNKNEEPSEKYWLGLMRDWLISIQRGFDEEVAKGSFNLTSGTVIGSNVSEDARLAHALMCSHGSLFGCAGRVGKIRLVDASGIINSDGFYNYLTAWFNVDHMMYYVSQASFFPTPPKWELSKNHTENFIPAA------------------EPLAYSQIPFYLTGLTDTAVIVDAIKDIRSVCERFTDQ-GLPNFPQGIAFTFWEQYLFLTGNLMQAISIITISVFCVISVLLFNPWAALMVVCILGIMTCELAG-FMGLVGIKLNPVSAVTLITAVGIGVEFTVHVVVSFL----------------------TALGTRSQRTSS-----------------------AVDRVF--VPVIHGSFSTLLGILMLGFSEFEFVVKYFFIVMTALICIGIINGLILLPVLLSWFGPRRE 1196          

HSP 2 Score: 69.3218 bits (168), Expect = 2.426e-11
Identity = 41/140 (29.29%), Postives = 72/140 (51.43%), Query Frame = 1
Query: 1522 FNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPR 1941
            FNA TTQ+VPF+ +G+G++ + +L   Y    D+ +    H            +IL  S +  L  L+  T++P+P +R+FC Q   ++         +YP ++ +D  R+++ R DL+CCL      +   ESYS + +
Sbjct:  573 FNAATTQIVPFLTLGIGVDNMFMLLHNYR---DVVKLAGGHAEMAILMRETGMSILCTSINNILSFLTG-TLLPIPALRSFCAQSSILLTFNFIAILTIYPAIISIDLRRKKAQRRDLVCCLYG----DTREESYSMISK 704          

HSP 3 Score: 68.5514 bits (166), Expect = 3.829e-11
Identity = 54/229 (23.58%), Postives = 91/229 (39.74%), Query Frame = 1
Query:  361 VEFETDVMNLWIYNSSRLHNETSFISRV----------SGSKIE-----SGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRS--FTFSDFCQRVQLPKLHYLHDRS-LRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDE--------SRSIKIDWKSFN---ISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLK 960
            V  ETD++ LW+    RL  E +F+  +          SG ++       G  + ++Q   +    +         +       +         ++ SD C +   P +      S L   ++ ++PC  I+P++CFWEGSK L  +     S+           S    I W  F+   +  E   SF   S+Y F    F+ AG+  G++ +PC+D  D  CP   K
Sbjct:   13 VHIETDIVKLWVAQGGRLDEELNFLPNIKEAMRNVTGDSGPELPRENGLGGGYQVLIQTPEYEGQDALAAGPLLKHVEIMKHIASFNVSVHGVDWSLSDICFKPAPPSVAADSAASSLGDVIDKIVPCIWITPIDCFWEGSKALGPHPSLPKSSLGPLGMLLSSLSDGDMIRWSDFDPIAVIDEIHRSFNLGSHYTF----FERAGVSHGYMDRPCIDPLDPECPPMAK 237          
BLAST of patched-like protein vs. Ensembl Celegans
Match: ptc-1 (pep chromosome:WBcel235:II:7895625:7900484:1 gene:WBGene00004208.1 transcript:ZK675.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ptc-1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.224e-15
Identity = 109/478 (22.80%), Postives = 188/478 (39.33%), Query Frame = 1
Query: 2314 GLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTK--EFEYTNNQDILLQLHQEIDNLHHVALLENG----KFWLSSFIGWLERIQSDFDRDV-KNKLILANGT-WSRNASKNGLLVMTLMVQDGESIN-YKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTV-----DNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEEL-DFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMF-VISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSD 3693
            GL    + P  +    +++   + F F     V K    +Y + Q  +    Q I +  +V   +N     K+WL     WL  IQ  FD +V K    L +GT    N S++  L   LM   G       ++   RLV  +G ++   FY +L  W ++  + Y       +P    + +     +NF P+                    PL +    ++  G +    + D +K +RS+  R+T+   LP  P G  FT  EQYL L   L+    I+ I +F VIS+L  N + A ++  +L   +      FM L  I LN  S V  + + G+G  F++ ++VS++                      ++  T ++RT                          V+R F  VP     FST LG+  +  ++  F+ + F ++    +   ++N   L P+   +  P+ +
Sbjct:  786 GLELGDVLPEHTAPAQFLRARDKYFSFYPMFAVIKGPNIDYAHQQRQIDNYRQSIGSSKYVIKNKNEEPSEKYWLGLMRDWLISIQRGFDEEVAKGSFNLTSGTVIGSNVSEDARLAHALMCSHGSLFGCAGRVGKIRLVDASGIINSDGFYNYLTAWFNVDHMMYYVSQASFFPTPPKWELSKNHTENFIPAA------------------EPLAYSQIPFYLTGLTDTAVIVDAIKDIRSVCERFTDQ-GLPNFPQGIAFTFWEQYLFLTGNLMQAISIITISVFCVISVLLFNPWAALMVVCILGIMTCELAG-FMGLVGIKLNPVSAVTLITAVGIGVEFTVHVVVSFL----------------------TALGTRSQRTSS-----------------------AVDRVF--VPVIHGSFSTLLGILMLGFSEFEFVVKYFFIVMTALICIGIINGLILLPVLLSWFGPRRE 1196          

HSP 2 Score: 69.3218 bits (168), Expect = 2.426e-11
Identity = 41/140 (29.29%), Postives = 72/140 (51.43%), Query Frame = 1
Query: 1522 FNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPR 1941
            FNA TTQ+VPF+ +G+G++ + +L   Y    D+ +    H            +IL  S +  L  L+  T++P+P +R+FC Q   ++         +YP ++ +D  R+++ R DL+CCL      +   ESYS + +
Sbjct:  573 FNAATTQIVPFLTLGIGVDNMFMLLHNYR---DVVKLAGGHAEMAILMRETGMSILCTSINNILSFLTG-TLLPIPALRSFCAQSSILLTFNFIAILTIYPAIISIDLRRKKAQRRDLVCCLYG----DTREESYSMISK 704          

HSP 3 Score: 68.5514 bits (166), Expect = 3.829e-11
Identity = 54/229 (23.58%), Postives = 91/229 (39.74%), Query Frame = 1
Query:  361 VEFETDVMNLWIYNSSRLHNETSFISRV----------SGSKIE-----SGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRS--FTFSDFCQRVQLPKLHYLHDRS-LRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDE--------SRSIKIDWKSFN---ISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLK 960
            V  ETD++ LW+    RL  E +F+  +          SG ++       G  + ++Q   +    +         +       +         ++ SD C +   P +      S L   ++ ++PC  I+P++CFWEGSK L  +     S+           S    I W  F+   +  E   SF   S+Y F    F+ AG+  G++ +PC+D  D  CP   K
Sbjct:   13 VHIETDIVKLWVAQGGRLDEELNFLPNIKEAMRNVTGDSGPELPRENGLGGGYQVLIQTPEYEGQDALAAGPLLKHVEIMKHIASFNVSVHGVDWSLSDICFKPAPPSVAADSAASSLGDVIDKIVPCIWITPIDCFWEGSKALGPHPSLPKSSLGPLGMLLSSLSDGDMIRWSDFDPIAVIDEIHRSFNLGSHYTF----FERAGVSHGYMDRPCIDPLDPECPPMAK 237          
BLAST of patched-like protein vs. Ensembl Celegans
Match: ptc-1 (pep chromosome:WBcel235:II:7893229:7900484:1 gene:WBGene00004208.1 transcript:ZK675.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ptc-1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.272e-15
Identity = 109/478 (22.80%), Postives = 188/478 (39.33%), Query Frame = 1
Query: 2314 GLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTK--EFEYTNNQDILLQLHQEIDNLHHVALLENG----KFWLSSFIGWLERIQSDFDRDV-KNKLILANGT-WSRNASKNGLLVMTLMVQDGESIN-YKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTV-----DNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEEL-DFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMF-VISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSD 3693
            GL    + P  +    +++   + F F     V K    +Y + Q  +    Q I +  +V   +N     K+WL     WL  IQ  FD +V K    L +GT    N S++  L   LM   G       ++   RLV  +G ++   FY +L  W ++  + Y       +P    + +     +NF P+                    PL +    ++  G +    + D +K +RS+  R+T+   LP  P G  FT  EQYL L   L+    I+ I +F VIS+L  N + A ++  +L   +      FM L  I LN  S V  + + G+G  F++ ++VS++                      ++  T ++RT                          V+R F  VP     FST LG+  +  ++  F+ + F ++    +   ++N   L P+   +  P+ +
Sbjct:  928 GLELGDVLPEHTAPAQFLRARDKYFSFYPMFAVIKGPNIDYAHQQRQIDNYRQSIGSSKYVIKNKNEEPSEKYWLGLMRDWLISIQRGFDEEVAKGSFNLTSGTVIGSNVSEDARLAHALMCSHGSLFGCAGRVGKIRLVDASGIINSDGFYNYLTAWFNVDHMMYYVSQASFFPTPPKWELSKNHTENFIPAA------------------EPLAYSQIPFYLTGLTDTAVIVDAIKDIRSVCERFTDQ-GLPNFPQGIAFTFWEQYLFLTGNLMQAISIITISVFCVISVLLFNPWAALMVVCILGIMTCELAG-FMGLVGIKLNPVSAVTLITAVGIGVEFTVHVVVSFL----------------------TALGTRSQRTSS-----------------------AVDRVF--VPVIHGSFSTLLGILMLGFSEFEFVVKYFFIVMTALICIGIINGLILLPVLLSWFGPRRE 1338          

HSP 2 Score: 69.707 bits (169), Expect = 1.767e-11
Identity = 41/140 (29.29%), Postives = 72/140 (51.43%), Query Frame = 1
Query: 1522 FNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPR 1941
            FNA TTQ+VPF+ +G+G++ + +L   Y    D+ +    H            +IL  S +  L  L+  T++P+P +R+FC Q   ++         +YP ++ +D  R+++ R DL+CCL      +   ESYS + +
Sbjct:  715 FNAATTQIVPFLTLGIGVDNMFMLLHNYR---DVVKLAGGHAEMAILMRETGMSILCTSINNILSFLTG-TLLPIPALRSFCAQSSILLTFNFIAILTIYPAIISIDLRRKKAQRRDLVCCLYG----DTREESYSMISK 846          

HSP 3 Score: 68.1662 bits (165), Expect = 4.950e-11
Identity = 54/229 (23.58%), Postives = 91/229 (39.74%), Query Frame = 1
Query:  361 VEFETDVMNLWIYNSSRLHNETSFISRV----------SGSKIE-----SGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRS--FTFSDFCQRVQLPKLHYLHDRS-LRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDE--------SRSIKIDWKSFN---ISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLK 960
            V  ETD++ LW+    RL  E +F+  +          SG ++       G  + ++Q   +    +         +       +         ++ SD C +   P +      S L   ++ ++PC  I+P++CFWEGSK L  +     S+           S    I W  F+   +  E   SF   S+Y F    F+ AG+  G++ +PC+D  D  CP   K
Sbjct:  155 VHIETDIVKLWVAQGGRLDEELNFLPNIKEAMRNVTGDSGPELPRENGLGGGYQVLIQTPEYEGQDALAAGPLLKHVEIMKHIASFNVSVHGVDWSLSDICFKPAPPSVAADSAASSLGDVIDKIVPCIWITPIDCFWEGSKALGPHPSLPKSSLGPLGMLLSSLSDGDMIRWSDFDPIAVIDEIHRSFNLGSHYTF----FERAGVSHGYMDRPCIDPLDPECPPMAK 379          
BLAST of patched-like protein vs. Ensembl Celegans
Match: ptc-1 (pep chromosome:WBcel235:II:7893229:7900510:1 gene:WBGene00004208.1 transcript:ZK675.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ptc-1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.272e-15
Identity = 109/478 (22.80%), Postives = 188/478 (39.33%), Query Frame = 1
Query: 2314 GLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTK--EFEYTNNQDILLQLHQEIDNLHHVALLENG----KFWLSSFIGWLERIQSDFDRDV-KNKLILANGT-WSRNASKNGLLVMTLMVQDGESIN-YKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTV-----DNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEEL-DFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMF-VISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSD 3693
            GL    + P  +    +++   + F F     V K    +Y + Q  +    Q I +  +V   +N     K+WL     WL  IQ  FD +V K    L +GT    N S++  L   LM   G       ++   RLV  +G ++   FY +L  W ++  + Y       +P    + +     +NF P+                    PL +    ++  G +    + D +K +RS+  R+T+   LP  P G  FT  EQYL L   L+    I+ I +F VIS+L  N + A ++  +L   +      FM L  I LN  S V  + + G+G  F++ ++VS++                      ++  T ++RT                          V+R F  VP     FST LG+  +  ++  F+ + F ++    +   ++N   L P+   +  P+ +
Sbjct:  928 GLELGDVLPEHTAPAQFLRARDKYFSFYPMFAVIKGPNIDYAHQQRQIDNYRQSIGSSKYVIKNKNEEPSEKYWLGLMRDWLISIQRGFDEEVAKGSFNLTSGTVIGSNVSEDARLAHALMCSHGSLFGCAGRVGKIRLVDASGIINSDGFYNYLTAWFNVDHMMYYVSQASFFPTPPKWELSKNHTENFIPAA------------------EPLAYSQIPFYLTGLTDTAVIVDAIKDIRSVCERFTDQ-GLPNFPQGIAFTFWEQYLFLTGNLMQAISIITISVFCVISVLLFNPWAALMVVCILGIMTCELAG-FMGLVGIKLNPVSAVTLITAVGIGVEFTVHVVVSFL----------------------TALGTRSQRTSS-----------------------AVDRVF--VPVIHGSFSTLLGILMLGFSEFEFVVKYFFIVMTALICIGIINGLILLPVLLSWFGPRRE 1338          

HSP 2 Score: 69.707 bits (169), Expect = 1.767e-11
Identity = 41/140 (29.29%), Postives = 72/140 (51.43%), Query Frame = 1
Query: 1522 FNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPR 1941
            FNA TTQ+VPF+ +G+G++ + +L   Y    D+ +    H            +IL  S +  L  L+  T++P+P +R+FC Q   ++         +YP ++ +D  R+++ R DL+CCL      +   ESYS + +
Sbjct:  715 FNAATTQIVPFLTLGIGVDNMFMLLHNYR---DVVKLAGGHAEMAILMRETGMSILCTSINNILSFLTG-TLLPIPALRSFCAQSSILLTFNFIAILTIYPAIISIDLRRKKAQRRDLVCCLYG----DTREESYSMISK 846          

HSP 3 Score: 68.1662 bits (165), Expect = 4.950e-11
Identity = 54/229 (23.58%), Postives = 91/229 (39.74%), Query Frame = 1
Query:  361 VEFETDVMNLWIYNSSRLHNETSFISRV----------SGSKIE-----SGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRS--FTFSDFCQRVQLPKLHYLHDRS-LRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDE--------SRSIKIDWKSFN---ISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLK 960
            V  ETD++ LW+    RL  E +F+  +          SG ++       G  + ++Q   +    +         +       +         ++ SD C +   P +      S L   ++ ++PC  I+P++CFWEGSK L  +     S+           S    I W  F+   +  E   SF   S+Y F    F+ AG+  G++ +PC+D  D  CP   K
Sbjct:  155 VHIETDIVKLWVAQGGRLDEELNFLPNIKEAMRNVTGDSGPELPRENGLGGGYQVLIQTPEYEGQDALAAGPLLKHVEIMKHIASFNVSVHGVDWSLSDICFKPAPPSVAADSAASSLGDVIDKIVPCIWITPIDCFWEGSKALGPHPSLPKSSLGPLGMLLSSLSDGDMIRWSDFDPIAVIDEIHRSFNLGSHYTF----FERAGVSHGYMDRPCIDPLDPECPPMAK 379          
BLAST of patched-like protein vs. Ensembl Celegans
Match: ptc-3 (pep chromosome:WBcel235:II:2845384:2852593:-1 gene:WBGene00004210.1 transcript:Y110A2AL.8a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ptc-3)

HSP 1 Score: 67.781 bits (164), Expect = 6.372e-11
Identity = 36/132 (27.27%), Postives = 70/132 (53.03%), Query Frame = 1
Query: 1522 FNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDST 1917
            FNA TTQVVPF+ +GLG++++ +L   Y + I+IC +     + +   L +    +M++    ++   +  ++P+P +R+FC Q   ++        F++P ++ +D  R+   + DL  C   R  P  +T
Sbjct:  679 FNAATTQVVPFLSLGLGIDDMFLLLHNYDEIINICNK-----NEIGVLLKETGMSVMLTSINNILAFISGYVLPIPALRSFCSQTAILLAFNLIFLMFIFPAMIGIDLRRQRKGKRDLAYC--SRGNPQMAT 803          
BLAST of patched-like protein vs. Ensembl Fly
Match: ptc (gene:FBgn0003892 transcript:FBtr0089427)

HSP 1 Score: 143.28 bits (360), Expect = 6.054e-34
Identity = 134/542 (24.72%), Postives = 231/542 (42.62%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNXXXX----XXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLH--YLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETS------NYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRL-----KQKPSYESIVNEGCAQIGEHMDKYSKSIFIG--KDNRG--LQTFLLLQSTSHVL----------ETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCC 1884
             KS +  + V  LWI    RL  E ++  +  G   ES + + ++Q +TH+   S       L     L++        YD   +   D C     P     Y  ++ LR    +L+PC II+PL+CFWEGS+LL   S       ++    ++ W + N +    Y  ++ S      ++    +  K A I SG++ KPCL+  + +CP+        Q P   +I++ GC         + + + +G  K NR   L+    LQS   ++          +  K+++L W + K  +V+N W +   + V                  + QS+       YVF++ +L+  L + +    L    +    V +L+     +   + VR    + V    L+  +  +GLGL A +G  FNA +TQVVPF+ +GLG++ + +LT  Y+++        N        L      ++ S         A   IPVP ++ FC+Q   +M         ++P ++ LD  RR + R D+ CC
Sbjct:   92 LKSAQIHSKVHQLWIQEGGRLEAELAYTQKTIGED-ESATHQLLIQ-TTHDPNASVLHPQALLAHLEVLVKATAVKVHLYDTE-WGLRDMCNMPSTPSFEGIYYIEQILR----HLIPCSIITPLDCFWEGSQLLGPESAVVIPGLNQ----RLLWTTLNPASVMQYMKQKMSEEKISFDFETVEQYMKRAAIGSGYMEKPCLNPLNPNCPDTAPNKNSTQPPDVGAILSGGCYGYAAKHMHWPEELIVGGAKRNRSGHLRKAQALQSVVQLMTEKEMYDQWQDNYKVHHLGWTQEKAAEVLNAWQRNFSREVEQL--------------LRKQSRIATNYDIYVFSSAALDDILAKFSHPSAL--SIVIGVAVTVLYAFCTLLRWRDPVRGQSSVGVAGVLLMCFSTAAGLGLSALLGIVFNAASTQVVPFLALGLGVDHIFMLTAAYAES--------NRREQTKLILKKVGPSILFSACSTAGSFFAAAFIPVPALKVFCLQAAIVMCSNLAAALLVFPAMISLDLRRRTAGRADIFCC 598          

HSP 2 Score: 105.531 bits (262), Expect = 2.326e-22
Identity = 99/376 (26.33%), Postives = 174/376 (46.28%), Query Frame = 1
Query: 2287 LYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTK-EFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGE---SINYKKLSTSRLVR-NGKVDERKFYLFLNVWRSMSV-EYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELD-FVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSP 3384
            LY++  +  GL    + P+DSNE  ++  +T LF F +   VT+  FEY   Q +L   H     + HV   +NG    FWL  F  WL  +Q  FD + ++   L    W  NAS + +L   L+VQ G     ++ + + T+RLV  +G +++R FY +L+ W +  V  Y      LYP+          P +Y  +P+      L +  + PL +    ++  G +   ++   +  +R ++ +Y     LP  P G  F   EQY+ LR  L ++   + +   V+  L +    A++L  L + +S+      M L  I L+A   V+ + S G+   F++ + + ++  T +       Q  M++S+ P
Sbjct:  695 LYASTRLQDGLDIIDLVPKDSNEHKFLDAQTRLFGFYSMYAVTQGNFEYPTQQQLLRDYHDSFVRVPHVIKNDNGGLPDFWLLLFSEWLGNLQKIFDEEYRDGR-LTKECWFPNASSDAILAYKLIVQTGHVDNPVDKELVLTNRLVNSDGIINQRAFYNYLSAWATNDVFAYGASQGKLYPE----------PRQYFHQPNEY---DLKIPKSLPLVYAQMPFYLHGLTDTSQIKTLIGHIRDLSVKY-EGFGLPNYPSGIPFIFWEQYMTLRSSLAMILACVLLAALVLVSLLLLSVWAAVLVILSVLASLAQIFGAMTLLGIKLSAIPAVILILSVGMMLCFNVLISLGFM--TSVGNRQRRVQLSMQMSLGP 1053          
BLAST of patched-like protein vs. Ensembl Zebrafish
Match: ptch2 (patched 2 [Source:NCBI gene;Acc:30181])

HSP 1 Score: 228.024 bits (580), Expect = 7.370e-60
Identity = 261/1133 (23.04%), Postives = 488/1133 (43.07%), Query Frame = 1
Query:  175 RKSYLMVNMYIKGHSSLKC-KTNIKIWLKLKY----FCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGS---IETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLKQK-----PSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNR-------GLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPD------TFIPNNVHQYCEINPVDLS---PRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCC------WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSP 3384
            R SY      +K  S  K       +W++ ++    F     ++ H  K+L IG+   G   +G +    ETD+  LW+   SR+  E  +     G +    S   I+T  Q  T N L     LL     L         Y + S+  +  C +  +P    + +  +   ++ L PC I++PL+CFWEGSKL         S Y       I W + +   +      + ++   F E+  +A +   ++++PCLD +D  CP+    K     P+  + +  GC    +    + + + +G   KD++        LQT  LL S   + E  K    I+++ W E K   ++  W +K  + V+H         SIP  ++         S+ Y F+  +LN  +   +    +    +  G ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G++++ +L   +++     R  I         L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC           ++ Q  +D+ +++   P                      FT          T +P           + LS   P ++P  S+ F  +SS  + L       +   C       W       + +  +++    +  V++V + ++ + LY    +  GL    I PRD+ E+ +I  + + F F N  +VT + F+Y  +Q  LLQLH   +++ +V    N K    WL  F  WL+ +Q+ FD D +   I  +    RN +++G L   L++Q G   E  NY +L++ RLV  +G +    FY++L VW S   + Y       YP    +  D +  +             L + +  PL+F    ++  G + + + ++ +++VR+I   +     +   P G  F   EQY+ LR+  ++ +S++LA    V ++L +N + A ++  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++  T +   +T +   ME   +P
Sbjct:   36 RPSYCHAAFALKQISKGKAVGQKAPLWIRARFQAFLFSLGCHIQRHCGKVLFIGLLVFGALSVGLRVAAIETDIEKLWVEAGSRVSKELRYTKEKQGEESVFTSQMLIQTPKQEGT-NILTQEALLLHLEAALSASKVQVSLYGK-SWDLNKICFKSGVP---IIENVMIERMIDKLFPCMIVTPLDCFWEGSKL------QGGSAYLPGMP-DIQWMNLD-PLKLMEELSQFTSLEGFREMLDKAQVGHAYMNRPCLDPSDTDCPHSAPNKDPWQVPNIAAELQGGCHGFSKKFMHWQEELILGERVKDSQNALQSAEALQTMFLLMSPKQLYEHFKDDYEIHDINWNEDKATAILESWQRKFVE-VVH--------GSIPQNSS---------SNVYAFSTTTLNDIMKSFSDVSVI---RVAGGYLLMLAYACVTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVLPFLALGIGVDDMFLLAHSFTET----RSNIPFKERTGDCLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSLDLHRREDKRLDILCCFYSPCSSRVIQIQPQELSDANDNHQRAPATPTYTGSTITTSTHITTTVQAFTQCDAAGQHIVTILPPTSQISTTPPSMVLSTPTPTTDPYGSQVFTTSSSTRDLLAQVEEPKEGRECVPLPFFRWNLSSFAREKYAPLLLKPETKTVVVVVFVALLSLSLYGTTMVHDGLYLTDIVPRDTQEYEFITAQFKYFSFYNMYLVTMDGFDYARSQRQLLQLHNAFNSVKYVVKDGNHKLPRMWLHYFQDWLKGLQATFDADWEAGKITYDSY--RNGTEDGALAYKLLIQTGSKKEPFNYSQLTSRRLVDEDGLIPPEVFYIYLTVWVSNDPLGYAASQANFYPHPREWIHDKYDTTG----------ENLRIPAAEPLEFAQFPFYLNGLRQASDFIEAIESVRTICEEFMRQ-GIKNYPNGYPFLFWEQYIGLRHWFLLSISVVLACTFLVCAILLLNPWTAGVIVFILAMMTVEL-FGIMGLIGIKLSAIPVVILIASVGIGVEFTVHIALGFL--TAIGDRNTRSAVAMEHMFAP 1114          
BLAST of patched-like protein vs. Ensembl Zebrafish
Match: ptch2 (patched 2 [Source:NCBI gene;Acc:30181])

HSP 1 Score: 228.024 bits (580), Expect = 8.861e-60
Identity = 246/1069 (23.01%), Postives = 462/1069 (43.22%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGS---IETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLKQK-----PSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNR-------GLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPD------TFIPNNVHQYCEINPVDLS---PRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCC------WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSP 3384
             +    ETD+  LW+   SR+  E  +     G +    S   I+T  Q  T N L     LL     L         Y + S+  +  C +  +P    + +  +   ++ L PC I++PL+CFWEGSKL         S Y       I W + +   +      + ++   F E+  +A +   ++++PCLD +D  CP+    K     P+  + +  GC    +    + + + +G   KD++        LQT  LL S   + E  K    I+++ W E K   ++  W +K  + V+H         SIP  ++         S+ Y F+  +LN  +   +    +    +  G ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G++++ +L   +++     R  I         L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC           ++ Q  +D+ +++   P                      FT          T +P           + LS   P ++P  S+ F  +SS  + L       +   C       W       + +  +++    +  V++V + ++ + LY    +  GL    I PRD+ E+ +I  + + F F N  +VT + F+Y  +Q  LLQLH   +++ +V    N K    WL  F  WL+ +Q+ FD D +   I  +    RN +++G L   L++Q G   E  NY +L++ RLV  +G +    FY++L VW S   + Y       YP    +  D +  +             L + +  PL+F    ++  G + + + ++ +++VR+I   +     +   P G  F   EQY+ LR+  ++ +S++LA    V ++L +N + A ++  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++  T +   +T +   ME   +P
Sbjct:  100 LRVAAIETDIEKLWVEAGSRVSKELRYTKEKQGEESVFTSQMLIQTPKQEGT-NILTQEALLLHLEAALSASKVQVSLYGK-SWDLNKICFKSGVP---IIENVMIERMIDKLFPCMIVTPLDCFWEGSKL------QGGSAYLPGMP-DIQWMNLD-PLKLMEELSQFTSLEGFREMLDKAQVGHAYMNRPCLDPSDTDCPHSAPNKDPWQVPNIAAELQGGCHGFSKKFMHWQEELILGERVKDSQNALQSAEALQTMFLLMSPKQLYEHFKDDYEIHDINWNEDKATAILESWQRKFVE-VVH--------GSIPQNSS---------SNVYAFSTTTLNDIMKSFSDVSVI---RVAGGYLLMLAYACVTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVLPFLALGIGVDDMFLLAHSFTET----RSNIPFKERTGDCLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSLDLHRREDKRLDILCCFYSPCSSRVIQIQPQELSDANDNHQRAPATPTYTGSTITTSTHITTTVQAFTQCDAAGQHIVTILPPTSQISTTPPSMVLSTPTPTTDPYGSQVFTTSSSTRDLLAQVEEPKEGRECVPLPFFRWNLSSFAREKYAPLLLKPETKTVVVVVFVALLSLSLYGTTMVHDGLYLTDIVPRDTQEYEFITAQFKYFSFYNMYLVTMDGFDYARSQRQLLQLHNAFNSVKYVVKDGNHKLPRMWLHYFQDWLKGLQATFDADWEAGKITYDSY--RNGTEDGALAYKLLIQTGSKKEPFNYSQLTSRRLVDEDGLIPPEVFYIYLTVWVSNDPLGYAASQANFYPHPREWIHDKYDTTG----------ENLRIPAAEPLEFAQFPFYLNGLRQASDFIEAIESVRTICEEFMRQ-GIKNYPNGYPFLFWEQYIGLRHWFLLSISVVLACTFLVCAILLLNPWTAGVIVFILAMMTVEL-FGIMGLIGIKLSAIPVVILIASVGIGVEFTVHIALGFL--TAIGDRNTRSAVAMEHMFAP 1114          
BLAST of patched-like protein vs. Ensembl Zebrafish
Match: ptch1 (patched 1 [Source:ZFIN;Acc:ZDB-GENE-980526-196])

HSP 1 Score: 125.561 bits (314), Expect = 2.536e-28
Identity = 128/524 (24.43%), Postives = 225/524 (42.94%), Query Frame = 1
Query: 2281 MGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIP-----KSDHKTR---SPFVRNSDSYRCKSRPSHKSSTKSFRSQVSRNGS 3807
            + LY    +  GL    I PR++ E+ +I+ +   F F N  +VT+  +Y   Q  L +LHQ   ++ ++   ENG   + WL  F  WL  +Q  FD+D +   I   G + RN S +G+L   L+VQ G     K ++  RLV  +G ++   FY++L+ W S   V Y      + P           P         I  S LN+ +  P+++    ++  G + + + ++ +++VR+I + ++    LP+ P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++                      + GD                         NK+ ++ +E  F   P     FST LG+  +  ++  F+ R F  +  +  V  +LN   L P+   Y  P      +D ++R             R   RPSH +      S  S  GS
Sbjct:  662 VSLYGTTRVRDGLELTDIVPRETGEYDFIRAQFRYFSFYNMYVVTQRADYAQIQPQLYELHQRFGSVKYILREENGQLPRMWLHYFRDWLLGLQEAFDKDWQAGRI-TQGNY-RNGSDDGVLAYKLLVQTGR--REKTITRQRLVSADGIINPNAFYIYLSAWVSNDPVAYAASQANIRPH---------PPEWLHDRTDSIPASRLNIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICNNFSRQ-GLPSYPNGYPFLFWEQYVGLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVLVLSLMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLT---------------------AIGDR------------------------NKRAVLALEHMF--APVLDGAFSTLLGVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGPYPEVSPADGQSRLPTPSPEPPPQVVRFTMRPSHTTPGAGSDSSDSEYGS 1123          

HSP 2 Score: 115.161 bits (287), Expect = 4.293e-25
Identity = 103/433 (23.79%), Postives = 200/433 (46.19%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETS-NYNFFYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKP-SYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLL 1890
            +E L PC +I+PL+CFWEG+KL      +  + Y   +   + W +F+    F    K      + + E+  +A +  G++++PCL+  D  CP    N+    P     ++  GC  + +    + + + +G   K++ G        QT   L +   + E +K    ++++ W E K   ++  W +K  + V          +S+P  +    SQ++       FT  +L   L   +    +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R D+ CC +
Sbjct:   89 LEKLHPCLVITPLDCFWEGAKL------HSGTFYLPGKP-PLQWTNFD-PMGFIAELKMLKYQVDSWEEMLVKADVGQGYMNRPCLNPADPDCPLSAPNKNTTGPFDVAPVLTGGCYGLSKKYMHWQEELIVGGTKKNDSGKLLSAQAFQTMFQLMTPKQMYEHLKGYDEVSHINWNEDKAAAILEAWQRKYSEAV---------QQSVPVNS----SQKV-----LTFTTTTLEDILKSFSDVSVI---RIASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIFCCFV 484          
BLAST of patched-like protein vs. Ensembl Zebrafish
Match: ptch1 (patched 1 [Source:ZFIN;Acc:ZDB-GENE-980526-196])

HSP 1 Score: 125.176 bits (313), Expect = 3.095e-28
Identity = 128/524 (24.43%), Postives = 225/524 (42.94%), Query Frame = 1
Query: 2281 MGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIP-----KSDHKTR---SPFVRNSDSYRCKSRPSHKSSTKSFRSQVSRNGS 3807
            + LY    +  GL    I PR++ E+ +I+ +   F F N  +VT+  +Y   Q  L +LHQ   ++ ++   ENG   + WL  F  WL  +Q  FD+D +   I   G + RN S +G+L   L+VQ G     K ++  RLV  +G ++   FY++L+ W S   V Y      + P           P         I  S LN+ +  P+++    ++  G + + + ++ +++VR+I + ++    LP+ P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++                      + GD                         NK+ ++ +E  F   P     FST LG+  +  ++  F+ R F  +  +  V  +LN   L P+   Y  P      +D ++R             R   RPSH +      S  S  GS
Sbjct:  782 VSLYGTTRVRDGLELTDIVPRETGEYDFIRAQFRYFSFYNMYVVTQRADYAQIQPQLYELHQRFGSVKYILREENGQLPRMWLHYFRDWLLGLQEAFDKDWQAGRI-TQGNY-RNGSDDGVLAYKLLVQTGR--REKTITRQRLVSADGIINPNAFYIYLSAWVSNDPVAYAASQANIRPH---------PPEWLHDRTDSIPASRLNIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICNNFSRQ-GLPSYPNGYPFLFWEQYVGLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVLVLSLMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLT---------------------AIGDR------------------------NKRAVLALEHMF--APVLDGAFSTLLGVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGPYPEVSPADGQSRLPTPSPEPPPQVVRFTMRPSHTTPGAGSDSSDSEYGS 1243          

HSP 2 Score: 115.931 bits (289), Expect = 2.365e-25
Identity = 124/545 (22.75%), Postives = 237/545 (43.49%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVST-----HNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRV-QLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETS-NYNFFYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKP-SYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLL 1890
             ++   ETDV  LW+    R++ E  +  +  G   E       L + T      N L            ++        Y+R+ +T    C +  +L     + D+ L    E L PC +I+PL+CFWEG+KL      +  + Y   +   + W +F+    F    K      + + E+  +A +  G++++PCL+  D  CP    N+    P     ++  GC  + +    + + + +G   K++ G        QT   L +   + E +K    ++++ W E K   ++  W +K  + V          +S+P  +    SQ++       FT  +L   L   +    +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R D+ CC +
Sbjct:  105 LRAANLETDVEKLWVEVGGRVNQELKYTRQKIG---EEAMFSPQLMIQTPRQEGANILTVEALKQHLDSAIKASRVHVYMYNRQ-WTLEHLCYKSGELVTETNVVDQIL----EKLHPCLVITPLDCFWEGAKL------HSGTFYLPGKP-PLQWTNFD-PMGFIAELKMLKYQVDSWEEMLVKADVGQGYMNRPCLNPADPDCPLSAPNKNTTGPFDVAPVLTGGCYGLSKKYMHWQEELIVGGTKKNDSGKLLSAQAFQTMFQLMTPKQMYEHLKGYDEVSHINWNEDKAAAILEAWQRKYSEAV---------QQSVPVNS----SQKV-----LTFTTTTLEDILKSFSDVSVI---RIASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIFCCFV 604          
BLAST of patched-like protein vs. Ensembl Zebrafish
Match: ptch1 (patched 1 [Source:ZFIN;Acc:ZDB-GENE-980526-196])

HSP 1 Score: 123.635 bits (309), Expect = 1.011e-27
Identity = 95/353 (26.91%), Postives = 174/353 (49.29%), Query Frame = 1
Query: 2281 MGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            + LY    +  GL    I PR++ E+ +I+ +   F F N  +VT+  +Y   Q  L +LHQ   ++ ++   ENG   + WL  F  WL  +Q  FD+D +   I   G + RN + +G+L   L+VQ G     K ++  RLV  +G ++   FY++L+ W S   V Y      + P           P         I  S LN+ +  P+++    ++  G + + + ++ +++VR+I + Y+    LP+ P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  782 VSLYGTTRVRDGLELTDIVPRETGEYDFIRAQFRYFSFYNMYVVTQRADYAQIQPQLYELHQRFGSVKYILREENGQLPRMWLHYFRDWLLGLQEAFDKDWQAGRI-TQGNY-RNGTDDGVLAYKLLVQTGR--REKTITRQRLVSADGIINPNAFYIYLSAWVSNDPVAYAASQANIRPH---------PPEWLHDRTDSIPASRLNIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICNNYSRQ-GLPSYPNGYPFLFWEQYVGLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVLVLSLMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1119          

HSP 2 Score: 115.546 bits (288), Expect = 2.806e-25
Identity = 124/545 (22.75%), Postives = 237/545 (43.49%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVST-----HNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRV-QLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETS-NYNFFYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKP-SYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLL 1890
             ++   ETDV  LW+    R++ E  +  +  G   E       L + T      N L            ++        Y+R+ +T    C +  +L     + D+ L    E L PC +I+PL+CFWEG+KL      +  + Y   +   + W +F+    F    K      + + E+  +A +  G++++PCL+  D  CP    N+    P     ++  GC  + +    + + + +G   K++ G        QT   L +   + E +K    ++++ W E K   ++  W +K  + V          +S+P  +    SQ++       FT  +L   L   +    +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R D+ CC +
Sbjct:  105 LRAANLETDVEKLWVEVGGRVNQELKYTRQKIG---EEAMFSPQLMIQTPRQEGANILTVEALKQHLDSAIKASRVHVYMYNRQ-WTLEHLCYKSGELVTETNVVDQIL----EKLHPCLVITPLDCFWEGAKL------HSGTFYLPGKP-PLQWTNFD-PMGFIAELKMLKYQVDSWEEMLVKADVGQGYMNRPCLNPADPDCPLSAPNKNTTGPFDVAPVLTGGCYGLSKKYMHWQEELIVGGTKKNDSGKLLSAQAFQTMFQLMTPKQMYEHLKGYDEVSHINWNEDKAAAILEAWQRKYSEAV---------QQSVPVNS----SQKV-----LTFTTTTLEDILKSFSDVSVI---RIASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIFCCFV 604          
BLAST of patched-like protein vs. Ensembl Xenopus
Match: PTCH2 (patched 2 [Source:NCBI gene;Acc:100492958])

HSP 1 Score: 235.728 bits (600), Expect = 1.760e-62
Identity = 236/1037 (22.76%), Postives = 456/1037 (43.97%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQV---STHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPN-----RLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG----------KDNRGLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHP--HPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL-------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCC------WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLEN---GKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQ-LVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
             +    ETD+  LW+   SR+ +E  +     G +    S + ++Q       N L     LL     L         Y + S+  +  C +  +P    + +  +   +E L PC II+PL+CFWEGS+L         S Y   R+  I W + +  Q       + ++ + F E+  +A +   ++ +PCLD TD+ CP      + K+ P   S +  GC    +    + K + +G          K    LQT  LL S   + E  K    I+++ W E K   ++  W +K  +            +SIP  +    SQ I   S     +   + +   A +        +  G ++ML    + +   +  +S   + +    L+  ++ SGLGL + +G +FNA TTQV+PF+ +G+G++++ +L   +++        ++ P      + L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC        + +  P + ++  + V     C     +++ + +  +++ +T+P   +P                  +P  S+ F  +SS  + L       ++  C       W       + +  +++    +  V+ + + ++ +GLY    +  GL    I PR++ E+++I  + + F F N  IVTK+ F+Y   Q+ L  LH+   ++ +V   E     K WL  F  WL  +Q+ FD+D +   I  +    RN +++ +L   L++Q G   E  N+ +L++ RLV   G + +  FY++L VW S   + Y       YP+   +  D +  +             L + +  P++F    ++  G + + + ++ +++VRS+   +     + + P G  F   EQY+ LR+  L+ +SI+LA    V ++L +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++
Sbjct:   98 LRVASIETDIERLWVEAGSRVSHELRYTKEKLGEESVYTS-QMLIQTPKREGENILTQEALLLHLRAALAASKVQVSMYGK-SWDLNKICYKSGVP---IIENGMIERMIEKLFPCVIITPLDCFWEGSQL------QGGSAYLPGRA-DIQWTNLDPIQ-LMEELGQFTSLDGFKEMLDKAEVGQAYMERPCLDPTDSDCPESSPNKKTKKNPDIVSTLRRGCYGFSKKFMYWQKELILGGMLKGPDGELKSAEALQTMYLLMSPGQLYEHFKDDYEIHDINWNEEKAAAILESWQRKFVEQA---------QQSIPQNS----SQDIHAFSTTTLNDIMKSFSDVSAIR--------VAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTET------SLSTPFKERTGECLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSLDLHRREDQRLDILCCFYSPCSSRVIQIQPQEFSDITTTVQAFTQCDPSGHHIV-TILPPTSQISTSPSVIVPT----------------MDPLGSQVFSPSSSTRDLLAQLDESKEKRECVPLPFLKWSLSDFAREKYAPVLLKAETKGIVVALFMALLGLGLYGTTMVHDGLYLTDIVPRETKEYNFISAQFKYFSFYNMFIVTKDGFDYPKAQESLYDLHEAFGSVKYVVREEGRDLPKMWLHYFQDWLRGLQTAFDKDWELGHITEDSY--RNGTEDSVLAFKLLIQTGNKKEPFNFNQLTSRRLVDEKGLIPQDAFYIYLTVWVSNDPLGYAASQANFYPQPPEWIHDRYDTTG----------ENLRIPAAEPIEFAQFPFYLNGLRQTSDFIEAIESVRSVCEEFVKQ-GVQSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVEL-FGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFL 1063          
BLAST of patched-like protein vs. Ensembl Xenopus
Match: PTCH2 (patched 2 [Source:NCBI gene;Acc:100492958])

HSP 1 Score: 234.958 bits (598), Expect = 2.804e-62
Identity = 240/1046 (22.94%), Postives = 458/1046 (43.79%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQV---STHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPN-----RLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG----------KDNRGLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHP--HPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPD------TFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCC------WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLEN---GKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQ-LVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
             +    ETD+  LW+   SR+ +E  +     G +    S + ++Q       N L     LL     L         Y + S+  +  C +  +P    + +  +   +E L PC II+PL+CFWEGS+L         S Y   R+  I W + +  Q       + ++ + F E+  +A +   ++ +PCLD TD+ CP      + K+ P   S +  GC    +    + K + +G          K    LQT  LL S   + E  K    I+++ W E K   ++  W +K  +            +SIP  +    SQ I   S     +   + +   A +        +  G ++ML    + +   +  +S   + +    L+  ++ SGLGL + +G +FNA TTQV+PF+ +G+G++++ +L   +++        ++ P      + L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC           ++ Q  +D+ ++++  P  Y      ++   +  +    FT          T +P         +P  + P  +P  S+ F  +SS  + L       ++  C       W       + +  +++    +  V+ + + ++ +GLY    +  GL    I PR++ E+++I  + + F F N  IVTK+ F+Y   Q+ L  LH+   ++ +V   E     K WL  F  WL  +Q+ FD+D +   I  +    RN +++ +L   L++Q G   E  N+ +L++ RLV   G + +  FY++L VW S   + Y       YP+   +  D +  +             L + +  P++F    ++  G + + + ++ +++VRS+   +     + + P G  F   EQY+ LR+  L+ +SI+LA    V ++L +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++
Sbjct:   98 LRVASIETDIERLWVEAGSRVSHELRYTKEKLGEESVYTS-QMLIQTPKREGENILTQEALLLHLRAALAASKVQVSMYGK-SWDLNKICYKSGVP---IIENGMIERMIEKLFPCVIITPLDCFWEGSQL------QGGSAYLPGRA-DIQWTNLDPIQ-LMEELGQFTSLDGFKEMLDKAEVGQAYMERPCLDPTDSDCPESSPNKKTKKNPDIVSTLRRGCYGFSKKFMYWQKELILGGMLKGPDGELKSAEALQTMYLLMSPGQLYEHFKDDYEIHDINWNEEKAAAILESWQRKFVEQA---------QQSIPQNS----SQDIHAFSTTTLNDIMKSFSDVSAIR--------VAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTET------SLSTPFKERTGECLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSLDLHRREDQRLDILCCFYSPCSSRVIQIQPQEFSDANDNHTYHPSSYGNPTITTSTQITTTV--QAFTQCDPSGHHIVTILPPTSQ--ISTSPSVIVPTMDPLGSQVFSPSSSTRDLLAQLDESKEKRECVPLPFLKWSLSDFAREKYAPVLLKAETKGIVVALFMALLGLGLYGTTMVHDGLYLTDIVPRETKEYNFISAQFKYFSFYNMFIVTKDGFDYPKAQESLYDLHEAFGSVKYVVREEGRDLPKMWLHYFQDWLRGLQTAFDKDWELGHITEDSY--RNGTEDSVLAFKLLIQTGNKKEPFNFNQLTSRRLVDEKGLIPQDAFYIYLTVWVSNDPLGYAASQANFYPQPPEWIHDRYDTTG----------ENLRIPAAEPIEFAQFPFYLNGLRQTSDFIEAIESVRSVCEEFVKQ-GVQSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVEL-FGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFL 1085          
BLAST of patched-like protein vs. Ensembl Xenopus
Match: PTCH2 (patched 2 [Source:NCBI gene;Acc:100492958])

HSP 1 Score: 234.958 bits (598), Expect = 2.975e-62
Identity = 250/1080 (23.15%), Postives = 472/1080 (43.70%), Query Frame = 1
Query:  250 WLKLKYFCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQV---STHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPN-----RLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG----------KDNRGLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHP--HPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPD------TFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCC------WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLEN---GKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQ-LVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            W K   F     ++ H  K+L IG+   G   +G +    ETD+  LW+   SR+ +E  +     G +    S + ++Q       N L     LL     L         Y + S+  +  C +  +P    + +  +   +E L PC II+PL+CFWEGS+L         S Y  +    I W + +  Q       + ++ + F E+  +A +   ++ +PCLD TD+ CP      + K+ P   S +  GC    +    + K + +G          K    LQT  LL S   + E  K    I+++ W E K   ++  W              R ++ESIP  +    SQ I   S     +   + +   A +        +  G ++ML    + +   +  +S   + +    L+  ++ SGLGL + +G +FNA TTQV+PF+ +G+G++++ +L   +++        ++ P      + L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC           ++ Q  +D+ ++++  P  Y      ++   +  +    FT          T +P         +P  + P  +P  S+ F  +SS  + L       ++  C       W       + +  +++    +  V+ + + ++ +GLY    +  GL    I PR++ E+++I  + + F F N  IVTK+ F+Y   Q+ L  LH+   ++ +V   E     K WL  F  WL  +Q+ FD+D +   I  +    RN +++ +L   L++Q G   E  N+ +L++ RLV   G + +  FY++L VW S   + Y       YP+   +  D +  +             L + +  P++F    ++  G + + + ++ +++VRS+   +     + + P G  F   EQY+ LR+  L+ +SI+LA    V ++L +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++
Sbjct:   19 WPKALLFSLGCSIQRHCGKVLFIGLLVFGALAVGLRVASIETDIERLWVEAGSRVSHELRYTKEKLGEESVYTS-QMLIQTPKREGENILTQEALLLHLRAALAASKVQVSMYGK-SWDLNKICYKSGVP---IIENGMIERMIEKLFPCVIITPLDCFWEGSQL------QGGSAYLPA---DIQWTNLDPIQ-LMEELGQFTSLDGFKEMLDKAEVGQAYMERPCLDPTDSDCPESSPNKKTKKNPDIVSTLRRGCYGFSKKFMYWQKELILGGMLKGPDGELKSAEALQTMYLLMSPGQLYEHFKDDYEIHDINWNEEKAAAILESW-------------QRKFVESIPQNS----SQDIHAFSTTTLNDIMKSFSDVSAIR--------VAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTET------SLSTPFKERTGECLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSLDLHRREDQRLDILCCFYSPCSSRVIQIQPQEFSDANDNHTYHPSSYGNPTITTSTQITTTV--QAFTQCDPSGHHIVTILPPTSQ--ISTSPSVIVPTMDPLGSQVFSPSSSTRDLLAQLDESKEKRECVPLPFLKWSLSDFAREKYAPVLLKAETKGIVVALFMALLGLGLYGTTMVHDGLYLTDIVPRETKEYNFISAQFKYFSFYNMFIVTKDGFDYPKAQESLYDLHEAFGSVKYVVREEGRDLPKMWLHYFQDWLRGLQTAFDKDWELGHITEDSY--RNGTEDSVLAFKLLIQTGNKKEPFNFNQLTSRRLVDEKGLIPQDAFYIYLTVWVSNDPLGYAASQANFYPQPPEWIHDRYDTTG----------ENLRIPAAEPIEFAQFPFYLNGLRQTSDFIEAIESVRSVCEEFVKQ-GVQSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVEL-FGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFL 1034          
BLAST of patched-like protein vs. Ensembl Xenopus
Match: PTCH2 (patched 2 [Source:NCBI gene;Acc:100492958])

HSP 1 Score: 234.187 bits (596), Expect = 4.978e-62
Identity = 240/1046 (22.94%), Postives = 458/1046 (43.79%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQV---STHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPN-----RLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG----------KDNRGLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHP--HPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPD------TFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCC------WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLEN---GKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQ-LVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
             +    ETD+  LW+   SR+ +E  +     G +    S + ++Q       N L     LL     L         Y + S+  +  C +  +P    + +  +   +E L PC II+PL+CFWEGS+L         S Y   R+  I W + +  Q       + ++ + F E+  +A +   ++ +PCLD TD+ CP      + K+ P   S +  GC    +    + K + +G          K    LQT  LL S   + E  K    I+++ W E K   ++  W +K  +            +SIP  +    SQ I   S     +   + +   A +        +  G ++ML    + +   +  +S   + +    L+  ++ SGLGL + +G +FNA TTQV+PF+ +G+G++++ +L   +++        ++ P      + L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC           ++ Q  +D+ ++++  P  Y      ++   +  +    FT          T +P         +P  + P  +P  S+ F  +SS  + L       ++  C       W       + +  +++    +  V+ + + ++ +GLY    +  GL    I PR++ E+++I  + + F F N  IVTK+ F+Y   Q+ L  LH+   ++ +V   E     K WL  F  WL  +Q+ FD+D +   I  +    RN +++ +L   L++Q G   E  N+ +L++ RLV   G + +  FY++L VW S   + Y       YP+   +  D +  +             L + +  P++F    ++  G + + + ++ +++VRS+   +     + + P G  F   EQY+ LR+  L+ +SI+LA    V ++L +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++
Sbjct:   98 LRVASIETDIERLWVEAGSRVSHELRYTKEKLGEESVYTS-QMLIQTPKREGENILTQEALLLHLRAALAASKVQVSMYGK-SWDLNKICYKSGVP---IIENGMIERMIEKLFPCVIITPLDCFWEGSQL------QGGSAYLPGRA-DIQWTNLDPIQ-LMEELGQFTSLDGFKEMLDKAEVGQAYMERPCLDPTDSDCPESSPNKKTKKNPDIVSTLRRGCYGFSKKFMYWQKELILGGMLKGPDGELKSAEALQTMYLLMSPGQLYEHFKDDYEIHDINWNEEKAAAILESWQRKFVEQA---------QQSIPQNS----SQDIHAFSTTTLNDIMKSFSDVSAIR--------VAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTET------SLSTPFKERTGECLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSLDLHRREDQRLDILCCFYSPCSSRVIQIQPQEFSDANDNHTYHPSSYGNPTITTSTQITTTV--QAFTQCDPSGHHIVTILPPTSQ--ISTSPSVIVPTMDPLGSQVFSPSSSTRDLLAQLDESKEKRECVPLPFLKWSLSDFAREKYAPVLLKAETKGIVVALFMALLGLGLYGTTMVHDGLYLTDIVPRETKEYNFISAQFKYFSFYNMFIVTKDGFDYPKAQESLYDLHEAFGSVKYVVREEGRDLPKMWLHYFQDWLRGLQTAFDKDWELGHITEDSY--RNGTEDSVLAFKLLIQTGNKKEPFNFNQLTSRRLVDEKGLIPQDAFYIYLTVWVSNDPLGYAASQANFYPQPPEWIHDRYDTTG----------ENLRIPAAEPIEFAQFPFYLNGLRQTSDFIEAIESVRSVCEEFVKQ-GVQSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVEL-FGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFL 1085          
BLAST of patched-like protein vs. Ensembl Xenopus
Match: PTCH2 (patched 2 [Source:NCBI gene;Acc:100492958])

HSP 1 Score: 235.343 bits (599), Expect = 6.000e-62
Identity = 241/1048 (23.00%), Postives = 456/1048 (43.51%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQV---STHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPN-----RLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG----------KDNRGLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHP--HPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVH--------QYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCC------WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLEN---GKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQ-LVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
             +    ETD+  LW+   SR+ +E  +     G +    S + ++Q       N L     LL     L         Y + S+  +  C +  +P    + +  +   +E L PC II+PL+CFWEGS+L         S Y   R+  I W + +  Q       + ++ + F E+  +A +   ++ +PCLD TD+ CP      + K+ P   S +  GC    +    + K + +G          K    LQT  LL S   + E  K    I+++ W E K   ++  W +K  +            +SIP  +    SQ I   S     +   + +   A +        +  G ++ML    + +   +  +S   + +    L+  ++ SGLGL + +G +FNA TTQV+PF+ +G+G++++ +L   +++        ++ P      + L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC           ++ Q  +D+ ++++  P  Y       N   +     T    A     P+  H             +P  + P  +P  S+ F  +SS  + L       ++  C       W       + +  +++    +  V+ + + ++ +GLY    +  GL    I PR++ E+++I  + + F F N  IVTK+ F+Y   Q+ L  LH+   ++ +V   E     K WL  F  WL  +Q+ FD+D +   I  +    RN +++ +L   L++Q G   E  N+ +L++ RLV   G + +  FY++L VW S   + Y       YP+   +  D +  +             L + +  P++F    ++  G + + + ++ +++VRS+   +     + + P G  F   EQY+ LR+  L+ +SI+LA    V ++L +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++
Sbjct:   98 LRVASIETDIERLWVEAGSRVSHELRYTKEKLGEESVYTS-QMLIQTPKREGENILTQEALLLHLRAALAASKVQVSMYGK-SWDLNKICYKSGVP---IIENGMIERMIEKLFPCVIITPLDCFWEGSQL------QGGSAYLPGRA-DIQWTNLDPIQ-LMEELGQFTSLDGFKEMLDKAEVGQAYMERPCLDPTDSDCPESSPNKKTKKNPDIVSTLRRGCYGFSKKFMYWQKELILGGMLKGPDGELKSAEALQTMYLLMSPGQLYEHFKDDYEIHDINWNEEKAAAILESWQRKFVEQA---------QQSIPQNS----SQDIHAFSTTTLNDIMKSFSDVSAIR--------VAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVASGLGLCSLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTET------SLSTPFKERTGECLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSLDLHRREDQRLDILCCFYSPCSSRVIQIQPQEFSDANDNHTYHPSSY------GNPTITTSTQITTTVQAFTQCDPSGHHIVTILPPTSQISTSPSVIVPTMDPLGSQVFSPSSSTRDLLAQLDESKEKRECVPLPFLKWSLSDFAREKYAPVLLKAETKGIVVALFMALLGLGLYGTTMVHDGLYLTDIVPRETKEYNFISAQFKYFSFYNMFIVTKDGFDYPKAQESLYDLHEAFGSVKYVVREEGRDLPKMWLHYFQDWLRGLQTAFDKDWELGHITEDSY--RNGTEDSVLAFKLLIQTGNKKEPFNFNQLTSRRLVDEKGLIPQDAFYIYLTVWVSNDPLGYAASQANFYPQPPEWIHDRYDTTG----------ENLRIPAAEPIEFAQFPFYLNGLRQTSDFIEAIESVRSVCEEFVKQ-GVQSYPSGYPFLFWEQYIGLRHWFLLAISIVLACTFLVCAILLLNPWTAGIIVFILAMMTVEL-FGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFL 1085          
BLAST of patched-like protein vs. Ensembl Mouse
Match: Ptch1 (patched 1 [Source:MGI Symbol;Acc:MGI:105373])

HSP 1 Score: 219.935 bits (559), Expect = 2.010e-57
Identity = 237/946 (25.05%), Postives = 431/946 (45.56%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCPNRLKQKPSYES-----IVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLK-------RQTPNDSTESYS----AVPRQYDC---VRKDSNLLKSKIIFSTEFTTAPDT---FIPNNVHQYCEINPV-----DLSPRSEPSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP     K S +      ++N GC  +      + + + +G   K+  G       LQT   L +   + E  +    ++++ W E +   ++  W              R Y+E +    A   +Q++       FT  +L+  L   +    +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC          +  P   TE +S    + P  Y       +    ++S +   TE+   P T   +          + PV     +LS +S  STS +  L S   ++    LEP   K       W       K +   ++    ++ VIL+ L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN +    WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR I + YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:   69 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNATGKLVSAHALQTMFQLMTPKQMYEHFRGYDYVSHINWNEDRAAAILEAW-------------QRTYVEVVHQSVAPNSTQKVLP-----FTTTTLDDILKSFSDVSVI---RVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTEPHSNTRYSPPPPYTSHSFAHETHITMQSTVQLRTEYD--PHTHVYYTTAEPRSEISVQPVTVTQDNLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVILLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENKQLPQMWLHYFRDWLQGLQDAFDSDWETGRIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRVICNNYT-SLGLSSYPNGYPFLFWEQYISLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 954          
BLAST of patched-like protein vs. Ensembl Mouse
Match: Ptch1 (patched 1 [Source:MGI Symbol;Acc:MGI:105373])

HSP 1 Score: 219.55 bits (558), Expect = 3.904e-57
Identity = 237/946 (25.05%), Postives = 431/946 (45.56%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCPNRLKQKPSYES-----IVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLK-------RQTPNDSTESYS----AVPRQYDC---VRKDSNLLKSKIIFSTEFTTAPDT---FIPNNVHQYCEINPV-----DLSPRSEPSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP     K S +      ++N GC  +      + + + +G   K+  G       LQT   L +   + E  +    ++++ W E +   ++  W              R Y+E +    A   +Q++       FT  +L+  L   +    +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC          +  P   TE +S    + P  Y       +    ++S +   TE+   P T   +          + PV     +LS +S  STS +  L S   ++    LEP   K       W       K +   ++    ++ VIL+ L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN +    WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR I + YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  206 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNATGKLVSAHALQTMFQLMTPKQMYEHFRGYDYVSHINWNEDRAAAILEAW-------------QRTYVEVVHQSVAPNSTQKVLP-----FTTTTLDDILKSFSDVSVI---RVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTEPHSNTRYSPPPPYTSHSFAHETHITMQSTVQLRTEYD--PHTHVYYTTAEPRSEISVQPVTVTQDNLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVILLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENKQLPQMWLHYFRDWLQGLQDAFDSDWETGRIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRVICNNYT-SLGLSSYPNGYPFLFWEQYISLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1091          
BLAST of patched-like protein vs. Ensembl Mouse
Match: Ptch2 (patched 2 [Source:MGI Symbol;Acc:MGI:1095405])

HSP 1 Score: 210.69 bits (535), Expect = 1.098e-54
Identity = 241/1029 (23.42%), Postives = 429/1029 (41.69%), Query Frame = 1
Query:  367 FETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTH----NXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCP----NR-LKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLL----LQST----------SHVLETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYD--CVRKDSNLLKSKIIFSTEFTTAPD---TFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRC----C--WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHV---ALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYT--NNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
             ETD+  LW+   SR+  E  +     G   E+     +L  + H    N L      L     L         Y + S+  +  C +  +P    + +  +   +E L PC I++PL+CFWEG+KL         S Y   R   I W + +  Q+        ++   F EL  +A +   ++ +PCLD  D  CP    NR  +Q P+    ++ GC         + + + +G   R LQ  LL    LQST           H     + +++ W E +   V+  W ++  Q            E++P  NA   SQ+I     + F++ +L+  L   ++  T     +  G ++ML    + +   +  +S   + +    L+  A+ SGLGL A +G TFNA TTQV+PF+ +G+G++++ +L   ++K           P  + + L    T + ++    ++      ++P+P +R F +Q   ++         ++P +L LD  RR   R+D+LCC     +P  S +    +P++     V      L + +   T    +     T +P   H         LSP S+P  S  +    S  + L  +     +  C    C  W   +     F  +++    +  V+L    ++ + LY A  +  GL    + PR + E  ++  +   F      +VT+  F+Y ++Q  L  LHQ   +L  V      +  + WL  +  WL+ IQ+ FD+D  +  I  +    RN S++G L   L++Q G   E +++ +L+T +LV + G +    FY+ L VW S   +         YP    +  D +  +             L + +  PL+F    +   G   Q+  DFV+ +    +  T      +   P G+ F   EQYL LR   ++   IL +  F++  L +     + L  L+L+   +     M    I L+A   V+ + S G+G  F++ + + ++
Sbjct:   78 IETDLEQLWVEVGSRVSQELHYTKEKLGE--EAAYTSQMLIQTAHQEGGNVLTPEALDLHLQAALTASKVQVSLYGK-SWDLNKICYKSGVP---LIENGMIERMIEKLFPCVILTPLDCFWEGAKL------QGGSAYLPGRP-DIQWTNLD-PQQLLEELGPFASLEGFRELLDKAQVGQAYVGRPCLDPDDPHCPPSAPNRHSRQAPNVAQELSGGCHGFSHKFMHWQEELLLGGTARDLQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASMVLQAWQRRFVQLA---------QEALP-ANA---SQQI-----HAFSSTTLDDILRAFSEVST---TRVVGGYLLMLAYACVTMLRWDCAQSQGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDIFLLAHAFTK----APPDTPLPERMGECLRSTGTSVALTSVNNMVAFFMAALVPIPALRAFSLQAAIVVGCNFAAVMLVFPAILSLDLRRRHRQRLDVLCCF---SSPC-SAQVIQMLPQELGDRAVPVGIAHLTATVQAFTHCEASSQHVVTILPPQAHL--------LSPASDPLGSELYSPGGSTRDLLSQEEGTGPQAACRPLLCAHWTLAHFARYQFAPLLLQTRAKALVLLFFGALLGLSLYGATLVQDGLALTDVVPRGTKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRTWLHYYRSWLQGIQAAFDQDWASGRITCHSY--RNGSEDGALAYKLLIQTGNAQEPLDFSQLTTRKLVDKEGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTG----------ENLRIPAAQPLEFAQFPFLLHGL--QKTADFVEAIEGARAACTEAGQAGVHAYPSGSPFLFWEQYLGLRRCFLLAVCILLVCTFLVCALLLLSPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVVILVASIGIGVEFTVHVALGFL 1041          
BLAST of patched-like protein vs. Ensembl Mouse
Match: Ptch1 (patched 1 [Source:MGI Symbol;Acc:MGI:105373])

HSP 1 Score: 116.316 bits (290), Expect = 3.911e-26
Identity = 108/432 (25.00%), Postives = 199/432 (46.06%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKP-SYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCC 1884
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP    N+   KP     ++N GC  +      + + + +G   K+  G       LQT   L +   + E  +    ++++ W E +   ++  W              R Y+E +    A   +Q++       FT  +L+  L   +    +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC
Sbjct:  154 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNATGKLVSAHALQTMFQLMTPKQMYEHFRGYDYVSHINWNEDRAAAILEAW-------------QRTYVEVVHQSVAPNSTQKVLP-----FTTTTLDDILKSFSDVSVI---RVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCC 547          
BLAST of patched-like protein vs. Ensembl Mouse
Match: Ptch2 (patched 2 [Source:MGI Symbol;Acc:MGI:1095405])

HSP 1 Score: 80.4925 bits (197), Expect = 2.056e-15
Identity = 64/255 (25.10%), Postives = 103/255 (40.39%), Query Frame = 1
Query:  367 FETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTH----NXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASC----PNR-LKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQSTSHV 1104
             ETD+  LW+   SR+  E  +     G   E+     +L  + H    N L      L     L         Y + S+  +  C +  +P    + +  +   +E L PC I++PL+CFWEG+KL         S Y   R   I W + +  Q+        ++   F EL  +A +   ++ +PCLD  D  C    PNR  +Q P+    ++ GC         + + + +G   R LQ  LL     H+
Sbjct:   78 IETDLEQLWVEVGSRVSQELHYTKEKLGE--EAAYTSQMLIQTAHQEGGNVLTPEALDLHLQAALTASKVQVSLYGK-SWDLNKICYKSGVP---LIENGMIERMIEKLFPCVILTPLDCFWEGAKL------QGGSAYLPGRP-DIQWTNLD-PQQLLEELGPFASLEGFRELLDKAQVGQAYVGRPCLDPDDPHCPPSAPNRHSRQAPNVAQELSGGCHGFSHKFMHWQEELLLGGTARDLQGQLLRGLAEHL 318          
BLAST of patched-like protein vs. UniProt/SwissProt
Match: sp|Q98864|PTC1_DANRE (Protein patched homolog 1 OS=Danio rerio OX=7955 GN=ptch1 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.023e-57
Identity = 259/1139 (22.74%), Postives = 483/1139 (42.41%), Query Frame = 1
Query:  175 RKSYLMVNMYIKGHSSLKC-KTNIKIWLKLKY----FCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGS---IETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLKQK-----PSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNR-------GLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPD------TFIPNNVHQYCEINPVDLS---PRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCC------WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPML------FMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSP 3384
            R SY      +K  S  K       +W++ ++    F     ++ H  K+L IG+   G   +G +    ETD+  LW+   SR+  E  +     G +    S   I+T  Q  T N L     LL     L         Y + S+  +  C +  +P    + +  +   ++ L PC I++PL+CFWEGSKL         S Y       I W + +   +      + ++   F E+  +A +   ++++PCLD +D  CP+    K     P+  + +  GC    +    + + + +G   KD++        LQT  LL S   + E  K    I+++ W E K   ++  W +K  + V+H         SIP  ++         S+ Y F+  +LN  +   +    +    +  G ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+P + +G+G++++ +L   +++     R  I         L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC           ++ Q  +D+ +++   P                      FT          T +P           + LS   P ++P  S+ F  +SS  + L       +   C       W       + +  +++    +  V++V + ++ + LY    +  GL    I PRD+ E+ +I  + + F F N  +VT + F+Y  +Q  LLQLH   +++ +V    N K    WL  F  WL+ +Q+ FD D +   I  +    RN +++G L    ++Q G   E  NY +L++ RLV  +G +    FY++L VW S   + Y       YP    +  D +  +             L + +  PL+F    ++  G + + + ++ +++VR+I   +     +   P G  F   EQY+ LR+  ++ +S++LA    V ++L +N +              + PM+       M L  I L+A   V+ + S G+G  F++ + + ++  T +   +T +   ME   +P
Sbjct:   36 RPSYCHAAFALKQISKGKAVGQKAPLWIRARFQAFLFSLGCHIQRHCGKVLFIGLLVFGALSVGLRVAAIETDIEKLWVEAGSRVSKELRYTKEKQGEESVFTSQMLIQTPKQEGT-NILTQEALLLHLEAALSASKVQVSLYGK-SWDLNKICFKSGVP---IIENVMIERMIDKLFPCMIVTPLDCFWEGSKL------QGGSAYLPGMP-DIQWMNLD-PLKLMEELSQFTSLEGFREMLDKAQVGHAYMNRPCLDPSDTDCPHSAPNKDPWQVPNIAAELQGGCHGFSKKFMHWQEELILGERVKDSQNALQSAEALQTMFLLMSPKQLYEHFKDDYEIHDINWNEDKATAILESWQRKFVE-VVH--------GSIPQNSS---------SNVYAFSTTTLNDIMKSFSDVSVI---RVAGGYLLMLAYACVTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVLPSLALGIGVDDMFLLGHSFTET----RSNIPFKERTGDCLRRTGTSVALTSVNNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMALLIFPAILSLDLHRREDKRLDILCCFYSPCSSRVIQIQPQELSDANDNHQRAPATPTYTGSTITTSTHITTTVQAFTQCDAAGQHIVTILPPTSQISTTPPSMVLSTPTPTTDPYGSQVFTTSSSTRDLLAQVEEPKEGRECVPLPFFRWNLSSFAREKYAPLLLKPETKTVVVVVFVALLSLSLYGTTMVHDGLYLTDIVPRDTQEYEFITAQFKYFSFYNMYLVTMDGFDYARSQRQLLQLHNAFNSVKYVVKDGNHKLPRMWLHYFQDWLKGLQATFDADWEAGKITYDSY--RNGTEDGALAYKPLIQTGSKKEPFNYSQLTSRRLVDGDGLIPPEVFYIYLTVWVSNDPLGYAASQANFYPHPREWIHDKYDTTG----------ENLRIPAAEPLEFAQFPFYLNGLRQASDFIEAIESVRTICEEFMRQ-GIKNYPNGYPFLFWEQYIGLRHWFLLSISVVLACTFLVCAILLLNPW-------TAGVIVFILPMMTVELFGIMGLIGIKLSAIPVVILIASVGIGVEFTVHIALGFL--TAIGDRNTRSAVAMEHMFAP 1114          
BLAST of patched-like protein vs. UniProt/SwissProt
Match: sp|Q13635|PTC1_HUMAN (Protein patched homolog 1 OS=Homo sapiens OX=9606 GN=PTCH1 PE=1 SV=2)

HSP 1 Score: 221.476 bits (563), Expect = 6.695e-57
Identity = 238/948 (25.11%), Postives = 428/948 (45.15%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKPSYESIV-NEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINP------VDLSPRSE------------------PSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP    N+   KP   ++V N GC  +      + + + +G   K++ G       LQT   L +   + E  K    ++++ W E K   ++  W              R Y+E +    A+  +Q++   SF   T + +  +      D +++   + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC     T    +      P+ Y     ++         S  F       + + V    E +P          PRSE                   STS +  L S   ++    LEP   K       W       K +   ++    ++ VI + L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN    K WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR+I S YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  220 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAW-------------QRTYVEVVHQSVAQNSTQKVL--SFTTTTLDDILKSF----SDVSVIR--VASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCF----TSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYT-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1105          
BLAST of patched-like protein vs. UniProt/SwissProt
Match: sp|Q61115|PTC1_MOUSE (Protein patched homolog 1 OS=Mus musculus OX=10090 GN=Ptch1 PE=1 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 2.731e-56
Identity = 237/946 (25.05%), Postives = 431/946 (45.56%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNF--FYELFKEAGIKSGFISKPCLDVTDASCPNRLKQKPSYES-----IVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLK-------RQTPNDSTESYS----AVPRQYDC---VRKDSNLLKSKIIFSTEFTTAPDT---FIPNNVHQYCEINPV-----DLSPRSEPSTSRSFPLNSSVDNN----LEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +E L PC II+PL+CFWEG+KL         + Y   +   + W +F+   EF    K+  NY    + E+  +A +  G++ +PCL+  D  CP     K S +      ++N GC  +      + + + +G   K+  G       LQT   L +   + E  +    ++++ W E +   ++  W              R Y+E +    A   +Q++       FT  +L+  L   +    +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R+D+ CC          +  P   TE +S    + P  Y       +    ++S +   TE+   P T   +          + PV     +LS +S  STS +  L S   ++    LEP   K       W       K +   ++    ++ VIL+ L ++ + LY    +  GL    I PR++ E+ +I  + + F F N  IVT++ +Y N Q +L  LH+   N+ +V L EN +    WL  F  WL+ +Q  FD D +   I+ N    +N S +G+L   L+VQ G   + I+  +L+  RLV  +G ++   FY++L  W S   V Y      + P    +  D    + Y  E      + L + +  P+++    ++  G + + + ++ ++ VR I + YT +L L + P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  206 IEYLYPCLIITPLDCFWEGAKL------QSGTAYLLGKP-PLRWTNFD-PLEFLEELKKI-NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNATGKLVSAHALQTMFQLMTPKQMYEHFRGYDYVSHINWNEDRAAAILEAW-------------QRTYVEVVHQSVAPNSTQKVLP-----FTTTTLDDILKSFSDVSVI---RVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTEPHSNTRYSPPPPYTSHSFAHETHITMQSTVQLRTEYD--PHTHVYYTTAEPRSEISVQPVTVTQDNLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTK-------WTLSSFAEKHYAPFLLKPKAKVVVILLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENKQLPQMWLHYFRDWLQGLQDAFDSDWETGRIMPNNY--KNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDK---ADYMPE------TRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRVICNNYT-SLGLSSYPNGYPFLFWEQYISLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1091          
BLAST of patched-like protein vs. UniProt/SwissProt
Match: sp|O35595|PTC2_MOUSE (Protein patched homolog 2 OS=Mus musculus OX=10090 GN=Ptch2 PE=2 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 7.681e-54
Identity = 241/1029 (23.42%), Postives = 429/1029 (41.69%), Query Frame = 1
Query:  367 FETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTH----NXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCP----NR-LKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLL----LQST----------SHVLETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYD--CVRKDSNLLKSKIIFSTEFTTAPD---TFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRC----C--WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHV---ALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYT--NNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
             ETD+  LW+   SR+  E  +     G   E+     +L  + H    N L      L     L         Y + S+  +  C +  +P    + +  +   +E L PC I++PL+CFWEG+KL         S Y   R   I W + +  Q+        ++   F EL  +A +   ++ +PCLD  D  CP    NR  +Q P+    ++ GC         + + + +G   R LQ  LL    LQST           H     + +++ W E +   V+  W ++  Q            E++P  NA   SQ+I     + F++ +L+  L   ++  T     +  G ++ML    + +   +  +S   + +    L+  A+ SGLGL A +G TFNA TTQV+PF+ +G+G++++ +L   ++K           P  + + L    T + ++    ++      ++P+P +R F +Q   ++         ++P +L LD  RR   R+D+LCC     +P  S +    +P++     V      L + +   T    +     T +P   H         LSP S+P  S  +    S  + L  +     +  C    C  W   +     F  +++    +  V+L    ++ + LY A  +  GL    + PR + E  ++  +   F      +VT+  F+Y ++Q  L  LHQ   +L  V      +  + WL  +  WL+ IQ+ FD+D  +  I  +    RN S++G L   L++Q G   E +++ +L+T +LV + G +    FY+ L VW S   +         YP    +  D +  +             L + +  PL+F    +   G   Q+  DFV+ +    +  T      +   P G+ F   EQYL LR   ++   IL +  F++  L +     + L  L+L+   +     M    I L+A   V+ + S G+G  F++ + + ++
Sbjct:   78 IETDLEQLWVEVGSRVSQELHYTKEKLGE--EAAYTSQMLIQTAHQEGGNVLTPEALDLHLQAALTASKVQVSLYGK-SWDLNKICYKSGVP---LIENGMIERMIEKLFPCVILTPLDCFWEGAKL------QGGSAYLPGRP-DIQWTNLD-PQQLLEELGPFASLEGFRELLDKAQVGQAYVGRPCLDPDDPHCPPSAPNRHSRQAPNVAQELSGGCHGFSHKFMHWQEELLLGGTARDLQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASMVLQAWQRRFVQLA---------QEALP-ANA---SQQI-----HAFSSTTLDDILRAFSEVST---TRVVGGYLLMLAYACVTMLRWDCAQSQGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDIFLLAHAFTK----APPDTPLPERMGECLRSTGTSVALTSVNNMVAFFMAALVPIPALRAFSLQAAIVVGCNFAAVMLVFPAILSLDLRRRHRQRLDVLCCF---SSPC-SAQVIQMLPQELGDRAVPVGIAHLTATVQAFTHCEASSQHVVTILPPQAHL--------LSPASDPLGSELYSPGGSTRDLLSQEEGTGPQAACRPLLCAHWTLAHFARYQFAPLLLQTRAKALVLLFFGALLGLSLYGATLVQDGLALTDVVPRGTKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRTWLHYYRSWLQGIQAAFDQDWASGRITCHSY--RNGSEDGALAYKLLIQTGNAQEPLDFSQLTTRKLVDKEGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTG----------ENLRIPAAQPLEFAQFPFLLHGL--QKTADFVEAIEGARAACTEAGQAGVHAYPSGSPFLFWEQYLGLRRCFLLAVCILLVCTFLVCALLLLSPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVVILVASIGIGVEFTVHVALGFL 1041          
BLAST of patched-like protein vs. UniProt/SwissProt
Match: sp|Q9Y6C5|PTC2_HUMAN (Protein patched homolog 2 OS=Homo sapiens OX=9606 GN=PTCH2 PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 6.132e-50
Identity = 248/1086 (22.84%), Postives = 451/1086 (41.53%), Query Frame = 1
Query:  217 SSLKCKTNIKIWLKLKYFCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGS---IETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCP-----NRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYD--CVRKDSNLLKSKIIFSTEFTTAPD---TFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRC----C--WKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHV---ALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNF--TPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITS--RYTNNLSLPTIPIGNIFTLSEQYLKLRYQ-LVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
             SLK    ++ + +   F     ++ H  K+L +G+   G   LG +    ET++  LW+   SR+  E  +     G +    S   I+T  Q    N L      L     L         Y + S+  +  C +  +P    + +  +   +E L PC I++PL+CFWEG+KL         S Y   R   I W + +  ++        ++   F EL  +A +   ++ +PCL   D  CP     +  +Q P+    ++ GC         + + + +G   +D +G       LQ+  LL S   + E  +     +++ W E +   V+  W ++  Q            E++P  NA   SQ+I   S     +     +           A  +  G ++ML    + +   +  +S   + +    L+  A+ SGLGL A +G TFNA TTQV+PF+ +G+G+++V +L   +++ +           P+ + + +C      ++++ S +     L A  ++P+P +R F +Q   ++         ++P +L LD  RR   R+D+LCC     +   S +    +P++     V      L + +   T    +     T +P   H         + P S+P  S  F    S  + L  +    ++  C    C  W   +     F  +++    +  V+++   ++ + LY A  +  GL    + PR + E  ++  +   F      +VT+  F+Y ++Q  L  LHQ   +L  V      +  + WL  +  WL+ IQ+ FD+D  +  I  +    RN S++G L   L++Q G   E +++ +L+T +LV R G +    FY+ L VW S   +         YP    +  D +  T    R  P+             PL+F    +  +G   Q+  DFV+ +    +         +   P G+ F   EQYL LR   L+ V I+L     V +LL +N + A ++  +L   ++      M    I L+A   V+ + S G+G  F++ + + ++
Sbjct:   28 GSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLFLGLLAFGALALGLRMAIIETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTARQ-EGENILTPEALGLHLQAALTASKVQVSLYGK-SWDLNKICYKSGVP---LIENGMIERMIEKLFPCVILTPLDCFWEGAKL------QGGSAYLPGRP-DIQWTNLD-PEQLLEELGPFASLEGFRELLDKAQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLGGMARDPQGELLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASTVLQAWQRRFVQLA---------QEALP-ENA---SQQIHAFSSTTLDDILHAFSEVS--------AARVVGGYLLMLAYACVTMLRWDCAQSQGSVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDVFLLAHAFTEALPGT--------PLQERMGECLQRTGTSVVLTSINNMAAFLMA-ALVPIPALRAFSLQAAIVVGCTFVAVMLVFPAILSLDLRRRHCQRLDVLCCF----SSPCSAQVIQILPQELGDGTVPVGIAHLTATVQAFTHCEASSQHVVTILPPQAHL--------VPPPSDPLGSELFSPGGSTRDLLGQEEETRQKAACKSLPCARWNLAHFARYQFAPLLLQSHAKAIVLVLFGALLGLSLYGATLVQDGLALTDVVPRGTKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRTWLHYYRNWLQGIQAAFDQDWASGRITRHSY--RNGSEDGALAYKLLIQTGDAQEPLDFSQLTTRKLVDREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIPPA------------QPLEFAQFPFLLRGL--QKTADFVEAIEGARAACAEAGQAGVHAYPSGSPFLFWEQYLGLRRCFLLAVCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVEL-FGIMGFLGIKLSAIPVVILVASVGIGVEFTVHVALGFL 1041          
BLAST of patched-like protein vs. TrEMBL
Match: D2ILS0 (Patched-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2375.51 bits (6155), Expect = 0.000e+0
Identity = 1317/1327 (99.25%), Postives = 1320/1327 (99.47%), Query Frame = 1
Query:  190 MVNMYIKGHSSLKCKTNIKIWLKLKYFCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQSTSHVLETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLVRNGKVDERKFYLFLNVWRSMSVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSDHKTRSPFVRNSDSYRCKSRPSHKSSTKSFRSQVSRNGSKFDLTNDNSAHGKLXXXXXXXXXXXXXXXXXDCCDNDHINNXXXXXXXXXXXXXXXXXXXXXXENDSRFVRQNVESSLIIHYSIDGQGKSPKKDANFPPELAVKTSFKYRQPTGQDQQDGH 4170
            MVNMYIKGHSSLKCKTNIKIWLKLKYFCYQKFVRYHHWKILLIGIGFLGLC LGFKSV+FETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNNLLSTEFLLEHLQLLQNVVNVTLQYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGI+SGFISKPCLDVTDASCPNRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQSTSHVLETMKINNLEWPESK+QDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTNNSLNSALNQANKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTSTSLLIAAILSGLGLMAAIGFTFN LTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHIIVLVPVQITVILVTLLIIVMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLVRNGKVDERKFYLFLNVWRSMSVEYETQPCLLYPKIEPFTVDNF PSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFLASILATLLLSSSILSPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTE  PSSTEAQPDMEL VSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSDHKTRSPFVRNSDSYRCKSRPSHKSSTKSFRSQVSRNGSKFDLTNDNSAHGKLSIIPEESSSVQSSLKSKDC DNDHINNSSSSSDSSSSSSSSSSDSSQSQENDSRFVRQNVESSLIIHYSIDGQGKSPKKDANFPPELAVKTSFKYRQPTGQDQQDGH
Sbjct:    1 MVNMYIKGHSSLKCKTNIKIWLKLKYFCYQKFVRYHHWKILLIGIGFLGLCLLGFKSVQFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNNLLSTEFLLEHLQLLQNVVNVTLQYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIRSGFISKPCLDVTDASCPNRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQSTSHVLETMKINNLEWPESKIQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTNNSLNSALNQANKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTSTSLLIAAILSGLGLMAAIGFTFNTLTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHIIVLVPVQITVILVTLLIIVMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLVRNGKVDERKFYLFLNVWRSMSVEYETQPCLLYPKIEPFTVDNFIPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFLASILATLLLSSSILSPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTE--PSSTEAQPDMELGVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSDHKTRSPFVRNSDSYRCKSRPSHKSSTKSFRSQVSRNGSKFDLTNDNSAHGKLSIIPEESSSVQSSLKSKDCRDNDHINNSSSSSDSSSSSSSSSSDSSQSQENDSRFVRQNVESSLIIHYSIDGQGKSPKKDANFPPELAVKTSFKYRQPTGQDQQDGH 1325          
BLAST of patched-like protein vs. TrEMBL
Match: D0VYP1 (Patched OS=Dugesia japonica OX=6161 GN=Djptc PE=2 SV=1)

HSP 1 Score: 1650.18 bits (4272), Expect = 0.000e+0
Identity = 923/1327 (69.56%), Postives = 1123/1327 (84.63%), Query Frame = 1
Query:  190 MVNMYIKGHSSLKCKTNIKIWLKLKYFCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQSTSHVLETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYS---AVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLVRNGKVDERKFYLFLNVWRSMSVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSDHKTRSPFVRN-SDSYRCKSRPSHKSSTKSFRSQVSRNGSKFDLTNDNSAHGKLXXXXXXXXXXXXXXXXXDCCDNDHINNXXXXXXXXXXXXXXXXXXXXXXENDSRFVRQNVESSLIIHYSIDGQGKSPKKDANFPPELAVKTSFKYRQPTGQDQ 4158
            MV+MYIKGH+SLKCKTN K W KLKYF YQ+FV+YHHWKILL+GIGFLGLC LG+KS++F+ D+MNLWIYNSSRLHNETSFI   +   I+SGS+ETILQVS+ NNLLSTE+LLEHLQL+Q+++ +T+QYD R+FTFSDFCQRVQLPK+H LHD+S+RVSVEN+MPC+IISPLNCFWEGSKLLD+ +K K SNYDE +SIKIDWK FNISQEFFYSF++ S+Y FF ELF+EAGIKSGF+SKPC+DVTD SCPNR   +  YESI+ +GC+QIGE+MDKYSKS+FIGK+NRGLQT LLLQS+SHVLETMKINNL+WPESK+  VM +WL KL+QTVI++NS+RP L SIPYRN KFQSQR+RKSSFYVFTNN+LN+AL+ A+ DETLL KYL S G+VMLF+VL+F+SS+NLVRSHCWLA+TST LL+ AI+SGLGLMAA+GFTF A+TTQVVPF++VG+GL+EVIILTKKYS  ID  R K N+P+PVAQTLYDCATILMVSFS+KL+VL A  +IP+PLMR+FCIQ++FI  LQTGVN FLYPCLL+LD  RR+SNRID+LCCLLKRQ+ ++  ES S     PRQYD VRK+++   S+I+FSTEFTT+P+T IPNNVHQYCEINP+D   RSEPSTS+SF  + SVD+N E K ++N +H+CCWKF YRLSKTFLHII+LVPVQITVIL+T+++IVMGLYSA+NIDCGL+ +SIF RDSNE++Y+++ETE FR QNFEI+TKE +Y + Q+ +LQLH EI+ L  V LLENGKFWLSSFI WL++IQ+DFD D+KNK IL+NGTW +NASKNGLL MTL+VQDGESINY KL+TSRL+++ KVDE KFYL LNVWRS+SV++++QPCLL+P+I PF++D+F P++Y KEPSVIRMSGLNLF+N+PL+FV+CKYF KG++ QEEL+FVKT+RSITSR+TNN S+PTIPIGNIF+ SEQYLKLRYQL+IVSIILA+GMFVISLLAINHFL S+LATLLLSSS+LSPMLFMN YQ+PLNATSGVMALWSGGLGFRFSLFLIVS+VEQ+++P  +T   P +   V   S       + E V ++  G +  +   VNKQK I++ERAFN+V C KAVFSTFLGMAFI+MTDI FLW NFM++P VGL+HSLLNYYYLAPIFCFYLIPK+  K+R+ F +    SYRCKS+ ++  S+K +RS  SR+ SKFD  ND+  HGKLSIIPEESSS+ SS+KS +  +N HIN             SSS  S   + N + F++QN+ESSL+I YS+DGQGKS KK+ +F PELAVKTSFKYRQP GQD 
Sbjct:    1 MVSMYIKGHNSLKCKTNFKNWFKLKYFRYQEFVKYHHWKILLVGIGFLGLCLLGYKSMKFDKDIMNLWIYNSSRLHNETSFIPTTT-ENIDSGSVETILQVSSDNNLLSTEYLLEHLQLMQSIIKLTIQYDGRAFTFSDFCQRVQLPKMHDLHDKSIRVSVENIMPCKIISPLNCFWEGSKLLDYDTKMKISNYDEQKSIKIDWKFFNISQEFFYSFQDRSDYKFFIELFQEAGIKSGFVSKPCIDVTDGSCPNRHNSQSDYESIIKQGCSQIGENMDKYSKSLFIGKNNRGLQTLLLLQSSSHVLETMKINNLDWPESKISHVMKMWLNKLRQTVINYNSNRPLLGSIPYRNNKFQSQRLRKSSFYVFTNNALNAALSHASNDETLLVKYLISSGLVMLFIVLLFMSSENLVRSHCWLAITSTLLLVIAIISGLGLMAAVGFTFTAITTQVVPFLVVGIGLDEVIILTKKYSNTIDSFRLKKNYPNPVAQTLYDCATILMVSFSVKLLVLCATAIIPIPLMRSFCIQVIFITALQTGVNVFLYPCLLYLDFARRQSNRIDILCCLLKRQSSHEDLESQSESQTTPRQYDFVRKETDFSNSRIVFSTEFTTSPNTLIPNNVHQYCEINPID-KQRSEPSTSKSFHRSHSVDSNNEMKLMRNPKHQCCWKFRYRLSKTFLHIIMLVPVQITVILITIMVIVMGLYSAINIDCGLILDSIFSRDSNEYNYVRFETETFRLQNFEIITKELDYIHQQESVLQLHHEINELAQVELLENGKFWLSSFIFWLKKIQNDFDNDIKNKRILSNGTWMKNASKNGLLAMTLLVQDGESINYGKLTTSRLIKDEKVDENKFYLLLNVWRSVSVDFDSQPCLLFPQIAPFSIDSFLPNEYPKEPSVIRMSGLNLFTNNPLKFVSCKYFLKGRTPQEELEFVKTIRSITSRFTNNQSVPTIPIGNIFSFSEQYLKLRYQLLIVSIILAVGMFVISLLAINHFLPSVLATLLLSSSLLSPMLFMNFYQLPLNATSGVMALWSGGLGFRFSLFLIVSFVEQSDIP--ATGKTPSISEIVQSQSSTN---SSSEDVIRNRTGWMAHMK-CVNKQKQIQIERAFNEVQCDKAVFSTFLGMAFILMTDIGFLWHNFMMLPLVGLIHSLLNYYYLAPIFCFYLIPKTPQKSRNYFDKKPKSSYRCKSQNANIYSSKPYRSHSSRDISKFDENNDSFTHGKLSIIPEESSSILSSVKSTNSHEN-HIN------------DSSSDSSQSQENNTTHFMKQNIESSLVIQYSVDGQGKS-KKETSFSPELAVKTSFKYRQPMGQDH 1305          
BLAST of patched-like protein vs. TrEMBL
Match: A0A0U2W010 (Patched1 (Fragment) OS=Novocrania anomala OX=317945 GN=ptc1 PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 2.919e-69
Identity = 271/1089 (24.89%), Postives = 481/1089 (44.17%), Query Frame = 1
Query:  247 IWLK--LKYFCYQK--FVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKL-HYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLK-----QKPSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLE----TMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVML-FVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQT-------PNDSTESYSAVP--RQYDCVRKDSNL-LKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKR-----------------HR--CCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGE---SINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMSVEYETQPCLLYPKIEPFTVDNFT--PSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEEL-DFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSI-ILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            +WL+  L+ + Y    F++ H  K+L +G+  L LC +G K+   ET+V  LW+    RL  E ++     G    S S   I    T +++L  + LL HLQ +     +T+  D  ++ F D C     P       DR L    +N++PC II+PL+CFWEG+KLL   +      +    S  I W + N       +  +    +   EL   AGI S +  KPCLD TD  CP         Q P   + +  GC         + + + +G   K+  G       LQ+ + L     + E    T K+N+++W + K + ++  W +K  Q V                      Q+   ++    +  S  S ++   K   L    +  G V+ML +  +  +   N V S   + +    L+   + +GLG+ +  G  FNA TTQ++PF+ +GLG++++ +L   +++N +  +  I +     + L      ++++    +       +IP+P +R F +Q   ++         ++P ++ +D  RRE  R+D+ CC     +       P     S S  P  R+       SN+ L   I  ++           +  H    + P    P S+   S    L++    +L P    +++                 HR  C W   +     +  ++    V++ V+++   ++ +G++    +  GL    I PR++NEF ++  +++ F F N  IVTK+ +Y N Q +L Q H+E   +  +   E+G   +FWL  F  WL  +Q  FDRD     I  + TW  NA+  G+L   L++Q G+    ++  ++ST RL+  NG ++ + FY +L  W S          L Y   E     NF   P+K+  + +    + L +  + PL +V   ++    +  E + + ++ +RSI   YT    +PT P G  FT  EQYL LR+ L++  I +L +   VI+++ +N + A ++  +L  + +     FM +  I L+A   V+ + S G+G  F++ + V ++
Sbjct:   62 LWLRWHLQKYLYGLGCFIQRHCGKVLFVGLLMLSLCCIGLKTATIETNVEKLWVEEGGRLEQELTYTKDQLGEGSGSTSQIIIQTPKTGSSILRKDSLLTHLQAVLAATQITVVMDDITWKFKDICYMATFPSFDEAFIDRIL----DNIVPCVIITPLDCFWEGAKLLGPENPITVPGF----STAIKWTNLN-PLLLVDTLDKFFPMDGIRELLDRAGITSAYQEKPCLDPTDPECPATAPNKHSLQDPDIGASLTNGCTGFATKYMHWEEDLIVGGVRKNKTGHIVRAEALQSVVQLVGEKELYEYYQDTYKVNSIDWTQDKAKSILETWQRKFTQEV----------------------QKAVNATQDDLSAFSTTSLIDILQKFSQLSIARVALGYVLMLVYACISLLRWSNAVESQSGVGIAGVLLVALTVAAGLGMCSVFGIKFNASTTQILPFLALGLGVDDMFLLAHTFAENAN--KPDIFYMEQTGECLKRTGVAVLLTSVSNVCAFLMAAIIPIPALRAFSLQAATLVAFNLASILLVFPAIVSIDLYRREERRVDVFCCFTGSSSDRVIELNPGAKERSRSPPPSYREPSPPPTYSNVSLHQTIAHASN----------DGQHAVTVLGP----PESDSPVSGDASLSAVTATSLPPSVATSRQCLTGEEGLTCRERCAQTHRECCSWSLTWFAKTHYGPLLEKSSVKVFVVVLFGTLLGVGIWGITEVKDGLDLTDIVPRETNEFEFLDAQSKYFGFYNMYIVTKDLDYPNQQQLLYQYHREFKQVSKIIKKEDGSLPEFWLELFRQWLSDLQVAFDRDFSKGCITED-TWYANATAEGILGYKLLIQTGDVDSPLDKAQVSTMRLIDSNGNINPKAFYNYLTAWTS-------NDALAYGASEA----NFKPLPNKWYHDAA---DNELMIPKSQPLAYVQMSFYLNNLAQTENITETIRQIRSICDSYTEK-GIPTYPSGIPFTFWEQYLHLRFYLMLALICVLGVTFLVITIMLMNPWAAIVVEAVLAMTVVEL-FGFMGIVGIKLSAVPAVILIVSVGIGVEFTVHVCVGFL 1086          
BLAST of patched-like protein vs. TrEMBL
Match: C3YM07 (Patched protein-like protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=PTCH1 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.108e-66
Identity = 268/1094 (24.50%), Postives = 486/1094 (44.42%), Query Frame = 1
Query:  268 FCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETIL-------QVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFN---ISQEFFYSFKETSNY---NFFYELFKEAGIKSGFISKPCLDVTDASCPNRL-----KQKPSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLE----TMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCA--TILMVSFSIKLIVLSAL--TMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSK-----------------IIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSK----TFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTK-EFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGES---INYKKLSTSRLV-RNGKVDERKFYLFLNVW-RSMSVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            F   K ++ H  K+L +G+  + L  +  K  + ET+   LW+    RL  E  +     G ++ +     I         V THN L      +     +Q  +          +   D C    LP L  +      +++E L PC II+PL+CFWEGSKLL         NY    S  + W + N   + +E   S    ++Y   + F +LF +AGI +G+  KPCL+  D  CP        K+ P + S +  GCA       ++ + + +G   K+  G       LQT ++L   + + E      K++++ W  SK  +V+  W +K  + V  +NS    L            Q++   S     +   + +     +        + +G  +ML    + +   + VRS   + +    L+  ++ + LG    IG +FNA TTQV+PFV +GLG++++ ++   +S     C     +   + QT  +C   T + V+ +   I++S     ++P+P +RN+ IQ   ++         ++P ++  D  RR + R+D+ CCL          ++  TP + T+S  + P      R  +N+                     ++  T+  T P  +IP+NV     + P+     + PST+ S    + V  + E +  ++    CC K ++ LS     T+   +   PV+I V++   L++V G+Y    ++ GL    + P+ S E  +++ +++ F F N  IVT+ +++Y N Q  L  LH++   ++ + L   G   ++WLS F  WL  +Q+ FD D +   I  N  W  NA+  G++   L+VQ G++   IN  +L ++RL+  NG ++ + FY++L  W    +  Y      + P+ E + VD          P       L +  + P+ +    ++  G + + E +  +K VR +         +PT P+G  FT  EQY+ LRY L++    +   +FV+  + + +   +++   +L+   +     M L  I L+A   V+ + S G+G  F++ +  +YV
Sbjct:   29 FNTGKIIQLHCGKVLFVGVLVMVLLAVFLKDAKIETETEKLWVQVGGRLEEELRYTKESLGEEMGTDYQVIITTAKNEGDNVLTHNALNQHLQSVLAAADVQVELFGV------DWNMKDVCYVTSLPVLEGV----FAMTIEKLYPCVIITPLDCFWEGSKLLGPDRPVIIPNY----SSNVRWTNLNPLGMLEELNKSSDIMASYFPLDTFQDLFDKAGITTGYQEKPCLNPEDPECPETAPNKYTKEVPDFNSELTGGCAGFATKYMQWPEELIVGGLKKNQSGQITSAEALQTAIVLSQPNALYEYYKDDYKVHDIHWSPSKAGEVLEEWQRKFTEAV--YNSANDSL-----------GQQVHAFSSAALNDLLQDFSQTNYIR--------VAAGYCLMLVYACVTMLRRSAVRSQGGVGLAGVILVSMSVAAALGFCTLIGLSFNASTTQVLPFVALGLGVDDMFLVAHTFS-----CTTSSPNVAYLDQT-GECLRRTGVSVTLTSLSIIVSCFMGAIVPIPALRNYSIQSAVVVFFNYLSVILIFPAIISWDLERRRNKRLDIFCCLNSSSSNRVIRVREATPEEDTDSVRSEPLPRHSQRHQTNVTVQSTVETVTSLDNEGRTVTVVVPPTQTVTRP--WIPSNV-----VTPIG----TPPSTAESSSTRNLVSPDFETEGTESSNVLCCAKKNWTLSSFARNTYGPFLARFPVKIAVLVAFALLLVGGIYGTTTVEDGLDTTDVVPKGSREHDFLRLQSKYFSFYNMYIVTQSDYDYPNGQAGLDSLHEDFMRVNKIVLTPEGNLPEYWLSYFRQWLFDVQAHFDEDWQLGRIQRN-KWFYNATNEGVMGYKLLVQTGDNDNPINKDQLYSNRLIDSNGVINSKAFYIYLTAWVNDDTFAYTASQAAIRPEPEQWGVDRNDHDNLDTIPEY----ELRIPKSQPINYSQFSFYVSGLKGTSEYIQLIKEVREVCEES----EVPTYPLGVPFTYWEQYIFLRYYLMVALAAVLAAIFVVVAIVMVNPWLALIVVSVLAMMAVELFGVMGLLGIKLSAIPAVIIIASVGIGVEFTVHICFAYV 1061          
BLAST of patched-like protein vs. TrEMBL
Match: A0A1S3IK03 (protein patched homolog 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106165040 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 6.603e-66
Identity = 297/1224 (24.26%), Postives = 526/1224 (42.97%), Query Frame = 1
Query:  208 KGHSSLK-CKTNIKIWLKLKYFCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISR--VSGSKIESGSIETILQV--STHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLL--DHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSN---YNFFYELFKEAGIKSGFISKPCLDVTDASCP----NRL-KQKPSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLE----TMKINNLEWPESKVQDVMNLWLQKLQQTVIHF-------NSHRPYLESIPYRNAKF-QSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSF-------PLNSSVDNNLEPKPLKNKRHRC------CWKFHY-RLSKT-FLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESIN-YKK--LSTSRLVRN-GKVDERKFYLFLNVWRSM-SVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSI-ILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSD 3693
            KG +S   C   ++  L+ + F    F+  H  K+L +G+  L LC +G K+   ET+V  LW+    RL  E ++  +    GS I +   E ++Q   S  N L     LL    +L         YD  ++ FSD C +   P      D  +   +E L PC IISPL+CFWEG+KLL  DH + N  S++       + W + N  +      +   N        +    AGI +G++ K CLD TD  CP    N+L +Q+P   S +  GC         + + + +G   K+  G       +Q+ + L +   + E    + K+ ++++   K + ++  W +K  Q V          N H     S+     +F +   +R +  Y+F                            ++++ ++  +   + V+S   + +    L+  ++ +GLG+ + +G  FNA TTQ++PF+ +GLG++++ +L   +++N     ++I+      + L      ++++            +IP+P +R F +Q   +++        ++P ++ +D +R+E NR D+ CC     T    T+     PR+         + +        + T   T    + H    + P    P+S+   SR         P  SS    L P      R  C      C  F   RL+K+ +  ++   P +I V ++ + ++V G++  V +  GL    I PRD+NE+ ++  + + F F N  IVTK+   Y N Q ++  LH+E   ++ V   E+G    FWL  F  WL  +Q  FD+D  +  I  +G W  N+++ G L   L++Q G+  + Y+K   +TSRLV + G ++ + FY +L  W +  ++ Y+     + P+ + +  D     + R     I  +   L+S  P       Y +    +Q+ +  ++ +R I   YTNN  L   P G  FT  EQYL LR+ L++  I +L +   VI+L+ +N +   ++  +L    +     FM L  I L+A   V+ + S G+G  F++ + V ++                                        IGS        N++  I +E  F   P      ST LG+A ++ ++  F+ R F  +    +V  +LN   L P+      PK +
Sbjct:   65 KGKASGNTCALWLRWHLQKQLFNLGCFIERHCGKVLFVGLLLLCLCCIGLKTATIETNVEKLWVEEGGRLDQEIAYTQKHLGEGSGITN---EIVIQTPKSGKNILSKDSLLLHLRTVLAATQITVDMYDI-TWRFSDLCNKPSFPSFE---DSLVDQMLEPLTPCVIISPLDCFWEGAKLLGPDH-AVNAGSSFQFG---GLKWTNLN-PEHLLSQLRSMGNIFPVQAIEDFLARAGITTGYVRKSCLDPTDPECPFTAPNKLSQQEPDIGSELTGGCDGFATKYMHWEEDLIVGGVHKNRSGHIVRAEAIQSIVQLMAEKQMFEYYEDSYKVTSIDFTREKARAILEAWQRKFTQVVQEMGNGTQEDNLHGFSSTSLLDMLKEFSEVSYVRVALGYIF----------------------------MLVYAIISLMRWTDFVQSQSGIGMAGVLLVALSVAAGLGICSVLGIRFNASTTQIIPFLALGLGVDDMFLLAHTFAENAK--NKEISSKEQTGECLKRTGVTVLLTSITNASAFFMAAIIPIPALRAFVLQAAILVIFNCASILLVFPAIVSVDLIRKEENRADVFCCFPGTST----TDVVELAPRERHTEHVAPPVYREPSP-PPSYQTITHTSAGGD-HAITVLGP----PQSDSPVSRQVSLSSVGPPSASSSRQCLTPDEGPTCREHCAQTQQECCHFSLTRLAKSKYGPMLETTPAKILVGVLFIALLVFGVWGIVKVKDGLDLTDIVPRDTNEWKFLDAQGKYFGFYNMYIVTKDSINYPNQQKMMFALHKEFLKINKVIKKEDGTLPDFWLELFRQWLLDLQLAFDQDWSSGCITTDG-WFANSTEEGRLGYLLLIQTGDVDDPYRKEQAATSRLVNDQGIINPQAFYNYLTAWVTNDALAYDASMAEIKPEPQHWVYDPSDQMELR-----IPKAQAILYSQMPF------YLNNMVDNQDVIATIEEIRKICDSYTNN-GLAVYPSGIPFTFWEQYLHLRFYLLLALICVLGVTFLVITLVLMNPWAGFMVVMVLAMIVVEL-FGFMGLIGIKLSAIPAVILIVSVGIGVEFTVHICVGFIT--------------------------------------AIGS-------RNRRMRIALEHMF--APVIHGAISTLLGVAMLVGSEFDFIVRYFFNVLTALVVLGVLNGLILLPVLLSIFGPKGE 1175          
BLAST of patched-like protein vs. Ensembl Cavefish
Match: ptch2 (patched 2 [Source:NCBI gene;Acc:30181])

HSP 1 Score: 131.339 bits (329), Expect = 3.932e-30
Identity = 140/596 (23.49%), Postives = 264/596 (44.30%), Query Frame = 1
Query:  175 RKSYLMVNMYIKGHSSLKCKTNIKIWLKLKY----FCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGS---IETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNR-----LKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCC 1884
            R + L +N + KG ++ +      +W++ ++    F     ++ H  K+L IG+   G   +G +    ETD+  LW+   SR+  E  +     G +    S   I+T  Q  T N L     LL     L         Y + S+  +  C +  +P    + +  +   ++ L PC I++PL+CFWEGSKL         S Y       I W + +   +      + ++   F E+  +A +   ++++PCLD  D  CP+      L+Q P     +  GC+   +    + + + +G   K+++G       LQT  LL S   + E  K    I+++ W E K   ++  W +K  + V+H         SIP  ++         S+ Y F+  +LN  +   +    +    +  G ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G++++  L    S+    C ++               ++ + S +  +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCC
Sbjct:   38 RHAALALNHFNKGKAAGQ---RAPVWIRARFQALLFTLGCHIQRHCGKVLFIGLLVFGALSVGLRVAAIETDIEQLWVEAGSRVSRELRYTKEKQGEETVFTSQMLIQTPKQEGT-NILTQEALLLHLEAALSASKVQVSLYGK-SWDLNKICFKSGVP---IIENVMIERMIDKLFPCMIVTPLDCFWEGSKL------QGGSAYLPGMP-DIQWMNLD-PLKLMEQLSQFTSLEGFREMLDKAQVGHAYMNRPCLDPNDPDCPHSAPNKDLRQSPEIAEELQGGCSGFSKKFMHWQEELILGERAKNSQGSLQSAEALQTMFLLMSPKQLYEHFKDDYEIHDINWNEDKATAILESWQRKFVE-VVH--------SSIPQNSS---------SNVYAFSTTTLNDIMKSFSDVSVI---RVAGGYLLMLAYACVTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVLPFLALGIGVDDISNLLS--SERTGDCLRRTG------------TSVALTSIN-NMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSLDLHRREDKRLDILCC 581          

HSP 2 Score: 86.2705 bits (212), Expect = 2.114e-16
Identity = 91/407 (22.36%), Postives = 168/407 (41.28%), Query Frame = 1
Query: 2509 KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSDHKTRS 3708
            + WL  F  WL  +Q  FD D ++  I  +    RN +++G L   L++Q G   E  NY +L++ RLV  +G +    FY++L VW S   + Y       YP    +  D +  +             L + +  PL+F    ++  G + + + ++ +++VRS+   +     +   P G  F   EQY+ LR+  ++ +S++LA    V ++L +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++                           G+  TR   A                     +E  F   P      STFLG+  +  ++  F+ R F  +  +  +  +LN   L P+    + P ++    S
Sbjct:  716 RMWLHYFQDWLRGLQVSFDADWESGRITPDSF--RNGTEDGALAYKLLIQTGSKKELFNYSQLTSRRLVDDDGMIPPEVFYIYLTVWVSNDPLGYAASQANFYPHPHEWIHDKYDTTG----------ENLRIPAAEPLEFAQFPFYLNGLRQASDFIEAIESVRSVCEEFMRK-GIQNYPNGYPFLFWEQYIGLRHWFLLSISVVLACTFLVCAVLLLNPWTAGIIVFILAMMTVEL-FGIMGLIGIKLSAIPVVILIASVGIGVEFTVHVALGFLTA------------------------IGDRNTRSVAA---------------------LEHMF--APVMDGAISTFLGVLMLAGSEFDFIMRYFFAVLAILTLLGILNGLVLLPVLLSIMGPPAEGSNGS 1061          
BLAST of patched-like protein vs. Ensembl Cavefish
Match: ptch1 (patched 1 [Source:NCBI gene;Acc:103030480])

HSP 1 Score: 123.635 bits (309), Expect = 8.400e-28
Identity = 107/436 (24.54%), Postives = 198/436 (45.41%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSN-YNFFYELFKEAGIKSGFISKPCLDVTDASC----PNRLKQKP-SYESIVNEGCAQIGEHMDKYSKSIFIGKDNR----------GLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTV---IHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLL 1890
            +ENL PC II+PL+CFWEG+KL  H      S         + W +F+   E     K  ++  + F E+  +A +  G++ +PC++  D  C    PN+   +P     ++  GC  + +    + + + +G  N+           LQT   L +   + E +K    ++++ W E K   ++  W ++  + V   +  NS                SQ++       FT  +L   L       ++    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S I    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R D+ CC +
Sbjct:  210 IENLHPCLIITPLDCFWEGAKL--HAGIAYLSG-----KPPLQWVNFD-PMELIAELKAVTHLVDSFEEMLVKAEVGHGYMDRPCINPADPDCPLSAPNKNSTRPLDIARVLTGGCYGVSKKYMHWQEELILGGTNKNESGRLLSAQALQTMFQLMTPKQMYEHLKGYEEVSHMNWNEDKAAAILEAWQRRYSEVVQQSVSINS----------------SQKV-----LTFTTTTLEDILKSF---SSVSGIRIASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVTLSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NRRIPFEDRTGECLKRTGASVALTSISNITAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIFCCFV 605          

HSP 2 Score: 119.013 bits (297), Expect = 2.361e-26
Identity = 94/354 (26.55%), Postives = 177/354 (50.00%), Query Frame = 1
Query: 2287 LYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            LY    +  GL    I PR++ E+ ++  + + F F N  +VT++  Y   Q +L ++HQ    + +V   +NG+    WL  +  WL+ +Q  FD+D +   I       +N S +G+L   L+VQ G   + IN   L+  RLV  +G ++   FY++L  W S   V Y      + P   P  + + T S        I ++ L + +  P+++    ++  G + + + ++ +++VRSI S Y+    +P+ P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  785 LYGTTCVRDGLELTDIVPRETAEYDFLGAQFQYFSFYNMYVVTQQANYAQAQPLLYEMHQRFGAVKYVLREDNGELPLMWLHYYRDWLQGLQEAFDKDWEVGRITQASY--KNGSDDGVLAYKLLVQTGRRDKPINLNLLTKHRLVDADGIINPNVFYIYLTAWVSNDPVAYAASQANIRPH-PPEWIHDRTDS--------IPINRLTIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRSICSNYSRQ-GMPSYPNGYPFLFWEQYVGLRHWLLLFISVVLASTFLVCAIFLLNPWTAGIIVLVLSLMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1125          
BLAST of patched-like protein vs. Ensembl Cavefish
Match: ptch1 (patched 1 [Source:NCBI gene;Acc:103030480])

HSP 1 Score: 123.635 bits (309), Expect = 9.650e-28
Identity = 107/436 (24.54%), Postives = 198/436 (45.41%), Query Frame = 1
Query:  670 VENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSN-YNFFYELFKEAGIKSGFISKPCLDVTDASC----PNRLKQKP-SYESIVNEGCAQIGEHMDKYSKSIFIGKDNR----------GLQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTV---IHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLL 1890
            +ENL PC II+PL+CFWEG+KL  H      S         + W +F+   E     K  ++  + F E+  +A +  G++ +PC++  D  C    PN+   +P     ++  GC  + +    + + + +G  N+           LQT   L +   + E +K    ++++ W E K   ++  W ++  + V   +  NS                SQ++       FT  +L   L       ++    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + IG +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S I    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R D+ CC +
Sbjct:  210 IENLHPCLIITPLDCFWEGAKL--HAGIAYLSG-----KPPLQWVNFD-PMELIAELKAVTHLVDSFEEMLVKAEVGHGYMDRPCINPADPDCPLSAPNKNSTRPLDIARVLTGGCYGVSKKYMHWQEELILGGTNKNESGRLLSAQALQTMFQLMTPKQMYEHLKGYEEVSHMNWNEDKAAAILEAWQRRYSEVVQQSVSINS----------------SQKV-----LTFTTTTLEDILKSF---SSVSGIRIASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVTLSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NRRIPFEDRTGECLKRTGASVALTSISNITAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIFCCFV 605          

HSP 2 Score: 119.013 bits (297), Expect = 2.353e-26
Identity = 92/356 (25.84%), Postives = 174/356 (48.88%), Query Frame = 1
Query: 2281 MGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            + LY    +  GL    I PR++ E+ ++  + + F F N  +VT++  Y   Q +L ++HQ    + +V   +NG+    WL  +  WL+ +Q  FD+D +   I       +N S +G+L   L+VQ G   + IN   L+  RLV  +G ++   FY++L  W S   V Y      + P           P         I ++ L + +  P+++    ++  G + + + ++ +++VRSI S Y+    +P+ P G  F   EQY+ LR+ L++ +S++LA    V ++  +N + A I+  +L   ++      M L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  755 VSLYGTTCVRDGLELTDIVPRETAEYDFLGAQFQYFSFYNMYVVTQQANYAQAQPLLYEMHQRFGAVKYVLREDNGELPLMWLHYYRDWLQGLQEAFDKDWEVGRITQASY--KNGSDDGVLAYKLLVQTGRRDKPINLNLLTKHRLVDADGIINPNVFYIYLTAWVSNDPVAYAASQANIRPH---------PPEWIHDRTDSIPINRLTIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRSICSNYSRQ-GMPSYPNGYPFLFWEQYVGLRHWLLLFISVVLASTFLVCAIFLLNPWTAGIIVLVLSLMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1097          
BLAST of patched-like protein vs. Ensembl Nematostella
Match: EDO48180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK33])

HSP 1 Score: 248.054 bits (632), Expect = 3.578e-67
Identity = 263/1045 (25.17%), Postives = 471/1045 (45.07%), Query Frame = 1
Query:  361 VEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVST--HNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFN---------ISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPN-----RLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG--KDNR--------GLQTFLLLQSTSHVLETMKINN-LEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVM-LFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCA----TILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLK------RQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHX----XXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVAL---LENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGE---SINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSM-SVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKY--FHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPML----FMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQT 3327
            ++ ET+   LW+    RL  E ++     G      S E I+Q       N+L+   LL HL+ ++    VT+  D + +T  + C    LP++    +++LR   + L+PC IISPL+CFWEG+K+  H  +   S   E + +K  W + N         I  + F++      Y     +FKEAGI SG+  KPCL+  D  CP      R K+     + + +GC        K+ + +  G  K NR         LQ+ +LL    ++    + N+  +    K   ++  W ++  + +                NA+    R   S+   FT+ + N  L   +K  T+    L  G ++M L+         N V+SH  L V    L+  ++++G+GL +  G  FNA +TQV+PF+ +GLG++++ ++   Y+   DI        HP  Q  Y       ++L+ SF+  +  L A  +IP+P +R F IQ   I++        ++P ++ +D  R++  R DLLCC  K        TP+ ST++ ++   Q   +   S L     + +   T +    +  +   + E+ P  +     P +     LN+    +++    + K  R  W  H  L     H     +     +I V+ +   +   G+Y  + +  GL    + PR++ E  ++  +++ F +     VTKE++Y N Q ++ + H+    + ++     ++   FWL  F  WL+ +Q  FD D     +   G W  NAS  G+L   L+ Q G     IN  ++ + RLV  +G +    FY +L  W ++ ++ Y          I+P  V+ +     R++ S +RM      +  P+ F    +  FH  +++++ +  +K VR I   +     LP+ P G  FT  EQY+ LR Q ++V+II+ +G   I+ + I  FL S+   +++  +++   +    FM L  I L+A   V  + S G+G  F++ + ++++  T
Sbjct:   60 IQMETNAEKLWVEAGGRLEEELAYTKGALGEGF-GASQELIIQTPNIEGTNILTPNALLLHLEAVRKATKVTVTIDNKKWTLKELCYAPNLPEIE---NKALRPIFDLLVPCAIISPLDCFWEGAKI--HGPEKNISFTPEKKLLK--WTTLNPIGLLDLLKIGLDIFHN----REYETIRTMFKEAGITSGYTEKPCLNPNDRECPRTAPNYRSKEALDIGASITDGCTGFAAKYMKWPEELIAGGVKKNRSGTIRSAGALQSIILLMGPQNMQRYYQDNDGQDLSTEKATQILEAWQRQFSKVM----------------NAESSRVRDEDSTVLAFTSTAFNDLLKDFSKSSTV---QLAIGYIIMVLYAGWSLKRWTNGVQSHGGLGVAGVILVTLSVVAGMGLCSFCGIAFNAASTQVLPFLALGLGVDDMFLIAHTYAAMSDI--------HPSDQVGYALGSAGVSVLLTSFNNMVAFLMA-AIIPIPALRAFSIQAAVIVVFNYLAVTIVFPAMIAIDVKRKQDQRYDLLCCFSKTVPQRISVTPDLSTDTGNSTAAQPPYIGA-SQLPSIGAVVTANGTISLPGAVTVHAAAFAELGPKTVYNTLLPLSVSE--LNNQTTQSMKSSRCERKHGRWHWLKHLSLEHFADHYYGPCLQKNSTKILVLFMFAAMFGAGVYGCMLVRDGLDLMDVVPRNTTEHKFVDAQSKYFSYYIMYAVTKEYDYPNGQKLMYKYHEAFSRVRNIIKSPDIKTQPFWLIYFRDWLKDMQQAFDSDWSTGCVTYEG-WRENASDYGILGYKLLSQTGNPDMPINRTQVRSIRLVDESGIIRPASFYNYLTAWMNVDTMGYTASQAF----IKPEAVNWYNLRDVREQHS-MRME-----AAKPITFAQLPFDLFHL-KTTEDIVQTIKEVRKICDEF-QAAGLPSYPSGIPFTFWEQYIMLR-QHLMVAIIIVLG---ITFIVIAGFLWSVWTAIIIDLTLVMITVQLFGFMGLAGIKLSAVPAVTLILSVGVGVEFTVHMCMAFLTST 1044          
BLAST of patched-like protein vs. Ensembl Medaka
Match: ptch1 (patched 1 [Source:NCBI gene;Acc:101166055])

HSP 1 Score: 235.343 bits (599), Expect = 3.259e-62
Identity = 252/1048 (24.05%), Postives = 464/1048 (44.27%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVST-----HNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRV-QLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNY--NFFYELFKEAGIKSGFISKPCLDVTDASCP----NRLKQKP-SYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINP---VDLSPRSEPSTSRS------FPLNSSVDNNLEPKPLKNKRHRCCWKF---HYRLS----KTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
             K+   ETDV  LW+    R++ E ++  +  G   E       L + T      N L     L      ++        Y+R+ +     C +  +L     + D+     +E L PC II+PL+CFWEG+KL        F  Y   R   + W +F+  Q     F   SN+    F  + ++A I  G++ +PCL+  D  CP    NR   KP +    ++ GC  +      + + + +G   K+  G       LQT   L +   + E  +    + ++ W E K   ++  W              R Y E++    A   SQR+       FT  +L   L   ++   +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R D+ CC             YS  P  +    +    ++S +   TE+      F       Y    P   + + P + P T  +       P ++S   +L  +  +      CW+     + L+    K +   ++    ++ VI++ L ++ + LY    +  GL    I PR+++E+ +I  + + F F N  +VT+  +Y  NQ +L QLHQ    + +V   +NG   + WL  F  WL+ +Q  FD+D +   I  +    +N S +G+L   L+VQ G   + IN+ +L++ RLV  +G ++   FY++L  W S   V Y      + P           P         +  + L++ +  P+++    ++  G + + + ++ +++VR+I + Y+    LP+ P G  F   EQY+ LR+ L++ +S++LA    V +L  +N + A I+  +L   ++     FM L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  106 LKAANLETDVEKLWVEVGGRVNQELNYTRQKMG---EEAMFNPQLMIQTPREEGANVLTVEALLQHLESAMRASRVHVYLYNRQ-WNLEHLCYKSGELITEESMMDQM----IEKLHPCLIITPLDCFWEGAKL----QSGMF--YLPGRGY-LQWTNFDPKQ-----FLAESNFLVESFESMLEKADIGHGYMDRPCLNPADPDCPLTAPNRNSTKPFNVARALSGGCHGLSRKYMHWQEELIVGGTTKNGSGPLLSAQALQTMFQLMTPKQMFEHFRGYEEVAHINWNEEKAAAILEAW-------------QRRYSEAVLQSVAANSSQRVLS-----FTTTTLEDILKSFSEISVI---RVASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRCDIFCCF------------YSPPPSSHSFAHQTQITMQSTVQLRTEYDPRTQAF-------YTTAEPRSQISVQPMNPPPTRVNSDYLGHIPESNSSTRDLLSQTGEASFGLHCWESPCSRWTLASFAEKHYAPFLLQPTTKVVVIVLFLCLLGVSLYGTTQVRDGLELTDIVPRETSEYDFIGAQFKFFSFYNMYVVTQRADYAKNQQLLHQLHQRFHTIRYVLKEDNGQLPRMWLHFFRDWLQGLQEAFDKDWQAGRITHSSY--KNGSDDGILAYKLLVQTGRRDKPINFNQLTSQRLVDADGIINPGAFYIYLTAWVSNDPVAYAASQANIRPH---------PPEWLHDHTDSMPETRLSIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICNNYSRQ-GLPSYPNGYPFLFWEQYVSLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIVLVLSLMTVEL-FGFMGLMGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1072          
BLAST of patched-like protein vs. Ensembl Medaka
Match: ptch2 (patched 2 [Source:NCBI gene;Acc:101159383])

HSP 1 Score: 216.083 bits (549), Expect = 3.366e-56
Identity = 273/1262 (21.63%), Postives = 536/1262 (42.47%), Query Frame = 1
Query:  166 PD--ERKSYLMVNMYIKGHSSLKC-KTNIKIWLKLKY----FCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYD--RRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCP-----NRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTE------SYSAVPRQY--------------------DCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRS----EPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKF---HYRLS----KTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSD 3693
            PD   R SY      +K  S  K       +W++ ++    F     ++ H  K+L IG+   G   +G +  + ET++  LW+   SR+  E  +     G +    S + ++Q                + +   +    +Q     +S+  +  C +  +P    + +  +   ++ L PC II+PL+CFWEG+KL         S Y       I W + +   +      + ++   F E+  +A +   ++++PCL+ +D+ CP         + P     +  GC    +    + + + +G   K ++G       LQT  LL S   + E  K    I+++ W E K   ++  W +K  + V     H    +SIP  +++         S + F+  +LN  +   +    +    +  G ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G++++ +L   ++++       I         L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCCL          L  Q  +DS E      + +A   QY                     C     +++ + +  +++ +T+P + I     Q   I+P   SP +    +P  S+ F   SS   +L  +   +K  + C  F   H+ LS    + +  +++    +  V++  L ++ + LY    +  GL    I PRD+ E+ +I+ + + F F N  +VT + F+Y  +Q +L+QLH   +++ +V    + K    WL  F  WL+ +Q+ FD D +   I A+    RN +++G L   L++Q G   +  NY +L++ +L+   G +    FY++L VW S   + Y       YP    +  D +  +             L + +  PL+F    ++  G + + + ++ +++VR+I   ++    +   P G  F   EQY+ LR+  ++ +S++LA    V ++L +N + A ++  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++                      + GD                         NK+  + +E  F   P      ST LG+  +  ++  F+ R F  +  +  V  +LN   L P+    + P ++
Sbjct:   29 PDLIRRPSYCHAAFALKQISKGKAVGQKAPLWIRARFQALLFSLGCHIQRHCGKVLFIGLLVFGALSVGLRVADIETNIEQLWVEAGSRVSTELRYTKEKQGEESVFTS-QMLIQTPKEEGSNILTQEALLVHMEAALSASKVQVSLFGKSWDLNKICYKSGVP---IIENVMIERMIDKLFPCMIITPLDCFWEGAKL------QGGSAYLPGMP-DIQWMNLD-PVKLMEELSQFTSLEGFKEMLDKAQVGHAYMNRPCLNPSDSDCPLSAPNKEQGESPDIAGGLQGGCHGFSQKFMHWQEELILGGQVKSSQGTLLSAEALQTMFLLMSPKQLYEHFKDDYEIHDINWNEEKATAILESWQRKFVEEV-----H----QSIPANSSQ---------SIHAFSTTTLNDIMKSFSDVSVI---RVAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVLPFLALGIGVDDMFLLAHSFTES----GTNIPFKERTGDCLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAIVVVFNFAMVLLIFPAILSLDLHRREDKRLDILCCLYSPCSDRVIHLAPQELSDSGEQPYVATTGTAHAHQYTAGSTITTSTQITTTVQAFTQCDAAGQHIV-TILPPTSQISTSPTSIIVCPTSQAQAISP---SPSTTSVPDPYGSQLFTPTSSSTRDLLAQVEDSKSGKRCVPFPFLHWNLSSFAREKYAPLLLQPKSKAIVVVFFLGLLGLSLYGTTMVHDGLYLTDIVPRDTKEYDFIEAQFKYFSFYNMYLVTMDGFDYARSQRLLIQLHNAFNSVRNVVRDNDNKLPRMWLHYFQDWLKGLQAAFDADWQEGRITADSY--RNGTEDGALAYKLLIQTGSKKDPFNYSQLTSRQLLDAEGLIPPEVFYIYLTVWVSNDPLGYAASQANFYPHPREWIHDKYDTTG----------ENLRIPAAEPLEFAQFPFYLNGLRQASDFVETIESVRAICDEFSRK-GVFNYPNGYPFLFWEQYIGLRHWFLLSISVVLACTFLVCAILLLNPWTAGLIVFILAMMTVEL-FGMMGLIGIKLSAIPVVILISSVGIGVEFTVHIALGFLT---------------------AIGDR------------------------NKRSAVALEHMF--APVVDGAISTLLGVLMLAGSEFDFIMRYFFAVLAILTVLGILNGLVLLPVLLSMMGPPAE 1188          
BLAST of patched-like protein vs. Ensembl Medaka
Match: ptch2 (patched 2 [Source:NCBI gene;Acc:101159383])

HSP 1 Score: 210.305 bits (534), Expect = 2.103e-54
Identity = 267/1255 (21.27%), Postives = 519/1255 (41.35%), Query Frame = 1
Query:  166 PD--ERKSYLMVNMYIKGHSSLKC-KTNIKIWLKLKY----FCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYD--RRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCP-----NRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCL----------LKRQTPNDSTE------SYSAVPRQY--------------------DCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRS----EPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSD 3693
            PD   R SY      +K  S  K       +W++ ++    F     ++ H  K+L IG+   G   +G +  + ET++  LW+   SR+  E  +     G +    S + ++Q                + +   +    +Q     +S+  +  C +  +P    + +  +   ++ L PC II+PL+CFWEG+KL         S Y       I W + +   +      + ++   F E+  +A +   ++++PCL+ +D+ CP         + P     +  GC    +    + + + +G   K ++G       LQT  LL S   + E  K    I+++ W E K   ++  W +K  + V     H    +SIP  +++         S + F+  +LN  +   +    +    +  G ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G++++ +L   ++++       I         L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCCL          L  Q  +DS E      + +A   QY                     C     +++ + +  +++ +T+P + I     Q   I+P   SP +    +P  S+ F   SS   +L  +   +K  +  +        T +H                     GLY             I PRD+ E+ +I+ + + F F N  +VT + F+Y  +Q +L+QLH   +++ +V    + K    WL  F  WL+ +Q+ FD D +   I A+    RN +++G L   L++Q G   +  NY +L++ +L+   G +    FY++L VW S   + Y       YP    +  D +  +             L + +  PL+F    ++  G + + + ++ +++VR+I   ++    +   P G  F   EQY+ LR+  ++ +S++LA    V ++L +N + A ++  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++                      + GD                         NK+  + +E  F   P      ST LG+  +  ++  F+ R F  +  +  V  +LN   L P+    + P ++
Sbjct:   29 PDLIRRPSYCHAAFALKQISKGKAVGQKAPLWIRARFQALLFSLGCHIQRHCGKVLFIGLLVFGALSVGLRVADIETNIEQLWVEAGSRVSTELRYTKEKQGEESVFTS-QMLIQTPKEEGSNILTQEALLVHMEAALSASKVQVSLFGKSWDLNKICYKSGVP---IIENVMIERMIDKLFPCMIITPLDCFWEGAKL------QGGSAYLPGMP-DIQWMNLD-PVKLMEELSQFTSLEGFKEMLDKAQVGHAYMNRPCLNPSDSDCPLSAPNKEQGESPDIAGGLQGGCHGFSQKFMHWQEELILGGQVKSSQGTLLSAEALQTMFLLMSPKQLYEHFKDDYEIHDINWNEEKATAILESWQRKFVEEV-----H----QSIPANSSQ---------SIHAFSTTTLNDIMKSFSDVSVI---RVAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVLPFLALGIGVDDMFLLAHSFTES----GTNIPFKERTGDCLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAIVVVFNFAMVLLIFPAILSLDLHRREDKRLDILCCLYSPCSDRVIHLAPQELSDSGEQPYVATTGTAHAHQYTAGSTITTSTQITTTVQAFTQCDAAGQHIV-TILPPTSQISTSPTSIIVCPTSQAQAISP---SPSTTSVPDPYGSQLFTPTSSSTRDLLAQVEDSKSGKSLY------GTTMVHD--------------------GLY----------LTDIVPRDTKEYDFIEAQFKYFSFYNMYLVTMDGFDYARSQRLLIQLHNAFNSVRNVVRDNDNKLPRMWLHYFQDWLKGLQAAFDADWQEGRITADSY--RNGTEDGALAYKLLIQTGSKKDPFNYSQLTSRQLLDAEGLIPPEVFYIYLTVWVSNDPLGYAASQANFYPHPREWIHDKYDTTG----------ENLRIPAAEPLEFAQFPFYLNGLRQASDFVETIESVRAICDEFSRK-GVFNYPNGYPFLFWEQYIGLRHWFLLSISVVLACTFLVCAILLLNPWTAGLIVFILAMMTVEL-FGMMGLIGIKLSAIPVVILISSVGIGVEFTVHIALGFLT---------------------AIGDR------------------------NKRSAVALEHMF--APVVDGAISTLLGVLMLAGSEFDFIMRYFFAVLAILTVLGILNGLVLLPVLLSMMGPPAE 1145          
BLAST of patched-like protein vs. Ensembl Medaka
Match: ptch2 (patched 2 [Source:NCBI gene;Acc:101159383])

HSP 1 Score: 196.052 bits (497), Expect = 3.825e-50
Identity = 252/1200 (21.00%), Postives = 507/1200 (42.25%), Query Frame = 1
Query:  223 LKCKTNIKIWLKLKY----FCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYD--RRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCP-----NRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKF---HYRLS----KTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKE-FEYTNNQDILLQLHQEIDNLHHVALLENGKF---WLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSD 3693
            L       +W++ ++    F     ++ H  K+L IG+   G   +G +  + ET++  LW+   SR+  E  +     G +    S + ++Q                + +   +    +Q     +S+  +  C +  +P    + +  +   ++ L PC II+PL+CFWEG+KL         S Y       I W + +   +      + ++   F E+  +A +   ++++PCL+ +D+ CP         + P     +  GC    +    + + + +G   K ++G       LQT  LL S   + E  K    I+++ W E K   ++  W +K  +  +H        +SIP  +++         S + F+  +LN  +   +    +    +  G ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV   +   +G++++ +L   ++++       I         L    T + ++    +I      ++P+P +R F +Q   +++    +   ++P +L LD  RRE  R+D+LCCL    +P  S       P++     +   ++ + +   T+   A    +         I P      + P  S+ F   SS   +L  +   +K  + C  F   H+ LS    + +  +++    +  V++  L ++ + LY    +  GL    I PRD+ E+ +I+ + + F F N  +VT + F+Y  +Q +L+QLH   +++ +V    + K    WL  F  WL+ +Q+ FD D +   I A+    RN +++G L   L++Q G   +  NY +L++ +L+   G +    FY++L VW S   + Y       YP    +  D +  +             L + +  PL+F    ++  G + + + ++ +++VR+I   ++    +   P G  F   EQY+ LR+  ++ +S++LA    V ++L +N + A ++  +L   ++      M L  I L+A   V+ + S G+G  F++ + + ++                      + GD                         NK+  + +E  F   P      ST LG+  +  ++  F+ R F  +  +  V  +LN   L P+    + P ++
Sbjct:   26 LAVGQKAPLWIRARFQALLFSLGCHIQRHCGKVLFIGLLVFGALSVGLRVADIETNIEQLWVEAGSRVSTELRYTKEKQGEESVFTS-QMLIQTPKEEGSNILTQEALLVHMEAALSASKVQVSLFGKSWDLNKICYKSGVP---IIENVMIERMIDKLFPCMIITPLDCFWEGAKL------QGGSAYLPGMP-DIQWMNLD-PVKLMEELSQFTSLEGFKEMLDKAQVGHAYMNRPCLNPSDSDCPLSAPNKEQGESPDIAGGLQGGCHGFSQKFMHWQEELILGGQVKSSQGTLLSAEALQTMFLLMSPKQLYEHFKDDYEIHDINWNEEKATAILESWQRKFVE--VH--------QSIPANSSQ---------SIHAFSTTTLNDIMKSFSDVSVI---RVAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVQ--LRGRIGVDDMFLLAHSFTES----GTNIPFKERTGDCLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAIVVVFNFAMVLLIFPAILSLDLHRREDKRLDILCCLY---SPC-SDRVIHLAPQELSDSGEQPYVITTTVQAFTQCDAAGQHIV--------TILPPTSQISTNPYGSQLFTPTSSSTRDLLAQVEDSKSGKRCVPFPFLHWNLSSFAREKYAPLLLQPKSKAIVVVFFLGLLGLSLYGTTMVHDGLYLTDIVPRDTKEYDFIEAQFKYFSFYNMYLVTMDGFDYARSQRLLIQLHNAFNSVRNVVRDNDNKLPRMWLHYFQDWLKGLQAAFDADWQEGRITADSY--RNGTEDGALAYKLLIQTGSKKDPFNYSQLTSRQLLDAEGLIPPEVFYIYLTVWVSNDPLGYAASQANFYPHPREWIHDKYDTTG----------ENLRIPAAEPLEFAQFPFYLNGLRQASDFVETIESVRAICDEFSRK-GVFNYPNGYPFLFWEQYIGLRHWFLLSISVVLACTFLVCAILLLNPWTAGLIVFILAMMTVEL-FGMMGLIGIKLSAIPVVILISSVGIGVEFTVHIALGFLT---------------------AIGDR------------------------NKRSAVALEHMF--APVVDGAISTLLGVLMLAGSEFDFIMRYFFAVLAILTVLGILNGLVLLPVLLSMMGPPAE 1112          
BLAST of patched-like protein vs. Ensembl Medaka
Match: ptch1 (patched 1 [Source:NCBI gene;Acc:101166055])

HSP 1 Score: 134.035 bits (336), Expect = 6.086e-31
Identity = 97/354 (27.40%), Postives = 180/354 (50.85%), Query Frame = 1
Query: 2287 LYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENG---KFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDG---ESINYKKLSTSRLV-RNGKVDERKFYLFLNVWRSMS-VEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKG-QSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVI-VSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYV 3318
            LY    +  GL    I PR+++E+ +I  + + F F N  +VT+  +Y  NQ +L QLHQ    + +V   +NG   + WL  F  WL+ +Q  FD+D +   I  +    +N S +G+L   L+VQ G   + IN+ +L++ RLV  +G ++   FY++L  W S   V Y      + P           P         +  + L++ +  P+++    ++  G + + + ++ +++VR+I + Y+    LP+ P G  F   EQY+ LR+ L++ +S++LA    V +L  +N + A I+  +L   ++     FM L  I L+A   V+ + S G+G  F++ + ++++
Sbjct:  836 LYGTTQVRDGLELTDIVPRETSEYDFIGAQFKFFSFYNMYVVTQRADYAKNQQLLHQLHQRFHTIRYVLKEDNGQLPRMWLHFFRDWLQGLQEAFDKDWQAGRITHSSY--KNGSDDGILAYKLLVQTGRRDKPINFNQLTSQRLVDADGIINPGAFYIYLTAWVSNDPVAYAASQANIRPH---------PPEWLHDHTDSMPETRLSIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICNNYSRQ-GLPSYPNGYPFLFWEQYVSLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIVLVLSLMTVEL-FGFMGLMGIKLSAVPVVILIASVGIGVEFTVHVALAFL 1176          

HSP 2 Score: 123.635 bits (309), Expect = 8.001e-28
Identity = 133/544 (24.45%), Postives = 237/544 (43.57%), Query Frame = 1
Query:  352 FKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVST-----HNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRV-QLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNY--NFFYELFKEAGIKSGFISKPCLDVTDASC----PNRLKQKP-SYESIVNEGCAQIGEHMDKYSKSIFIG---KDNRG-------LQTFLLLQSTSHVLETMK----INNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDC-----ATILMVSFS-IKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCC 1884
             K+   ETDV  LW+    R++ E ++  +  G   E       L + T      N L     L      ++        Y+R+ +     C +  +L     + D+     +E L PC II+PL+CFWEG+KL        F  Y   R   + W +F+  Q     F   SN+    F  + ++A I  G++ +PCL+  D  C    PNR   KP +    ++ GC  +      + + + +G   K+  G       LQT   L +   + E  +    + ++ W E K   ++  W ++  + V         L+S+    A   SQR+       FT  +L   L   ++   +    + SG ++ML    + +   +  +S   + +    L+  ++ +GLGL + +G +FNA TTQV+PF+ +G+G+++V +L   +S+         N   P      +C     A++ + S S +    ++AL  IP+P +R F +Q   +++    +   ++P +L +D  RRE  R D+ CC
Sbjct:  106 LKAANLETDVEKLWVEVGGRVNQELNYTRQKMG---EEAMFNPQLMIQTPREEGANVLTVEALLQHLESAMRASRVHVYLYNRQ-WNLEHLCYKSGELITEESMMDQM----IEKLHPCLIITPLDCFWEGAKL----QSGMF--YLPGRGY-LQWTNFDPKQ-----FLAESNFLVESFESMLEKADIGHGYMDRPCLNPADPDCPLTAPNRNSTKPFNVARALSGGCHGLSRKYMHWQEELIVGGTTKNGSGPLLSAQALQTMFQLMTPKQMFEHFRGYEEVAHINWNEEKAAAILEAWQRRYSEAV---------LQSV----AANSSQRVLS-----FTTTTLEDILKSFSEISVI---RVASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVTLSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQ------NKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAAL--IPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRCDIFCC 600          
BLAST of patched-like protein vs. Planmine SMEST
Match: SMESG000003567.1 (SMESG000003567.1)

HSP 1 Score: 2394 bits (6203), Expect = 0.000e+0
Identity = 1324/1324 (100.00%), Postives = 1324/1324 (100.00%), Query Frame = 1
Query:  199 MYIKGHSSLKCKTNIKIWLKLKYFCYQKFVRYHHWKXXXXXXXXXXXXXXXFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNXXXXXXXXXXXXXXXXXXXXXXXXYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQSTSHVLETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTXXXXXXXXXXXXKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTXXXXXXXXXXXXXXXXXXXXFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHXXXXXXXXXXXXXXXXXXXXMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLVRNGKVDERKFYLFLNVWRSMSVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFXXXXXXXXXXXXXXXXPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSDHKTRSPFVRNSDSYRCKSRPSHKSSTKSFRSQVSRNGSKFDLTNDNSAHGKLXXXXXXXXXXXXXXXXXDCCDNDHINNXXXXXXXXXXXXXXXXXXXXXXENDSRFVRQNVESSLIIHYSIDGQGKSPKKDANFPPELAVKTSFKYRQPTGQDQQDGH 4170
            MYIKGHSSLKCKTNIKIWLKLKYFCYQKFVRYHHWKILLIGIGFLGLCWLGFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNNLLSTEFLLEHLQLLQNVVNVTLQYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQSTSHVLETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTNNSLNSALNQANKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTSTSLLIAAILSGLGLMAAIGFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHIIVLVPVQITVILVTLLIIVMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLVRNGKVDERKFYLFLNVWRSMSVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFLASILATLLLSSSILSPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSDHKTRSPFVRNSDSYRCKSRPSHKSSTKSFRSQVSRNGSKFDLTNDNSAHGKLSIIPEESSSVQSSLKSKDCCDNDHINNSSSSSDSSSSSSSSSSDSSQSQENDSRFVRQNVESSLIIHYSIDGQGKSPKKDANFPPELAVKTSFKYRQPTGQDQQDGH
Sbjct:    1 MYIKGHSSLKCKTNIKIWLKLKYFCYQKFVRYHHWKILLIGIGFLGLCWLGFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQVSTHNNLLSTEFLLEHLQLLQNVVNVTLQYDRRSFTFSDFCQRVQLPKLHYLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSIKIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDASCPNRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQSTSHVLETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIPYRNAKFQSQRIRKSSFYVFTNNSLNSALNQANKDETLLAKYLTSGGVVMLFVVLIFVSSDNLVRSHCWLAVTSTSLLIAAILSGLGLMAAIGFTFNALTTQVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATILMVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHLDSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKIIFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNNLEPKPLKNKRHRCCWKFHYRLSKTFLHIIVLVPVQITVILVTLLIIVMGLYSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNNQDILLQLHQEIDNLHHVALLENGKFWLSSFIGWLERIQSDFDRDVKNKLILANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLVRNGKVDERKFYLFLNVWRSMSVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLNLFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIGNIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFLASILATLLLSSSILSPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPPSSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLIRVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLLNYYYLAPIFCFYLIPKSDHKTRSPFVRNSDSYRCKSRPSHKSSTKSFRSQVSRNGSKFDLTNDNSAHGKLSIIPEESSSVQSSLKSKDCCDNDHINNSSSSSDSSSSSSSSSSDSSQSQENDSRFVRQNVESSLIIHYSIDGQGKSPKKDANFPPELAVKTSFKYRQPTGQDQQDGH 1324          
The following BLAST results are available for this feature:
BLAST of patched-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTCH17.789e-5825.11patched 1 [Source:HGNC Symbol;Acc:HGNC:9585][more]
PTCH17.789e-5825.11patched 1 [Source:HGNC Symbol;Acc:HGNC:9585][more]
PTCH17.965e-5825.11patched 1 [Source:HGNC Symbol;Acc:HGNC:9585][more]
PTCH18.496e-5825.11patched 1 [Source:HGNC Symbol;Acc:HGNC:9585][more]
PTCH18.496e-5825.11patched 1 [Source:HGNC Symbol;Acc:HGNC:9585][more]
back to top
BLAST of patched-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptc-11.224e-1522.80pep chromosome:WBcel235:II:7895625:7900484:1 gene:... [more]
ptc-11.224e-1522.80pep chromosome:WBcel235:II:7895625:7900484:1 gene:... [more]
ptc-11.272e-1522.80pep chromosome:WBcel235:II:7893229:7900484:1 gene:... [more]
ptc-11.272e-1522.80pep chromosome:WBcel235:II:7893229:7900510:1 gene:... [more]
ptc-36.372e-1127.27pep chromosome:WBcel235:II:2845384:2852593:-1 gene... [more]
back to top
BLAST of patched-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ptc6.054e-3424.72gene:FBgn0003892 transcript:FBtr0089427[more]
back to top
BLAST of patched-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptch27.370e-6023.04patched 2 [Source:NCBI gene;Acc:30181][more]
ptch28.861e-6023.01patched 2 [Source:NCBI gene;Acc:30181][more]
ptch12.536e-2824.43patched 1 [Source:ZFIN;Acc:ZDB-GENE-980526-196][more]
ptch13.095e-2824.43patched 1 [Source:ZFIN;Acc:ZDB-GENE-980526-196][more]
ptch11.011e-2726.91patched 1 [Source:ZFIN;Acc:ZDB-GENE-980526-196][more]
back to top
BLAST of patched-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTCH21.760e-6222.76patched 2 [Source:NCBI gene;Acc:100492958][more]
PTCH22.804e-6222.94patched 2 [Source:NCBI gene;Acc:100492958][more]
PTCH22.975e-6223.15patched 2 [Source:NCBI gene;Acc:100492958][more]
PTCH24.978e-6222.94patched 2 [Source:NCBI gene;Acc:100492958][more]
PTCH26.000e-6223.00patched 2 [Source:NCBI gene;Acc:100492958][more]
back to top
BLAST of patched-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptch12.010e-5725.05patched 1 [Source:MGI Symbol;Acc:MGI:105373][more]
Ptch13.904e-5725.05patched 1 [Source:MGI Symbol;Acc:MGI:105373][more]
Ptch21.098e-5423.42patched 2 [Source:MGI Symbol;Acc:MGI:1095405][more]
Ptch13.911e-2625.00patched 1 [Source:MGI Symbol;Acc:MGI:105373][more]
Ptch22.056e-1525.10patched 2 [Source:MGI Symbol;Acc:MGI:1095405][more]
back to top
BLAST of patched-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q98864|PTC1_DANRE2.023e-5722.74Protein patched homolog 1 OS=Danio rerio OX=7955 G... [more]
sp|Q13635|PTC1_HUMAN6.695e-5725.11Protein patched homolog 1 OS=Homo sapiens OX=9606 ... [more]
sp|Q61115|PTC1_MOUSE2.731e-5625.05Protein patched homolog 1 OS=Mus musculus OX=10090... [more]
sp|O35595|PTC2_MOUSE7.681e-5423.42Protein patched homolog 2 OS=Mus musculus OX=10090... [more]
sp|Q9Y6C5|PTC2_HUMAN6.132e-5022.84Protein patched homolog 2 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of patched-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2ILS00.000e+099.25Patched-like protein OS=Schmidtea mediterranea OX=... [more]
D0VYP10.000e+069.56Patched OS=Dugesia japonica OX=6161 GN=Djptc PE=2 ... [more]
A0A0U2W0102.919e-6924.89Patched1 (Fragment) OS=Novocrania anomala OX=31794... [more]
C3YM071.108e-6624.50Patched protein-like protein (Fragment) OS=Branchi... [more]
A0A1S3IK036.603e-6624.26protein patched homolog 1 isoform X1 OS=Lingula un... [more]
back to top
BLAST of patched-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ptch23.932e-3023.49patched 2 [Source:NCBI gene;Acc:30181][more]
ptch18.400e-2824.54patched 1 [Source:NCBI gene;Acc:103030480][more]
ptch19.650e-2824.54patched 1 [Source:NCBI gene;Acc:103030480][more]
back to top
BLAST of patched-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of patched-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of patched-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481803.578e-6725.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of patched-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptch13.259e-6224.05patched 1 [Source:NCBI gene;Acc:101166055][more]
ptch23.366e-5621.63patched 2 [Source:NCBI gene;Acc:101159383][more]
ptch22.103e-5421.27patched 2 [Source:NCBI gene;Acc:101159383][more]
ptch23.825e-5021.00patched 2 [Source:NCBI gene;Acc:101159383][more]
ptch16.086e-3127.40patched 1 [Source:NCBI gene;Acc:101166055][more]
back to top
BLAST of patched-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000003567.10.000e+0100.00SMESG000003567.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029695
GenBankACZ64511.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029695 ID=SMED30029695|Name=patched-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4428bp
AACGCATTATATAAAAGCACGATTTTAAGTAATTTTATTGGCTAATACAA
AATTATCACTCAGATTTTTATTGAATATTAATAGTTAATGATATTTTGGG
TACTTTATAAATAACAAATCTCCTACAAATTTAATATTGACTTGTGAATT
GTTTTTCGAAACTCCCCAGATGAACGAAAATCCTATCTTATGGTTAACAT
GTATATAAAGGGCCATTCATCTTTAAAATGCAAGACAAACATTAAAATCT
GGTTAAAGTTAAAATATTTCTGTTATCAAAAATTCGTCCGTTATCATCAT
TGGAAAATATTACTCATTGGAATCGGTTTTCTCGGTTTATGTTGGCTTGG
GTTCAAATCCGTGGAGTTTGAGACCGATGTGATGAATCTTTGGATTTACA
ATTCATCCCGGTTGCACAATGAAACCTCATTTATCTCCCGTGTTTCTGGG
AGCAAAATCGAGTCTGGTTCAATTGAAACTATCTTGCAAGTTTCGACCCA
CAATAATCTATTGTCAACCGAATTCTTACTGGAGCACCTTCAACTATTGC
AGAATGTTGTGAACGTGACACTGCAATACGACAGGAGATCATTCACGTTT
TCTGATTTTTGTCAAAGGGTTCAGTTACCGAAATTGCATTACCTCCATGA
CAGGTCTTTACGGGTTTCGGTAGAAAATTTAATGCCCTGCCGAATAATCT
CTCCTCTCAATTGTTTCTGGGAGGGCTCGAAATTGCTGGATCACTATTCG
AAAAATAAATTTTCAAATTATGATGAATCCCGATCAATCAAAATCGATTG
GAAATCTTTCAACATTTCCCAGGAATTCTTTTATTCATTCAAGGAGACTT
CGAATTATAATTTTTTCTACGAATTGTTCAAAGAGGCCGGCATCAAATCC
GGATTCATTTCCAAGCCATGCCTCGATGTAACCGACGCGTCTTGTCCCAA
CCGACTTAAACAAAAGCCAAGCTATGAGTCGATTGTCAATGAAGGTTGTG
CCCAGATAGGGGAGCACATGGACAAATATTCCAAGTCCATATTTATTGGC
AAGGACAATCGAGGCCTCCAAACCTTCCTGTTGCTGCAAAGCACATCTCA
TGTATTGGAAACAATGAAAATAAACAATCTCGAATGGCCGGAGTCGAAAG
TTCAGGACGTCATGAATTTGTGGCTACAGAAGTTACAACAGACAGTCATC
CACTTCAATTCTCACCGACCGTATTTGGAGTCAATTCCTTATAGAAATGC
CAAATTCCAATCTCAAAGAATCAGGAAATCGTCTTTCTATGTATTTACAA
ATAATTCGTTGAATTCTGCACTCAATCAAGCGAATAAGGATGAAACGTTG
CTAGCAAAATATTTGACGTCCGGTGGAGTTGTGATGCTGTTTGTAGTGCT
CATTTTCGTGTCATCGGACAACCTAGTTCGGTCACATTGTTGGCTGGCAG
TAACCAGCACCTCCTTGCTCATTGCTGCCATTCTTTCTGGGCTCGGATTA
ATGGCAGCGATTGGATTCACGTTTAACGCCTTAACAACTCAGGTCGTTCC
CTTTGTCATGGTGGGTTTGGGACTAGAGGAAGTCATCATTTTGACGAAAA
AGTATTCAAAAAACATTGACATTTGTCGTCAGAAGATAAACCATCCTCAT
CCGGTTGCTCAAACTCTCTATGACTGTGCGACAATTTTGATGGTCTCATT
CTCTATAAAGCTCATCGTCCTCAGTGCCCTTACCATGATACCGGTTCCAC
TTATGCGCAATTTTTGCATTCAGATTCTTTTCATAATGCTGTTACAAACT
GGAGTCAATGCCTTCCTTTATCCCTGTCTTCTTCATTTAGATTCCGTTAG
ACGGGAAAGTAATCGAATAGACCTTCTCTGTTGCTTGCTGAAACGTCAAA
CTCCCAACGATTCTACTGAGTCTTATTCGGCTGTCCCTCGTCAGTATGAC
TGTGTCCGAAAAGACTCGAACTTGTTAAAGTCGAAAATAATTTTCTCCAC
CGAATTTACAACGGCTCCAGATACATTCATTCCAAACAATGTTCACCAGT
ACTGCGAAATCAATCCTGTCGACCTGTCACCAAGATCGGAGCCTTCAACG
TCTCGATCGTTTCCTCTCAATAGTTCTGTCGACAATAATTTGGAGCCGAA
ACCACTGAAAAACAAAAGGCACCGATGCTGTTGGAAGTTTCATTATCGAT
TGTCAAAGACATTTCTCCATATAATTGTGCTCGTTCCGGTTCAAATCACT
GTGATACTAGTAACGCTTCTGATCATTGTCATGGGACTCTATTCTGCTGT
GAACATTGACTGTGGACTTCTGTTTGAATCTATCTTCCCTCGGGATTCCA
ATGAGTTCCACTATATCAAATACGAGACAGAACTGTTTCGCTTTCAAAAT
TTCGAAATTGTCACCAAAGAGTTCGAATATACAAACAACCAGGACATTCT
GTTACAGCTTCACCAGGAAATTGACAATCTCCATCATGTGGCCTTGCTAG
AAAATGGCAAGTTTTGGTTATCTTCTTTCATCGGTTGGTTGGAAAGGATT
CAGAGCGACTTTGACAGAGATGTGAAAAACAAGCTCATACTAGCCAATGG
AACATGGTCAAGGAATGCCTCCAAGAACGGACTGTTGGTCATGACATTGA
TGGTCCAAGATGGAGAATCGATTAATTATAAAAAACTCTCAACGTCTCGA
TTGGTAAGAAATGGAAAAGTCGACGAAAGGAAATTTTATCTTTTCCTCAA
CGTCTGGAGATCCATGTCAGTGGAATATGAGACCCAGCCTTGTCTTTTAT
ATCCAAAAATTGAACCTTTCACAGTTGATAATTTCACTCCAAGCAAATAT
CGAAAAGAGCCGTCCGTTATCCGAATGTCCGGGTTGAATTTATTTTCTAA
TCATCCATTGCAATTTGTTGCCTGTAAATATTTCCACAAAGGCCAATCTT
CTCAGGAAGAATTAGATTTTGTCAAGACGGTTCGAAGTATAACGAGCAGA
TATACAAATAATCTCAGTTTACCAACCATTCCGATTGGGAACATATTTAC
TTTGTCAGAGCAGTATCTAAAATTGCGATATCAACTCGTCATTGTGTCGA
TTATTCTCGCCATTGGAATGTTCGTCATTAGCCTGCTGGCTATCAATCAT
TTCCTTGCTAGTATTCTCGCAACGCTATTATTGAGTTCTAGCATTCTCAG
TCCAATGCTATTCATGAATCTCTATCAAATTCCTTTGAATGCTACGTCTG
GAGTTATGGCTCTTTGGTCCGGTGGACTTGGGTTTAGATTCTCATTATTT
TTGATAGTGTCATACGTCGAGCAAACCGAGATGCCGCCCTCCAGCACAGA
AGCTCAGCCAGATATGGAACTTAGTGTAAGTCCTAGTAGTGGTGATACTG
GTAATGAGCGCACTCGTGAACCTGTTGCTAAGGATTGCATTGGCTCCATC
TTTAGCGTGACATTTATGGTCAATAAGCAAAAGCTAATCAGAGTCGAGCG
AGCGTTTAATGACGTCCCATGCGGCAAAGCTGTGTTTTCCACCTTCCTCG
GAATGGCATTTATAATAATGACAGATATCAGTTTTTTGTGGCGGAACTTC
ATGTTGATACCTTTTGTCGGTCTGGTTCACTCGCTCCTGAATTACTACTA
TTTGGCTCCGATATTTTGCTTTTACCTAATCCCGAAATCCGACCACAAAA
CGCGCAGCCCATTCGTCCGCAATTCCGATTCGTATCGTTGCAAGTCGCGC
CCGTCTCATAAATCATCCACAAAGTCTTTTCGGTCTCAGGTTTCAAGGAA
CGGTTCAAAGTTCGACCTTACCAATGACAATTCGGCTCACGGCAAACTCA
GCATCATTCCTGAAGAATCGAGCTCAGTCCAGAGCTCCTTGAAATCCAAA
GACTGTTGTGACAATGACCACATTAATAATAGTAGTAGTAGTAGTGATAG
TAGTAGTAGTAGTAGTTCTTCTTCATCTGATTCGTCTCAATCTCAGGAAA
ACGATTCCCGTTTTGTCAGGCAAAATGTTGAATCCTCCCTAATAATTCAT
TACTCAATTGACGGCCAGGGGAAATCTCCAAAGAAAGATGCCAATTTTCC
TCCTGAGTTGGCTGTGAAAACTTCATTCAAATACCGGCAGCCGACGGGCC
AGGATCAGCAGGATGGGCATTGAAATTGTCAAATAGATGATATTATTCCC
AAAAGAGCAGTTATTCCCTCCCTCCCCTAGTTCGGTGTGCAAATATATTT
TATCAATAAATTTTCATTTTCGTTTCTCTTATTTTATTGCACATCGTCAT
GAAATATAATTATTTCCGGAAGTATTGGCAGGCCAGAACATTGGGCGAGT
AAGGTGGGTTAGGGGACATAACTGTAAAGGAACGCCAATCTAAAGGTTTC
TGTAGGATACTGACTCTTTAACTACTTA
back to top

protein sequence of SMED30029695-orf-1

>SMED30029695-orf-1 ID=SMED30029695-orf-1|Name=SMED30029695-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1328bp
MVNMYIKGHSSLKCKTNIKIWLKLKYFCYQKFVRYHHWKILLIGIGFLGL
CWLGFKSVEFETDVMNLWIYNSSRLHNETSFISRVSGSKIESGSIETILQ
VSTHNNLLSTEFLLEHLQLLQNVVNVTLQYDRRSFTFSDFCQRVQLPKLH
YLHDRSLRVSVENLMPCRIISPLNCFWEGSKLLDHYSKNKFSNYDESRSI
KIDWKSFNISQEFFYSFKETSNYNFFYELFKEAGIKSGFISKPCLDVTDA
SCPNRLKQKPSYESIVNEGCAQIGEHMDKYSKSIFIGKDNRGLQTFLLLQ
STSHVLETMKINNLEWPESKVQDVMNLWLQKLQQTVIHFNSHRPYLESIP
YRNAKFQSQRIRKSSFYVFTNNSLNSALNQANKDETLLAKYLTSGGVVML
FVVLIFVSSDNLVRSHCWLAVTSTSLLIAAILSGLGLMAAIGFTFNALTT
QVVPFVMVGLGLEEVIILTKKYSKNIDICRQKINHPHPVAQTLYDCATIL
MVSFSIKLIVLSALTMIPVPLMRNFCIQILFIMLLQTGVNAFLYPCLLHL
DSVRRESNRIDLLCCLLKRQTPNDSTESYSAVPRQYDCVRKDSNLLKSKI
IFSTEFTTAPDTFIPNNVHQYCEINPVDLSPRSEPSTSRSFPLNSSVDNN
LEPKPLKNKRHRCCWKFHYRLSKTFLHIIVLVPVQITVILVTLLIIVMGL
YSAVNIDCGLLFESIFPRDSNEFHYIKYETELFRFQNFEIVTKEFEYTNN
QDILLQLHQEIDNLHHVALLENGKFWLSSFIGWLERIQSDFDRDVKNKLI
LANGTWSRNASKNGLLVMTLMVQDGESINYKKLSTSRLVRNGKVDERKFY
LFLNVWRSMSVEYETQPCLLYPKIEPFTVDNFTPSKYRKEPSVIRMSGLN
LFSNHPLQFVACKYFHKGQSSQEELDFVKTVRSITSRYTNNLSLPTIPIG
NIFTLSEQYLKLRYQLVIVSIILAIGMFVISLLAINHFLASILATLLLSS
SILSPMLFMNLYQIPLNATSGVMALWSGGLGFRFSLFLIVSYVEQTEMPP
SSTEAQPDMELSVSPSSGDTGNERTREPVAKDCIGSIFSVTFMVNKQKLI
RVERAFNDVPCGKAVFSTFLGMAFIIMTDISFLWRNFMLIPFVGLVHSLL
NYYYLAPIFCFYLIPKSDHKTRSPFVRNSDSYRCKSRPSHKSSTKSFRSQ
VSRNGSKFDLTNDNSAHGKLSIIPEESSSVQSSLKSKDCCDNDHINNSSS
SSDSSSSSSSSSSDSSQSQENDSRFVRQNVESSLIIHYSIDGQGKSPKKD
ANFPPELAVKTSFKYRQPTGQDQQDGH*
back to top
Aliases
The feature 'patched-like protein' has the following synonyms
Synonym
patched-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000062esophagus
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003392Ptc/Disp
IPR000731SSD
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003392Protein patched/dispatchedPFAMPF02460Patchedcoord: 365..877
e-value: 3.6E-20
score: 71.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1246..1286
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1050..1075
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1050..1073
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1246..1327
NoneNo IPR availablePANTHERPTHR46022FAMILY NOT NAMEDcoord: 23..1044
NoneNo IPR availablePANTHERPTHR46022:SF1PROTEIN PATCHEDcoord: 23..1044
NoneNo IPR availableSUPERFAMILYSSF82866Multidrug efflux transporter AcrB transmembrane domaincoord: 954..1049
NoneNo IPR availableSUPERFAMILYSSF82866Multidrug efflux transporter AcrB transmembrane domaincoord: 394..550
NoneNo IPR availableTMHMMTMhelixcoord: 962..984
NoneNo IPR availableTMHMMTMhelixcoord: 1143..1165
NoneNo IPR availableTMHMMTMhelixcoord: 1114..1133
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 426..448
NoneNo IPR availableTMHMMTMhelixcoord: 526..548
NoneNo IPR availableTMHMMTMhelixcoord: 675..697
NoneNo IPR availableTMHMMTMhelixcoord: 1021..1043
NoneNo IPR availableTMHMMTMhelixcoord: 989..1011
NoneNo IPR availableTMHMMTMhelixcoord: 387..406
NoneNo IPR availableTMHMMTMhelixcoord: 499..521
IPR000731Sterol-sensing domainPROSITEPS50156SSDcoord: 397..550
score: 22.251