Kinesin light chain

Overview
NameKinesin light chain
Smed IDSMED30029694
Length (bp)2800
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin light chain (SMED30029694) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin light chain (SMED30029694) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin light chain (SMED30029694) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin light chain (SMED30029694) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029694

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029694SMESG000023454.1 SMESG000018677.1 SMESG000018676.1 dd_Smed_v4_6449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029694SMESG000023454.1 SMESG000018677.1 SMESG000018676.1 dd_Smed_v4_6449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029694SMESG000023454.1 SMESG000018677.1 SMESG000018676.1 dd_Smed_v4_6449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029694SMESG000023454.1 SMESG000018677.1 SMESG000018676.1 dd_Smed_v4_6449_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC2 (kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC:20716])

HSP 1 Score: 349.362 bits (895), Expect = 3.200e-108
Identity = 195/435 (44.83%), Postives = 269/435 (61.84%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSEL---SLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L      +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ +++              K  + ++ NE K  +P +     T   +  N        + G  ++             +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     D  +KPIW+ AEERE+ K++
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIR--------------KLDEDASPNEEKGDVPKD-----TLDDLFPNEDEQSPAPSPGGGDVSGQHGG-------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGD--NKPIWMHAEEREESKDK 424          
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC2 (kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC:20716])

HSP 1 Score: 349.362 bits (895), Expect = 3.200e-108
Identity = 195/435 (44.83%), Postives = 269/435 (61.84%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSEL---SLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L      +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ +++              K  + ++ NE K  +P +     T   +  N        + G  ++             +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     D  +KPIW+ AEERE+ K++
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIR--------------KLDEDASPNEEKGDVPKD-----TLDDLFPNEDEQSPAPSPGGGDVSGQHGG-------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGD--NKPIWMHAEEREESKDK 424          
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC2 (kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC:20716])

HSP 1 Score: 349.362 bits (895), Expect = 3.200e-108
Identity = 195/435 (44.83%), Postives = 269/435 (61.84%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSEL---SLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L      +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ +++              K  + ++ NE K  +P +     T   +  N        + G  ++             +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     D  +KPIW+ AEERE+ K++
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIR--------------KLDEDASPNEEKGDVPKD-----TLDDLFPNEDEQSPAPSPGGGDVSGQHGG-------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGD--NKPIWMHAEEREESKDK 424          
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 343.969 bits (881), Expect = 4.646e-107
Identity = 186/389 (47.81%), Postives = 253/389 (65.04%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTD--LSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQK E    +L+E+ K+L F+ +L+   +  +    K+  ST   L ++  N    P           +   + ++      G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEERE+ K +
Sbjct:   77 EMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDP--------GQGIQQQHSSAAAAAQQGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREECKGK 439          
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 343.969 bits (881), Expect = 4.990e-107
Identity = 186/389 (47.81%), Postives = 253/389 (65.04%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTD--LSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQK E    +L+E+ K+L F+ +L+   +  +    K+  ST   L ++  N    P           +   + ++      G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEERE+ K +
Sbjct:   77 EMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDP--------GQGIQQQHSSAAAAAQQGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREECKGK 439          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 338.191 bits (866), Expect = 5.395e-106
Identity = 189/446 (42.38%), Postives = 273/446 (61.21%), Query Frame = 3
Query:   90 SSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKEL------VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRS 1409
            S DD T   G++  ++  E L+ E   + + L  +    + D+  +   ++ ++      +   + +T  M  ++   + +  +   ++ Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+NK+L ++  ++   +   +    +         NE   ++          +   FN  T         +N +  S N  Y     E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L EAL IR+K LG   P VAATLNNL+VL+ K+G   +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVEKYY+RAL IY +     D NV KTKN+L+S+Y+KQGKY++AE L K IL  A ++++   +   ++KPIW IAEERE+ K++ 
Sbjct:    5 SQDDVTT--GLRTVQQGLEALREEHSTISNTLETSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTP--------ANQMAASANVGY-----EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFG--QISGENKPIWQIAEEREENKHKG 433          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 338.191 bits (866), Expect = 5.395e-106
Identity = 189/446 (42.38%), Postives = 273/446 (61.21%), Query Frame = 3
Query:   90 SSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKEL------VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRS 1409
            S DD T   G++  ++  E L+ E   + + L  +    + D+  +   ++ ++      +   + +T  M  ++   + +  +   ++ Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+NK+L ++  ++   +   +    +         NE   ++          +   FN  T         +N +  S N  Y     E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L EAL IR+K LG   P VAATLNNL+VL+ K+G   +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVEKYY+RAL IY +     D NV KTKN+L+S+Y+KQGKY++AE L K IL  A ++++   +   ++KPIW IAEERE+ K++ 
Sbjct:    5 SQDDVTT--GLRTVQQGLEALREEHSTISNTLETSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTP--------ANQMAASANVGY-----EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFG--QISGENKPIWQIAEEREENKHKG 433          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 339.347 bits (869), Expect = 6.232e-106
Identity = 189/446 (42.38%), Postives = 273/446 (61.21%), Query Frame = 3
Query:   90 SSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKEL------VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRS 1409
            S DD T   G++  ++  E L+ E   + + L  +    + D+  +   ++ ++      +   + +T  M  ++   + +  +   ++ Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+NK+L ++  ++   +   +    +         NE   ++          +   FN  T         +N +  S N  Y     E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L EAL IR+K LG   P VAATLNNL+VL+ K+G   +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVEKYY+RAL IY +     D NV KTKN+L+S+Y+KQGKY++AE L K IL  A ++++   +   ++KPIW IAEERE+ K++ 
Sbjct:    5 SQDDVTT--GLRTVQQGLEALREEHSTISNTLETSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTP--------ANQMAASANVGY-----EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFG--QISGENKPIWQIAEEREENKHKG 433          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 339.347 bits (869), Expect = 6.232e-106
Identity = 189/446 (42.38%), Postives = 273/446 (61.21%), Query Frame = 3
Query:   90 SSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKEL------VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRS 1409
            S DD T   G++  ++  E L+ E   + + L  +    + D+  +   ++ ++      +   + +T  M  ++   + +  +   ++ Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+NK+L ++  ++   +   +    +         NE   ++          +   FN  T         +N +  S N  Y     E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L EAL IR+K LG   P VAATLNNL+VL+ K+G   +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVEKYY+RAL IY +     D NV KTKN+L+S+Y+KQGKY++AE L K IL  A ++++   +   ++KPIW IAEERE+ K++ 
Sbjct:    5 SQDDVTT--GLRTVQQGLEALREEHSTISNTLETSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTP--------ANQMAASANVGY-----EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFG--QISGENKPIWQIAEEREENKHKG 433          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 338.576 bits (867), Expect = 6.829e-106
Identity = 192/454 (42.29%), Postives = 279/454 (61.45%), Query Frame = 3
Query:   90 SSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKEL------VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTM---SFN-----NITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRS 1409
            S DD T   G++  ++  E L+ E   + + L  +    + D+  +   ++ ++      +   + +T  M  ++   + +  +   ++ Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+NK+L ++  +               K  D    ++ K+ + +     +TN T+    F      ++ +   N    +N +  S N  Y     E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L EAL IR+K LG   P VAATLNNL+VL+ K+G   +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVEKYY+RAL IY +     D NV KTKN+L+S+Y+KQGKY++AE L K IL  A ++++   +   ++KPIW IAEERE+ K++ 
Sbjct:   26 SQDDVTT--GLRTVQQGLEALREEHSTISNTLETSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASI---------------KQFDDGTQSDTKTSVDVG-PQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGY-----EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFG--QISGENKPIWQIAEEREENKHKG 454          
BLAST of Kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0331556)

HSP 1 Score: 347.051 bits (889), Expect = 4.479e-109
Identity = 184/395 (46.58%), Postives = 249/395 (63.04%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDL------SNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEERE--KLKNR 1406
            E ++  +S+ + M ++  +++ +  EK   K Q +RL++EN WLR+EL  TQ K Q  E    +L+E+ K+L F+  ++     +   +A +   TD          NE++  +     +   N T  +                              E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR KTLG + P VAATLNNL+VLY K+G + +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+DEVEKYYQRAL+IY +     D NV KTKN+LA  Y+KQG+Y +AE L K +L  A ++++     D+K+KPIW +AEERE  K  NR
Sbjct:   52 ENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY------------------------------EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGA--IDSKNKPIWQVAEEREEHKFDNR 414          
BLAST of Kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0075951)

HSP 1 Score: 347.051 bits (889), Expect = 4.764e-109
Identity = 184/395 (46.58%), Postives = 249/395 (63.04%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDL------SNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEERE--KLKNR 1406
            E ++  +S+ + M ++  +++ +  EK   K Q +RL++EN WLR+EL  TQ K Q  E    +L+E+ K+L F+  ++     +   +A +   TD          NE++  +     +   N T  +                              E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR KTLG + P VAATLNNL+VLY K+G + +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+DEVEKYYQRAL+IY +     D NV KTKN+LA  Y+KQG+Y +AE L K +L  A ++++     D+K+KPIW +AEERE  K  NR
Sbjct:   52 ENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY------------------------------EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGA--IDSKNKPIWQVAEEREEHKFDNR 414          
BLAST of Kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0331555)

HSP 1 Score: 347.051 bits (889), Expect = 4.764e-109
Identity = 184/395 (46.58%), Postives = 249/395 (63.04%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDL------SNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEERE--KLKNR 1406
            E ++  +S+ + M ++  +++ +  EK   K Q +RL++EN WLR+EL  TQ K Q  E    +L+E+ K+L F+  ++     +   +A +   TD          NE++  +     +   N T  +                              E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR KTLG + P VAATLNNL+VLY K+G + +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+DEVEKYYQRAL+IY +     D NV KTKN+LA  Y+KQG+Y +AE L K +L  A ++++     D+K+KPIW +AEERE  K  NR
Sbjct:   52 ENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY------------------------------EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGA--IDSKNKPIWQVAEEREEHKFDNR 414          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc4 (kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-050417-350])

HSP 1 Score: 344.354 bits (882), Expect = 1.434e-106
Identity = 197/435 (45.29%), Postives = 272/435 (62.53%), Query Frame = 3
Query:  135 KTFEKLKTEIDNLF-SELSLNQCYFQNDDMIMN------LYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKN---PK-STDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            +  E LK+E +++  S L   QC  ++++  +       L +  E+++  + + + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ K+QK E    +L+E+ K+L F+ +L+   +       KN   PK S D    N+   Q+           +   N+         G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D+P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YY RAL+IY       D NV KTKN+LAS Y+KQGKY++AE L K IL  A +K++     DA++KPIW+ AEERE+ K +
Sbjct:   29 QGLEALKSEHNSILQSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKVQKSEQSVAQLEEEKKHLEFMNQLKKYDDGATPEEEKNSDTPKDSLDDLFPNDEDDQV-----------SHQHNSAAVAAAQQGG-----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGNDNPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGREHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALDIYEKRLGPDDPNVAKTKNNLASCYLKQGKYKEAEILYKEILTRAHEKEFGC--VDAENKPIWMHAEEREESKGK 433          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc4 (kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-050417-350])

HSP 1 Score: 344.354 bits (882), Expect = 1.434e-106
Identity = 197/435 (45.29%), Postives = 272/435 (62.53%), Query Frame = 3
Query:  135 KTFEKLKTEIDNLF-SELSLNQCYFQNDDMIMN------LYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKN---PK-STDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            +  E LK+E +++  S L   QC  ++++  +       L +  E+++  + + + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ K+QK E    +L+E+ K+L F+ +L+   +       KN   PK S D    N+   Q+           +   N+         G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D+P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YY RAL+IY       D NV KTKN+LAS Y+KQGKY++AE L K IL  A +K++     DA++KPIW+ AEERE+ K +
Sbjct:   29 QGLEALKSEHNSILQSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKVQKSEQSVAQLEEEKKHLEFMNQLKKYDDGATPEEEKNSDTPKDSLDDLFPNDEDDQV-----------SHQHNSAAVAAAQQGG-----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGNDNPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGREHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALDIYEKRLGPDDPNVAKTKNNLASCYLKQGKYKEAEILYKEILTRAHEKEFGC--VDAENKPIWMHAEEREESKGK 433          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 338.191 bits (866), Expect = 1.522e-104
Identity = 181/394 (45.94%), Postives = 252/394 (63.96%), Query Frame = 3
Query:  231 LYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTG------NSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREK 1394
            + R  E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ +LQK E    +L+E+ K+L F                       ++ + +    +  +      +S  + +++    ++  G      +S+ +  +    Y +P      RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEERE+
Sbjct:   77 IQRSMEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEF-----------------------MNQLKKYDQDLSPSDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVAAAQQGGYEIPA-----RLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFG--SVDDENKPIWMHAEEREE 440          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 337.806 bits (865), Expect = 2.390e-104
Identity = 181/394 (45.94%), Postives = 252/394 (63.96%), Query Frame = 3
Query:  231 LYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTG------NSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREK 1394
            + R  E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ +LQK E    +L+E+ K+L F                       ++ + +    +  +      +S  + +++    ++  G      +S+ +  +    Y +P      RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEERE+
Sbjct:   77 IQRSMEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEF-----------------------MNQLKKYDQDLSPSDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVAAAQQGGYEIPA-----RLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFG--SVDDENKPIWMHAEEREE 440          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc3 (kinesin light chain 3 [Source:ZFIN;Acc:ZDB-GENE-060929-772])

HSP 1 Score: 333.183 bits (853), Expect = 1.020e-103
Identity = 178/380 (46.84%), Postives = 246/380 (64.74%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEE 1385
            E ++  + + + M ++  ++  L  EK   + Q +RL +EN WLR+EL   Q +LQ++E E + L+E+N++L F+  ++            + + T L + +              T+   S +++    E    + +    S         +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE+SSGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+ EVE+YY+RAL+IY +     D+NV KTKN+LAS Y+KQGKY+ AE L K IL  A +K++   E D   +P+W+  EE
Sbjct:   59 ERIELGLGEAQVMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELSRAQQQLQEREQEVVTLEEQNRHLQFMSSIRKY----------DHEETSLEDKDS-------------TSGKESLDDLFPTEEEEQTHMSQPHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHSHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGMDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYQEVEQYYERALHIYQSQLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFGSVEGDG--RPVWIHTEE 413          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 320.857 bits (821), Expect = 1.514e-98
Identity = 152/235 (64.68%), Postives = 187/235 (79.57%), Query Frame = 3
Query:  702 HEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEEREK K +
Sbjct:  207 YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREKFKGK 439          

HSP 2 Score: 77.7962 bits (190), Expect = 3.568e-14
Identity = 48/119 (40.34%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  951 GPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGIL 1307
            G + P    TL+NL + YA QG +  A PLC+ AL+  E   G  HPDVA  LN LAL+  +Q K+ +       AL I   +       V  T N+LA  Y K+GKY++AE L K  L
Sbjct:  206 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRAL 324          

HSP 3 Score: 52.7582 bits (125), Expect = 2.347e-6
Identity = 26/75 (34.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFL 470
            E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+ K+L F+
Sbjct:   77 EMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFM 151          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 321.242 bits (822), Expect = 1.708e-98
Identity = 152/235 (64.68%), Postives = 187/235 (79.57%), Query Frame = 3
Query:  702 HEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEEREK K +
Sbjct:  182 YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREKFKGK 414          

HSP 2 Score: 77.411 bits (189), Expect = 4.893e-14
Identity = 48/119 (40.34%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  951 GPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGIL 1307
            G + P    TL+NL + YA QG +  A PLC+ AL+  E   G  HPDVA  LN LAL+  +Q K+ +       AL I   +       V  T N+LA  Y K+GKY++AE L K  L
Sbjct:  181 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRAL 299          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 322.013 bits (824), Expect = 1.893e-98
Identity = 153/235 (65.11%), Postives = 187/235 (79.57%), Query Frame = 3
Query:  702 HEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEEREK K R
Sbjct:  203 YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREKFKVR 435          

HSP 2 Score: 78.1814 bits (191), Expect = 3.766e-14
Identity = 48/119 (40.34%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  951 GPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGIL 1307
            G + P    TL+NL + YA QG +  A PLC+ AL+  E   G  HPDVA  LN LAL+  +Q K+ +       AL I   +       V  T N+LA  Y K+GKY++AE L K  L
Sbjct:  202 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRAL 320          

HSP 3 Score: 53.1434 bits (126), Expect = 2.016e-6
Identity = 26/75 (34.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFL 470
            E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+ K+L F+
Sbjct:   73 EMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFM 147          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 322.013 bits (824), Expect = 2.119e-98
Identity = 153/238 (64.29%), Postives = 189/238 (79.41%), Query Frame = 3
Query:  702 HEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRSMS 1415
            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEEREK K R ++
Sbjct:  200 YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREKFKVRYLT 435          

HSP 2 Score: 78.5666 bits (192), Expect = 2.658e-14
Identity = 48/119 (40.34%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  951 GPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGIL 1307
            G + P    TL+NL + YA QG +  A PLC+ AL+  E   G  HPDVA  LN LAL+  +Q K+ +       AL I   +       V  T N+LA  Y K+GKY++AE L K  L
Sbjct:  199 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRAL 317          

HSP 3 Score: 53.5286 bits (127), Expect = 1.604e-6
Identity = 26/75 (34.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFL 470
            E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+ K+L F+
Sbjct:   70 EMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFM 144          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 322.013 bits (824), Expect = 4.070e-98
Identity = 152/235 (64.68%), Postives = 187/235 (79.57%), Query Frame = 3
Query:  702 HEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEEREK K +
Sbjct:  207 YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREKFKGK 439          

HSP 2 Score: 78.1814 bits (191), Expect = 3.261e-14
Identity = 48/119 (40.34%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  951 GPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGIL 1307
            G + P    TL+NL + YA QG +  A PLC+ AL+  E   G  HPDVA  LN LAL+  +Q K+ +       AL I   +       V  T N+LA  Y K+GKY++AE L K  L
Sbjct:  206 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRAL 324          

HSP 3 Score: 52.7582 bits (125), Expect = 2.340e-6
Identity = 26/75 (34.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFL 470
            E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+ K+L F+
Sbjct:   77 EMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFM 151          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc2 (kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:107953])

HSP 1 Score: 350.132 bits (897), Expect = 9.193e-109
Identity = 193/435 (44.37%), Postives = 268/435 (61.61%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSELS---LNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L+     +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ +++              K  + ++ NE K  +P +    +      F N        +     +            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     + ++KPIW+ AEERE+ K R
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQERCLLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIR--------------KLDEDASPNEEKGDVPKDSLDDL------FPNEDEQSPAPSPGGGDVAAQHGG------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFG--SVNGENKPIWMHAEEREESKRR 424          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc2 (kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:107953])

HSP 1 Score: 350.132 bits (897), Expect = 9.193e-109
Identity = 193/435 (44.37%), Postives = 268/435 (61.61%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSELS---LNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L+     +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ +++              K  + ++ NE K  +P +    +      F N        +     +            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     + ++KPIW+ AEERE+ K R
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQERCLLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIR--------------KLDEDASPNEEKGDVPKDSLDDL------FPNEDEQSPAPSPGGGDVAAQHGG------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFG--SVNGENKPIWMHAEEREESKRR 424          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc2 (kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:107953])

HSP 1 Score: 350.132 bits (897), Expect = 9.193e-109
Identity = 193/435 (44.37%), Postives = 268/435 (61.61%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSELS---LNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L+     +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ +++              K  + ++ NE K  +P +    +      F N        +     +            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     + ++KPIW+ AEERE+ K R
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQERCLLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIR--------------KLDEDASPNEEKGDVPKDSLDDL------FPNEDEQSPAPSPGGGDVAAQHGG------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFG--SVNGENKPIWMHAEEREESKRR 424          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc2 (kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:107953])

HSP 1 Score: 348.977 bits (894), Expect = 2.467e-108
Identity = 192/435 (44.14%), Postives = 269/435 (61.84%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSELS---LNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L+     +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ +++              K  + ++ NE K  +P +    +      F N        +     +            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     + ++KPIW+ AEERE+ K++
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQERCLLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIR--------------KLDEDASPNEEKGDVPKDSLDDL------FPNEDEQSPAPSPGGGDVAAQHGG------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFG--SVNGENKPIWMHAEEREESKDK 424          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 343.199 bits (879), Expect = 6.701e-107
Identity = 185/389 (47.56%), Postives = 253/389 (65.04%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTD--LSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQK E    +L+E+ K+L F+ +L+   +  +    K+  S+   L ++  N    P           +   + ++      G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEERE+ K +
Sbjct:   77 EMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLFPNDEDEP--------GQGIQQQHSSAAAAAQQGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREECKGK 439          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|P46824|KLC_DROME (Kinesin light chain OS=Drosophila melanogaster OX=7227 GN=Klc PE=1 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 4.775e-108
Identity = 184/395 (46.58%), Postives = 249/395 (63.04%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDL------SNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEERE--KLKNR 1406
            E ++  +S+ + M ++  +++ +  EK   K Q +RL++EN WLR+EL  TQ K Q  E    +L+E+ K+L F+  ++     +   +A +   TD          NE++  +     +   N T  +                              E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR KTLG + P VAATLNNL+VLY K+G + +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+DEVEKYYQRAL+IY +     D NV KTKN+LA  Y+KQG+Y +AE L K +L  A ++++     D+K+KPIW +AEERE  K  NR
Sbjct:   52 ENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY------------------------------EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGA--IDSKNKPIWQVAEEREEHKFDNR 414          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|P46825|KLC_DORPE (Kinesin light chain OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 1.247e-107
Identity = 184/393 (46.82%), Postives = 250/393 (63.61%), Query Frame = 3
Query:  252 VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQ--------IPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            ++  + + + M ++  +++    EK   + Q +RL +EN WLR+EL  TQ KLQ  E +   ++E+ K+L F+ E++                T+ + VNE K           P +         +S    +++ +  +G                  E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+G ++EA   L +AL IR+KTLGPD P VAATLNNL+VLY K+G + +AEPLC+ AL IRE +LG  HPDVAKQLNNLALLC NQGK++EVE+YYQRAL IY       D NV KTKN+LAS+Y+KQGKY+ AE L K +L  A +K++   + D  +KPIW+ AEERE+ K +
Sbjct:   85 IELGLGEAQVMMALANHLQHTEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQMSEQKVATIEEEKKHLEFMNEMKKY-------------DTNEAQVNEEKESEQSSLDLGFPDDDDDGGQPEVLSPTQPSAMAQAASGGC----------------EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALVIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVERYYQRALEIYQKELGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFGKVDDD--NKPIWMQAEEREENKAK 446          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|Q9H0B6|KLC2_HUMAN (Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.537e-107
Identity = 195/435 (44.83%), Postives = 269/435 (61.84%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSEL---SLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L      +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ +++              K  + ++ NE K  +P +     T   +  N        + G  ++             +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     D  +KPIW+ AEERE+ K++
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIR--------------KLDEDASPNEEKGDVPKD-----TLDDLFPNEDEQSPAPSPGGGDVSGQHGG-------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGD--NKPIWMHAEEREESKDK 424          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|Q5R581|KLC1_PONAB (Kinesin light chain 1 OS=Pongo abelii OX=9601 GN=KLC1 PE=2 SV=3)

HSP 1 Score: 344.739 bits (883), Expect = 1.543e-106
Identity = 186/389 (47.81%), Postives = 254/389 (65.30%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTD--LSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQK E    +L+E+ K+L F+ +L+   +  +    K+  ST   L ++  N    P           +   + ++      G+                +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEERE+ K +
Sbjct:   77 EMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDP--------GQGIQQQHSSAAAAAQQGD----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREECKGK 439          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|O88448|KLC2_MOUSE (Kinesin light chain 2 OS=Mus musculus OX=10090 GN=Klc2 PE=1 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.587e-106
Identity = 191/435 (43.91%), Postives = 265/435 (60.92%), Query Frame = 3
Query:  111 IFGIKCEKKTFEKLKTEIDNLFSELS---LNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            + G K   +  E L+ E   L + L+     +    + +  + L R  E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLREEL  TQ KLQ+ E    +L+E+ ++L F+ ++               +  D     E K  +P +    +      F N        +     +            +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  +++A   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQL+NLALLC NQGK +EVE YY+RAL IY T     D NV KTKN+LAS Y+KQGKYQDAETL K IL  A +K++     + ++KPIW+ AEERE+ K++
Sbjct:   18 VLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQERCLLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQI---------------RKLDEMLPQEEKGDVPKDSLDDL------FPNEDEQSPAPSPGGGDVAAQHGG------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFG--SVNGENKPIWMHAEEREESKDK 423          
BLAST of Kinesin light chain vs. TrEMBL
Match: H2Z633 (TPR_REGION domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 2.798e-111
Identity = 210/445 (47.19%), Postives = 289/445 (64.94%), Query Frame = 3
Query:   99 DNTPIFGI----KCEKKTFEKLKTEIDNLFSEL--SLNQCYFQNDDMIMNLYRIK--------ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEERE 1391
            DN P  GI    +   +  E+LK E +++   L  +LN    + D+ + NL   K        E+++  + + E M S+  ++  +  EK   K   +RL +EN WLR+EL  TQ+KLQ  E + ++L+E+  +L FL  ++           ++     L N  +  S +  ++ +S TN   S    TS+   +  +S+L +++ N+  S   +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  F+EA   L +AL IR+KTLGPD P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQ K++EVEKYYQRAL IY T+    D NV KTKN+LAS+Y+KQGK++ AETL K +L +A +K +     D K+KPIW+ AEERE
Sbjct:   14 DNRPPDGIVTSTRAVMQGLEQLKNEHNSILHSLLATLNAIRREKDEDV-NLVEEKSNIIKKSLEMIELGLGEAEMMVSLSCHLNTMESEKQRAKALIRRLCQENAWLRDELANTQNKLQMSEQKVVQLEEEKNHLEFLKSIRKFD--------EDLPDQGLGNTTKETSSME-DLFSSGTNGDGS----TSI--GSAPSSSLNQINSNSVAS-GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKFKEAGNLLNDALAIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGGDHPDVAKQLNNLALLCQNQSKYEEVEKYYQRALQIYETNLGPDDPNVAKTKNNLASAYMKQGKFKQAETLYKQVLTQAHEKDFG--SIDEKNKPIWMHAEERE 439          
BLAST of Kinesin light chain vs. TrEMBL
Match: A0A1S3IGZ4 (kinesin light chain isoform X10 OS=Lingula unguis OX=7574 GN=LOC106164206 PE=4 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 1.422e-110
Identity = 190/394 (48.22%), Postives = 263/394 (66.75%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIA-------TSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            E++   +++ + M ++  +++ +  EK   + Q +RL +EN WLR+EL  TQ KLQ  E +  E++E+NK+L F+ E++     +       P    +S+  ++K+ +PL++            +S MS +    + +   G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+G ++EA   L +AL IR+KTLGPD P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE+YYQRAL IY T     D NV KTKN+LAS+Y+KQGKY+ AE L K +L  A +K++   + D  +KPIW+ AEERE+ K +
Sbjct:   85 EMIDLGLNEAQVMMALTNHLQHVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQLSEQKVAEIEEQNKHLEFMKEMRKYDEEDTTQT--TPDQEPISSEKDSKN-LPLDLGFPDDDEDNQQQDSMMSPSQPMVMSQAAAGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALEIYETKLGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFG--KVDGDNKPIWMQAEEREENKGK 457          
BLAST of Kinesin light chain vs. TrEMBL
Match: H2XXU0 (TPR_REGION domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.908e-110
Identity = 210/447 (46.98%), Postives = 285/447 (63.76%), Query Frame = 3
Query:   99 DNTP-----IFGIKCEKKTFEKLKTEIDNLFSEL--SLNQCYFQNDDMIMNLYRIK--------ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFN-NITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEERE 1391
            DN P     I   +   +  E+LK E +++   L  +LN    + DD + NL   K        E+++  + + E M S+  ++  L  EK   K   +RL +EN WLR+EL  TQ+KLQ  E + ++L+E+  +L FL  ++       +  + NP S D               A+S+ +   S N    S  + +  +S+L +++ N+  S   +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  F+EA   L +AL IR+KTLGPD P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQ K++EVEKYYQRAL IY  +    D NV KTKN+LAS+Y+KQGK++ AETL K +L +A +K +     D K+KPIW+ AEERE
Sbjct:   12 DNRPPQDSIITNTRAVMQGLEQLKNEHNSILHSLLATLNAIRREKDDDV-NLVEEKSNIIKKSLEMIELGLGEAEMMVSLSCHLNTLESEKQRAKALIRRLCQENAWLRDELANTQNKLQMSEQKVVQLEEEKNHLEFLKSIRKFDEDLPDQGSTNP-SKD---------------ASSIEDLFGSGNPGDGSTADGSVQSSSLNQINSNSVAS-GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKFKEAGNLLNDALAIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGRDHPDVAKQLNNLALLCQNQSKYEEVEKYYQRALQIYENNLGPDDPNVAKTKNNLASAYMKQGKFKQAETLYKQVLTQAHEKDFG--SIDEKNKPIWMHAEERE 438          
BLAST of Kinesin light chain vs. TrEMBL
Match: A0A1S3IGY9 (kinesin light chain isoform X5 OS=Lingula unguis OX=7574 GN=LOC106164206 PE=4 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 2.924e-110
Identity = 190/394 (48.22%), Postives = 263/394 (66.75%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIA-------TSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            E++   +++ + M ++  +++ +  EK   + Q +RL +EN WLR+EL  TQ KLQ  E +  E++E+NK+L F+ E++     +       P    +S+  ++K+ +PL++            +S MS +    + +   G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+G ++EA   L +AL IR+KTLGPD P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE+YYQRAL IY T     D NV KTKN+LAS+Y+KQGKY+ AE L K +L  A +K++   + D  +KPIW+ AEERE+ K +
Sbjct:   85 EMIDLGLNEAQVMMALTNHLQHVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQLSEQKVAEIEEQNKHLEFMKEMRKYDEEDTTQT--TPDQEPISSEKDSKN-LPLDLGFPDDDEDNQQQDSMMSPSQPMVMSQAAAGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALEIYETKLGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFG--KVDGDNKPIWMQAEEREENKGK 457          
BLAST of Kinesin light chain vs. TrEMBL
Match: A0A1I8HH06 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 4.410e-110
Identity = 185/389 (47.56%), Postives = 255/389 (65.55%), Query Frame = 3
Query:  237 RIKELVK---FCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREK 1394
            R+ ELV+     I + E + ++  +I++L  +K   + Q +RL +EN WLREEL   Q +L ++E   + L+E+  +L F+ E++         +     ++   + +         ++T+  +  +  +   S      G SN L            +EVP RL+TLH LVIQYA+QGRYE+A+PLCKQ L DLE++SGH HPDVATMLNILALVYRD+G ++E+   L +AL IR+KTLGP+ P VAATLNNL+VLY K+G + EAEPLC  AL IRE +LGP HPDVAKQLNNLALLC NQGK+++VEKYYQRALNIY+ +    D NV KTKN+LAS+Y+KQGKY+ AE L K +L+ A ++  +GR      +PIW++AE RE+
Sbjct:   93 RLGELVEKLELGIDEGELLVAVSRHIQQLDSDKMKMRTQVRRLVQENAWLREELTAVQGRLHERESALVALEEERNHLKFMAEMRQIDPSSAAASGGAGPASTGKDDD--------TVSTAGDDDLLLGDAGGSPSHGGAGGSNALAAGGGG------YEVPARLRTLHNLVIQYASQGRYEVAVPLCKQALDDLERTSGHDHPDVATMLNILALVYRDQGKYRESATLLNDALVIREKTLGPEHPAVAATLNNLAVLYGKRGKYREAEPLCERALAIREKVLGPAHPDVAKQLNNLALLCQNQGKYEQVEKYYQRALNIYVQAQGPDDPNVAKTKNNLASAYLKQGKYRQAEQLYKEVLSRAHERGESGR----SGQPIWMLAEAREE 463          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: klc3 (kinesin light chain 1 [Source:NCBI gene;Acc:103044410])

HSP 1 Score: 349.747 bits (896), Expect = 5.843e-110
Identity = 181/380 (47.63%), Postives = 246/380 (64.74%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEE 1385
            E ++  + + + M ++  ++  L  EK   + Q +RL +EN WLR+EL   Q KLQ++E E + L+E+N++L F+  ++             P+  D  + +  +S   L        + +S  + ++V     G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE+SSGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+ EVE+YY+RAL+IY +     D+NV KTKN+LAS Y+KQGKY+ AE L K IL  A +K++   E D   +P+WV  EE
Sbjct:   60 EKIELGLGEAQMMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELSAAQQKLQEREQEVVTLEEQNRHLQFMSSIRKYDQ-------DEPQLEDKDSSSAKESLDDLFPTDEEEQTQISQPHSSAVAAAQQGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHSHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGLDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYQEVEEYYERALHIYQSRLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFGSVEGDG--RPVWVHPEE 414          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: klc3 (kinesin light chain 1 [Source:NCBI gene;Acc:103044410])

HSP 1 Score: 347.821 bits (891), Expect = 3.891e-109
Identity = 181/380 (47.63%), Postives = 246/380 (64.74%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEE 1385
            E ++  + + + M ++  ++  L  EK   + Q +RL +EN WLR+EL   Q KLQ++E E + L+E+N++L F+  ++             P+  D  + +  +S   L        + +S  + ++V     G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE+SSGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+ EVE+YY+RAL+IY +     D+NV KTKN+LAS Y+KQGKY+ AE L K IL  A +K++   E D   +P+WV  EE
Sbjct:   60 EKIELGLGEAQMMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELSAAQQKLQEREQEVVTLEEQNRHLQFMSSIRKYDQ-------DEPQLEDKDSSSAKESLDDLFPTDEEEQTQISQPHSSAVAAAQQGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHSHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGLDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYQEVEEYYERALHIYQSRLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFGSVEGDG--RPVWVHPEE 414          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: klc3 (kinesin light chain 1 [Source:NCBI gene;Acc:103044410])

HSP 1 Score: 347.821 bits (891), Expect = 3.891e-109
Identity = 181/380 (47.63%), Postives = 246/380 (64.74%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEE 1385
            E ++  + + + M ++  ++  L  EK   + Q +RL +EN WLR+EL   Q KLQ++E E + L+E+N++L F+  ++             P+  D  + +  +S   L        + +S  + ++V     G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE+SSGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+ EVE+YY+RAL+IY +     D+NV KTKN+LAS Y+KQGKY+ AE L K IL  A +K++   E D   +P+WV  EE
Sbjct:   60 EKIELGLGEAQMMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELSAAQQKLQEREQEVVTLEEQNRHLQFMSSIRKYDQ-------DEPQLEDKDSSSAKESLDDLFPTDEEEQTQISQPHSSAVAAAQQGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHSHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGLDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYQEVEEYYERALHIYQSRLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFGSVEGDG--RPVWVHPEE 414          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:103045712])

HSP 1 Score: 347.436 bits (890), Expect = 1.165e-108
Identity = 188/395 (47.59%), Postives = 256/395 (64.81%), Query Frame = 3
Query:  231 LYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPV-------HEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREK 1394
            + R  E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ +LQK E    +L+E+ K+L F+ +L+                 DLS  ++  S           +S  + +++    ++  G           P+S  V       +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEERE+
Sbjct:   77 IQRSLEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKY-------------DQDLSPTDDKDS----------DSSRETLDDLFPDEQDEPGPG------IQPPHSSAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREE 440          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:103045712])

HSP 1 Score: 348.591 bits (893), Expect = 2.240e-108
Identity = 188/395 (47.59%), Postives = 256/395 (64.81%), Query Frame = 3
Query:  231 LYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPV-------HEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREK 1394
            + R  E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ +LQK E    +L+E+ K+L F+ +L+                 DLS  ++  S           +S  + +++    ++  G           P+S  V       +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IY T     D NV KTKN+LAS Y+KQGK++ AETL K IL  A ++++     D ++KPIW+ AEERE+
Sbjct:   77 IQRSLEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKY-------------DQDLSPTDDKDS----------DSSRETLDDLFPDEQDEPGPG------IQPPHSSAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREE 440          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009139.1 (pep scaffold:Pmarinus_7.0:GL480151:1445:19017:1 gene:ENSPMAG00000008222.1 transcript:ENSPMAT00000009139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 358.221 bits (918), Expect = 2.295e-112
Identity = 187/395 (47.34%), Postives = 254/395 (64.30%), Query Frame = 3
Query:  252 VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSN 1436
            ++  +S+ + + ++  ++  +  EK   + Q +RL +EN WLREEL   Q +LQ+ E    +L+E+N++L F+      Q  + +  A  P+  D  +  E    +  N     ++S      ++       G                 +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YY+RAL+IYL    + D NV KTKN+LAS Y+KQGKY+DAE L K IL  A ++++     D ++KPIWV AEERE+ K +    E LP  
Sbjct:   75 IELGLSEAQVIVALASHLGSVEAEKQKLRAQVRRLCQENAWLREELATAQQRLQRSEQSVAQLEEENRHLQFM-----GQLRKYDDEASPPEEKDGESSKEPLDDLFPNDEDEQSSSMTQSRGMSGAAAAQQGG----------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAGNLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVETYYRRALDIYLLQLGTDDPNVAKTKNNLASCYLKQGKYKDAEALYKEILTRAHEREFG--SVDGENKPIWVHAEEREQSKGK--QKEALPCG 444          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 347.821 bits (891), Expect = 3.479e-109
Identity = 186/387 (48.06%), Postives = 249/387 (64.34%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNR 1406
            E+++  + + + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+ K+L F+ +++                 D+S   E K   P             F N     E  +  S+    S         +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQ K++EVE YYQRAL+IY +     D NV KTKN+LAS Y+KQGKY++AE L K IL  A +K++     D ++KPIW+ AEERE+ K +
Sbjct:   31 EMIRLGLGEAQVMVALTSHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQAVAQLEEEKKHLEFMNQMKKY-------------DDDISPSQEEKVSEPCKEPLDDL-----FPNEEDEQEQGSQPSHNAVNSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKVHPDVAKQLNNLALLCQNQSKYEEVEHYYQRALDIYQSQLGPDDPNVAKTKNNLASCYLKQGKYKEAEGLYKDILTRAHEKEFGS--VDGENKPIWMHAEEREEQKGK 397          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001329.1 (pep scaffold:Pmarinus_7.0:GL484789:104:2647:1 gene:ENSPMAG00000001191.1 transcript:ENSPMAT00000001329.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 3.349e-25
Identity = 57/109 (52.29%), Postives = 70/109 (64.22%), Query Frame = 3
Query: 1074 LGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLK 1400
            LG  HPDVAKQLNNLALLC NQ K+ EVE YYQRAL+IY       D NV KTKN+         KY+ AE L K IL  A ++++     + ++KPIW+ AEERE+ K
Sbjct:    1 LGKDHPDVAKQLNNLALLCQNQSKYGEVEHYYQRALDIYEGRLGPDDPNVAKTKNNR--------KYKAAEALYKEILTRAHEREFGA--INGENKPIWMHAEEREETK 99          

HSP 2 Score: 50.0618 bits (118), Expect = 5.036e-7
Identity = 56/201 (27.86%), Postives = 82/201 (40.80%), Query Frame = 3
Query:  825 GHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEA---EPLCRDALKIRETILGPHHPD-VAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETL-----------------LKGILNEAMDKQWNGRERDAKSKP 1364
            G  HPDVA  LN LAL+ +++  + E       AL+I +  LGPD P VA T NN      ++   AEA   E L R   +    I G + P  +  +      +C   G   + + +     N +  +       +  T  +L + Y +QGK + AETL                 +  ILNE M K    + RD    P
Sbjct:    2 GKDHPDVAKQLNNLALLCQNQSKYGEVEHYYQRALDIYEGRLGPDDPNVAKTKNN------RKYKAAEALYKEILTRAHEREFGAINGENKPIWMHAEEREETKVCVAGGAVRQGKGWNAVKENGWYRTCSINSPTLATTLKNLGALYRRQGKLEAAETLEEFASHSRKQDFVHQTRVADILNERMVKAEKRQSRDGAPPP 196          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: nphp3 (nephronophthisis 3 [Source:NCBI gene;Acc:562601])

HSP 1 Score: 93.5893 bits (231), Expect = 6.975e-20
Identity = 66/204 (32.35%), Postives = 104/204 (50.98%), Query Frame = 3
Query:  594 TNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSL------PVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNI 1187
             ++  S N +  V+    GN + +R+ F    ++      P H  P   ++L+ L      +G  E A  L ++ L   +++    HP +A  +  LAL+Y+  G  ++A+      +EIR+K  GP+ P VA  L NL+V+Y++   H EA PL   AL+  E  LGP HP VA+ L NLA+L + QG      + Y+RA  I
Sbjct:  463 ADAARSLNEL-GVLYYLQGNPDFMRLFFQRSLTMREKVLGPDH--PDCAQSLNNLASLCGERGESERAQCLYERALHSRQRALSRNHPALAYTVKQLALLYKKGGKLEKALPLYQLTVEIREKASGPNHPSVATALVNLAVVYSQLKRHDEALPLYERALRTYEDSLGPLHPRVAETLRNLAVLRYEQGDVAGAAELYKRATEI 663          

HSP 2 Score: 88.1965 bits (217), Expect = 3.691e-18
Identity = 68/218 (31.19%), Postives = 99/218 (45.41%), Query Frame = 3
Query:  711 PPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTL------------------------GPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETL 1292
            P    TLH+L   Y +  +   A  L +Q L  ++ + GH  P VA  L+ LA ++   G  ++A     +AL+IR+K                          G +S   A +LN L VLY  QGN        + +L +RE +LGP HPD A+ LNNLA LC  +G+ +  +  Y+RAL+    +       +  T   LA  Y K GK + A  L
Sbjct:  355 PSVAGTLHRLAAVYLSWRKPGPAQQLYEQALALVQNAHGHDDPRVARHLDALAALHHKHGRLEQAESLRRQALKIRQKAAAERGNVSGFELLRRRLLQLEEAPPGGESADAARSLNELGVLYYLQGNPDFMRLFFQRSLTMREKVLGPDHPDCAQSLNNLASLCGERGESERAQCLYERALHSRQRALSRNHPALAYTVKQLALLYKKGGKLEKALPL 572          

HSP 3 Score: 87.0409 bits (214), Expect = 9.443e-18
Identity = 63/192 (32.81%), Postives = 97/192 (50.52%), Query Frame = 3
Query:  723 KTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLK 1298
            ++L++L + Y  QG  +      +++L   E+  G  HPD A  LN LA +  ++G+ + A      AL  R++ L  + P +A T+  L++LY K G   +A PL +  ++IRE   GP+HP VA  L NLA++     + DE    Y+RAL  Y  S       V +T  +LA    +QG    A  L K
Sbjct:  467 RSLNELGVLYYLQGNPDFMRLFFQRSLTMREKVLGPDHPDCAQSLNNLASLCGERGESERAQCLYERALHSRQRALSRNHPALAYTVKQLALLYKKGGKLEKALPLYQLTVEIREKASGPNHPSVATALVNLAVVYSQLKRHDEALPLYERALRTYEDSLGPLHPRVAETLRNLAVLRYEQGDVAGAAELYK 658          

HSP 4 Score: 73.1738 bits (178), Expect = 1.856e-13
Identity = 47/113 (41.59%), Postives = 66/113 (58.41%), Query Frame = 3
Query:  726 TLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIR 1064
            T+ QL + Y   G+ E A+PL + T++  E++SG  HP VAT L  LA+VY       EA+     AL   + +LGP  P+VA TL NL+VL  +QG+ A A  L + A +IR
Sbjct:  552 TVKQLALLYKKGGKLEKALPLYQLTVEIREKASGPNHPSVATALVNLAVVYSQLKRHDEALPLYERALRTYEDSLGPLHPRVAETLRNLAVLRYEQGDVAGAAELYKRATEIR 664          

HSP 5 Score: 64.3142 bits (155), Expect = 1.045e-10
Identity = 54/180 (30.00%), Postives = 82/180 (45.56%), Query Frame = 3
Query:  834 HPDVATMLNILALVY---RDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETIL------------------------GPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETL 1292
            HP VA  L+ LA VY   R  G  Q+  E   +AL + +   G D P+VA  L+ L+ L+ K G   +AE L R ALKIR+                           G    D A+ LN L +L + QG  D +  ++QR+L +          +  ++ N+LAS   ++G+ + A+ L
Sbjct:  354 HPSVAGTLHRLAAVYLSWRKPGPAQQLYE---QALALVQNAHGHDDPRVARHLDALAALHHKHGRLEQAESLRRQALKIRQKAAAERGNVSGFELLRRRLLQLEEAPPGGESADAARSLNELGVLYYLQGNPDFMRLFFQRSLTMREKVLGPDHPDCAQSLNNLASLCGERGESERAQCL 530          

HSP 6 Score: 59.3066 bits (142), Expect = 3.702e-9
Identity = 34/96 (35.42%), Postives = 51/96 (53.12%), Query Frame = 3
Query:  900 EAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNI 1187
            +AV  L  +LE+R+  L PD P VA TL+ L+ +Y        A+ L   AL + +   G   P VA+ L+ LA L H  G+ ++ E   ++AL I
Sbjct:  334 QAVLMLQRSLELRETALDPDHPSVAGTLHRLAAVYLSWRKPGPAQQLYEQALALVQNAHGHDDPRVARHLDALAALHHKHGRLEQAESLRRQALKI 429          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO43009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV0])

HSP 1 Score: 340.117 bits (871), Expect = 2.276e-107
Identity = 176/362 (48.62%), Postives = 236/362 (65.19%), Query Frame = 3
Query:  252 VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNV-NENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWN 1334
            ++  + + + + ++  ++  +  EK   + Q KRL +EN WLREEL +TQ KLQ+ E    +L+E+ K+L F+  L               K  D   + N+  S I             + +  ++V  +T+G                V+E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + +AEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+DEVE+YYQRAL IY T     D NV KTKN+LAS+Y+KQGKY+ AETL K +L  A ++++ 
Sbjct:   69 IELGLGEAQVLMALCSHLSTVEAEKQKLRAQVKRLCQENAWLREELSVTQQKLQESEQSVAQLEEEKKHLEFMNSL--------------KKYDDDEGIENDISSDILSQDEDDHDVDDETLSQTSNVSASTSG----------------VYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLHDALTIREKTLGEDHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEQYYQRALEIYTTKLGPDDPNVAKTKNNLASAYLKQGKYKAAETLYKQVLTRAHEREFG 400          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO37603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFC9])

HSP 1 Score: 115.931 bits (289), Expect = 3.314e-26
Identity = 84/252 (33.33%), Postives = 127/252 (50.40%), Query Frame = 3
Query:  723 KTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSNSLPEKRHITSNGLN 1478
            ++L+++ + Y  Q  +E +    +++L   E+  G  HP+VA  L+ LA +Y D   + +A      AL+IR K   P+   VA+T+ +L+ LY KQG   +AEPL R AL+ RE I G +HP V   L+NLA++   Q K ++    Y+RAL IY  S       V +   +LA  Y  QG   +A  L K    EA D Q NG  R  +S+P             R+ S+ +L +N        TS+ L+
Sbjct: 1107 RSLNEIGVLYYLQNNHEASKSFFQRSLAMREEILGEDHPEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNHPGVGTALHNLAVVLCLQNKQEDAIPLYERALRIYEESLGPQHPRVAEVLVNLAKVYYDQGALGEAVRLYK----EASDIQQNG-PRSPQSRP------------GRAQSIGMLSNNGTVRNPSHTSHALD 1341          

HSP 2 Score: 103.99 bits (258), Expect = 1.380e-22
Identity = 72/225 (32.00%), Postives = 114/225 (50.67%), Query Frame = 3
Query:  711 PPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKT--------------------LGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDK 1325
            P   ++LH L   Y+  G +  A    KQ ++  + + G  H  +   L  L+++Y+    +  A      A+ IR+K+                    LGP S +++ +LN + VLY  Q NH  ++   + +L +RE ILG  HP+VA+ L+NLA L ++  ++D+ E  Y+RAL+I L +F    S V  T   LA+ Y KQGK+  AE L +  L EA +K
Sbjct:  999 PLVAQSLHYLAELYSHWGNFSAAEAFFKQAIEITQNALGADHFSLIKDLEGLSILYKKNEKYSLAESCHKRAIAIRQKSGVLIGVQAMKRKIIQVEELSLGPGSQELSRSLNEIGVLYYLQNNHEASKSFFQRSLAMREEILGEDHPEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQAL-EAREK 1222          

HSP 3 Score: 95.5153 bits (236), Expect = 6.441e-20
Identity = 58/159 (36.48%), Postives = 85/159 (53.46%), Query Frame = 3
Query:  711 PPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNI 1187
            P   ++LH L   Y    +Y+ A PL K+ L    ++    H  VA+ +  LA +YR +G F +A     +ALE R+K  G + P V   L+NL+V+   Q    +A PL   AL+I E  LGP HP VA+ L NLA + ++QG   E  + Y+ A +I
Sbjct: 1145 PEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNHPGVGTALHNLAVVLCLQNKQEDAIPLYERALRIYEESLGPQHPRVAEVLVNLAKVYYDQGALGEAVRLYKEASDI 1303          

HSP 4 Score: 79.337 bits (194), Expect = 4.984e-15
Identity = 52/164 (31.71%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  792 KQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDA 1283
            ++ +Q  E S G    +++  LN + ++Y  + + + +      +L +R++ LG D P+VA +L+NL+ LY     + +AEPL + AL IR     P H  VA  + +LA L   QGKFD+ E  Y++AL      F      V    ++LA     Q K +DA
Sbjct: 1088 RKIIQVEELSLGPGSQELSRSLNEIGVLYYLQNNHEASKSFFQRSLAMREEILGEDHPEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNHPGVGTALHNLAVVLCLQNKQEDA 1251          

HSP 5 Score: 67.0106 bits (162), Expect = 3.475e-11
Identity = 37/100 (37.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  888 GDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNI 1187
            G   +A  SL +ALEIR+  L PD P VA +L+ L+ LY+  GN + AE   + A++I +  LG  H  + K L  L++L     K+   E  ++RA+ I
Sbjct:  974 GLLSQAAPSLQKALEIRESVLDPDHPLVAQSLHYLAELYSHWGNFSAAEAFFKQAIEITQNALGADHFSLIKDLEGLSILYKKNEKYSLAESCHKRAIAI 1073          

HSP 6 Score: 56.225 bits (134), Expect = 7.068e-8
Identity = 41/128 (32.03%), Postives = 65/128 (50.78%), Query Frame = 3
Query:  927 LEIRKKTLGPDSPKVAATLNNLSVLYAK----QGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLK 1298
            L++ K     D P V   + NL V   +     G  ++A P  + AL+IRE++L P HP VA+ L+ LA L  + G F   E ++++A+ I   +  +   ++IK    L+  Y K  KY  AE+  K
Sbjct:  943 LDVIKSMENEDQPSV--LIANLYVAVGQFLKYLGLLSQAAPSLQKALEIRESVLDPDHPLVAQSLHYLAELYSHWGNFSAAEAFFKQAIEITQNALGADHFSLIKDLEGLSILYKKNEKYSLAESCHK 1068          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO36593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI60])

HSP 1 Score: 94.3597 bits (233), Expect = 4.367e-22
Identity = 57/186 (30.65%), Postives = 96/186 (51.61%), Query Frame = 3
Query:  726 TLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDA 1283
            +L  L + Y+ QG+Y  A+ L  Q+L+ L   +G  H  V  +LN + +VY   GDF  A+      LEI +   G   P VA  LN L  +Y   GN  +A+ +   +L+I+E +    H  V + LN+L ++    G+ ++  K   RAL+ +  ++    + V+ T+NSL +++   GK + A
Sbjct:    1 SLLNLAVVYSRQGKYSKALALYNQSLEILADINGPRHVSVGRVLNTIGIVYYRLGDFPYAICYSERGLEILEAGHGKYHPHVAEALNFLGFMYRDHGNLEKAKKVLEHSLEIKEKVFNAEHFIVGEALNDLGVVYTRLGETEKAVKVLGRALDTFKRTWGEKHTAVLTTQNSLGAAFCAIGKPEKA 186          

HSP 2 Score: 75.0998 bits (183), Expect = 2.230e-15
Identity = 48/153 (31.37%), Postives = 75/153 (49.02%), Query Frame = 3
Query:  723 KTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRAL 1181
            + L+ + I Y   G +  AI   ++ L+ LE   G YHP VA  LN L  +YRD G+ ++A + L  +LEI++K    +   V   LN+L V+Y + G   +A  +   AL   +   G  H  V    N+L       GK ++  + +Q AL
Sbjct:   42 RVLNTIGIVYYRLGDFPYAICYSERGLEILEAGHGKYHPHVAEALNFLGFMYRDHGNLEKAKKVLEHSLEIKEKVFNAEHFIVGEALNDLGVVYTRLGETEKAVKVLGRALDTFKRTWGEKHTAVLTTQNSLGAAFCAIGKPEKAIELHQEAL 194          

HSP 3 Score: 63.1586 bits (152), Expect = 2.511e-11
Identity = 44/161 (27.33%), Postives = 76/161 (47.20%), Query Frame = 3
Query:  849 TMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQW 1331
            ++LN LA+VY  +G + +A+    ++LEI     GP    V   LN + ++Y + G+   A       L+I E   G +HP VA+ LN L  +  + G  ++ +K  + +L I    F +    V +  N L   Y + G+ + A  +L   L +   + W
Sbjct:    1 SLLN-LAVVYSRQGKYSKALALYNQSLEILADINGPRHVSVGRVLNTIGIVYYRLGDFPYAICYSERGLEILEAGHGKYHPHVAEALNFLGFMYRDHGNLEKAKKVLEHSLEIKEKVFNAEHFIVGEALNDLGVVYTRLGETEKAVKVLGRAL-DTFKRTW 159          

HSP 4 Score: 51.9878 bits (123), Expect = 1.776e-7
Identity = 35/120 (29.17%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  978 TLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNG 1337
            +L NL+V+Y++QG +++A  L   +L+I   I GP H  V + LN + ++ +  G F     Y +R L I          +V +  N L   Y   G  + A+ +L+  L E  +K +N 
Sbjct:    1 SLLNLAVVYSRQGKYSKALALYNQSLEILADINGPRHVSVGRVLNTIGIVYYRLGDFPYAICYSERGLEILEAGHGKYHPHVAEALNFLGFMYRDHGNLEKAKKVLEHSL-EIKEKVFNA 119          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO28725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5N6])

HSP 1 Score: 67.0106 bits (162), Expect = 3.283e-11
Identity = 53/187 (28.34%), Postives = 97/187 (51.87%), Query Frame = 3
Query:  732 HQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIY-LTSFPSTDSNVIKTKNSLASSYIKQGKYQDAET 1289
            H + +   + G YE A+   +Q LQ  E++      D A + + + +V +  G+++EA++   +AL++ ++T   +  K A   +N+ V+    GN+ EA    + AL++ E     +  D A   NN+ ++  + G ++E  KYYQ+AL ++  T   S  + V    NS+ S Y K+  Y DAE+
Sbjct:  672 HNIGVVQQSLGNYEEAMKYYQQVLQVFERTGNE--SDQADVRHNIGVVQQSLGNYEEAMKYYQQALQVFERT--GNESKQANVRHNIGVVQQSLGNYEEAMKYYQQALQVFERT--GNESDQADVRNNIGVVQQSLGNYEEAMKYYQQALQVFERTGNESAKAGVY---NSIGSMYRKKQNYLDAES 849          

HSP 2 Score: 62.7734 bits (151), Expect = 7.441e-10
Identity = 43/149 (28.86%), Postives = 80/149 (53.69%), Query Frame = 3
Query:  750 YATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLT 1196
            Y ++G YE A+  C+Q LQ +  S+G+     A +   + LV +  G+++EA++   +AL++   T G +S +    L N+  +Y   GN+ EA   C+ AL++   I   +    A    ++ L+  + G ++E  KYYQ+AL +++ 
Sbjct:   62 YQSKGNYEEAMKYCQQALQ-VYISTGN-ESKQADVRQSIGLVQQSLGNYEEAIKYYQQALQVYIST-GNESKQAGVRL-NIGAVYQSLGNYEEAMKYCQQALQV--YISTGNESKQADVRQSIGLVQQSLGNYEEAIKYYQQALQVFIA 204          

HSP 3 Score: 53.9138 bits (128), Expect = 3.440e-7
Identity = 37/134 (27.61%), Postives = 70/134 (52.24%), Query Frame = 3
Query:  882 DKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDA 1283
            D G  +EA+E   +AL++   T G +S +    LN +  +Y  +GN+ EA   C+ AL++   I   +    A    ++ L+  + G ++E  KYYQ+AL +Y+++    +S     + ++ + Y   G Y++A
Sbjct:   24 DLGKHREALEQYQQALQVYIST-GNESDQADVRLN-IGAVYQSKGNYEEAMKYCQQALQV--YISTGNESKQADVRQSIGLVQQSLGNYEEAIKYYQQALQVYIST--GNESKQAGVRLNIGAVYQSLGNYEEA 151          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO49938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFD0])

HSP 1 Score: 63.5438 bits (153), Expect = 3.252e-10
Identity = 39/136 (28.68%), Postives = 67/136 (49.26%), Query Frame = 3
Query:  786 LCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYL 1193
            L  ++L    Q  G  HPD+AT    +A V+    D  +AV    +A+ + ++ LG D P+      +L++     G  + A  L   A  +   + G  HPD++   +N+ L+ H Q +F   EK+ ++ALN+ L
Sbjct:  920 LMLESLNLFHQVYGPLHPDIATCYRAIARVHYLADDAAQAVGYQKKAVLVCERVLGVDHPETIIAFVHLALYCHSAGLASVALKLMYRARYLALLVFGEGHPDMSTFDSNIGLILHGQREFKISEKFMEKALNVQL 1055          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:101163537])

HSP 1 Score: 342.428 bits (877), Expect = 7.226e-107
Identity = 193/430 (44.88%), Postives = 263/430 (61.16%), Query Frame = 3
Query:  135 KTFEKLKTE----IDNLFSELSLNQCYFQNDDMIM------NLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREK 1394
            +  E LK E    +D L   L   +C  Q+++ ++       + +  E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+ K+L F+ +L+                 DLS   E  S          +  T+         +   G       +         +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+DEVE YY RAL IY T     D NV KTKN+LAS Y+KQ K++ AETL K IL  A ++++     D ++KPIW+ AEERE+
Sbjct:   33 QGLEALKQEHHSILDGLLGTL---RCLKQDEEGVLVEEKSHMIRKSLEMLELGLSEAQVMMALSTHLSSVESEKQKLRAQVRRLCQENQWLRDELAGTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKY-------------DEDLSPSEEKDS--------DSSKETLDDLFPDDQDDQAPGIQPAHGSAAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEYYYMRALEIYQTQLGPDDPNVAKTKNNLASCYLKQSKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEEREE 436          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:101163537])

HSP 1 Score: 343.584 bits (880), Expect = 3.428e-106
Identity = 193/429 (44.99%), Postives = 262/429 (61.07%), Query Frame = 3
Query:  135 KTFEKLKTE----IDNLFSELSLNQCYFQNDDMIM------NLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEERE 1391
            +  E LK E    +D L   L   +C  Q+++ ++       + +  E+++  +S+ + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQ+ E    +L+E+ K+L F+ +L+                 DLS   E  S          +  T+         +   G       +         +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+DEVE YY RAL IY T     D NV KTKN+LAS Y+KQ K++ AETL K IL  A ++++     D ++KPIW+ AEERE
Sbjct:   33 QGLEALKQEHHSILDGLLGTL---RCLKQDEEGVLVEEKSHMIRKSLEMLELGLSEAQVMMALSTHLSSVESEKQKLRAQVRRLCQENQWLRDELAGTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKY-------------DEDLSPSEEKDS--------DSSKETLDDLFPDDQDDQAPGIQPAHGSAAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEYYYMRALEIYQTQLGPDDPNVAKTKNNLASCYLKQSKFKQAETLYKEILTRAHEREFGS--VDDENKPIWMHAEERE 435          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: ENSORLT00000016251.2 (kinesin light chain 1 [Source:NCBI gene;Acc:101171520])

HSP 1 Score: 343.584 bits (880), Expect = 3.592e-106
Identity = 187/385 (48.57%), Postives = 250/385 (64.94%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKS-QIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKL 1397
            E+++  + + + M ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KLQK E    +L+E+ K+L F+ +L+                 D+S   E K  + P +    +      F N     EN  G  +    +         +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK++EVE YY RAL IY       D NV KTKN+LAS ++KQGKY++AE L K IL  A +K++     DA++KPIW+ AEERE++
Sbjct:   73 EMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQNVAQLEEEKKHLEFMNQLKKY-------------DEDVSPTQEEKDRETPKDSLDDL------FPNEDE--ENNQGMQHQHNSAAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKEHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALEIYECRLGPDDPNVAKTKNNLASCFLKQGKYKEAEILYKEILTRAHEKEFGS--VDAENKPIWMHAEEREEM 434          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: klc3 (kinesin light chain 1 [Source:NCBI gene;Acc:101163426])

HSP 1 Score: 339.347 bits (869), Expect = 4.333e-106
Identity = 181/380 (47.63%), Postives = 240/380 (63.16%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEE 1385
            E ++  +S+ + M ++  ++  L  EK   + Q +RL +EN WLR+EL   Q +LQ  E + + L+E+N++L F+  ++             P   D  N +   S   L  A     S MS  + ++                        +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE+SSGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IRE +LG  HPDVAKQLNNLALLC NQGK+ EVE+YY+RAL+IY +     D+NV KTKN+LAS Y+KQGKY+ AE L K IL  A +K++   E D    P W  AE+
Sbjct:   60 ERIELGLSEAQVMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELANAQQRLQDTEQQVVTLEEQNRHLQFMSSMRKYDQ-------DEPPVDDKQNFSNKGSLDDLFPADDEEPSQMSQPHSSAAAAAQQ----------------GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHTHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGMDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYQEVEQYYERALHIYQSKLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFGSVEGDG--HPSWSGAED 414          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: ENSORLT00000010213.2 (kinesin light chain 2 [Source:NCBI gene;Acc:101159385])

HSP 1 Score: 339.347 bits (869), Expect = 1.207e-104
Identity = 180/386 (46.63%), Postives = 247/386 (63.99%), Query Frame = 3
Query:  246 ELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKN 1403
            E ++  + + + + ++  ++  +  EK   + Q +RL +EN WLR+EL  TQ KL   E    +L+E+ K+L F+ +++   +  +    KN    D +   E                  S +++  +  N   +    + S +       +E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE+SSGH HPDVATMLNILALVYRD+  ++EA   L +AL IR+KTLG D P VAATLNNL+VLY K+G + EAEPLC+ AL+IR  +LG  HPDVAKQLNNLALLC NQGK+DEVE YY +AL IY++     D NV KTKN+LA+ Y+KQGK++DAE L K IL  A +K++     D  +KPIW+ AEERE+ K 
Sbjct:   66 EDIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELAATQHKLHCSEQSVAQLEEEKKHLEFMNQIKKFDDDASPAEEKNQSCGDGAGAGE-----------------ASKDSLDDLFPNDD-DQGPAQPSGDVAAQHAGYEIPVRLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIRVKVLGKLHPDVAKQLNNLALLCQNQGKYDEVEYYYTQALEIYVSQLGPDDPNVAKTKNNLATCYLKQGKFKDAEVLYKEILTRAHEKEFGSVNND--NKPIWMHAEEREESKG 431          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000023454.1 (SMESG000023454.1)

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 534/662 (80.66%), Postives = 554/662 (83.69%), Query Frame = 3
Query:   84 MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSNSLPEKRHITSNGLNDSNATNDENFMNNPPYGFEMKQKNKEDXXXXXXXXXXXXXXYFRENKETAGNIIEEWLIWAGRALSKYEKDIKWISYESSLTQSDLYTSSQNDKSQTFWYRTPSPSKRSTSNLSSQRALHKSPFXXXXXXXXXXXXXXXXXXXXXXPEYSRQSNLPIKSKLPMHLSPYLYKTPITIIESKAKYESEKGNVYDNIDRC 2069
            MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLIELQNNQNIENNLNAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQ                                          Y  +G ++ A+    + L+  +++ G   P VA  LN L+++Y  +G+  EA     +AL+IR+  LGP  P VA  LNNL++L   QG   E E   + AL I  T                ASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSNSLPEKRHITSNGLND NATNDENFMNNPPYGFEMKQKNKEDKLVLLNALKLLASLYFRENKETAGNIIEEWLIWAGRALSKYEKDIKWISYESSLTQSDLYTSSQNDKSQTFWYRTPSPSKRSTSNLSSQRALHKSPFLLLDSSSSTNSNIDSSSSLLRLPEYSRQSNLPIKSKLPMHLSPYLYKTPITIIESKAKYESEKGNVYDNIDRC
Sbjct:    1 MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLIELQNNQNIENNLNAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQ------------------------------------------YATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRET----------------ASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSNSLPEKRHITSNGLNDPNATNDENFMNNPPYGFEMKQKNKEDKLVLLNALKLLASLYFRENKETAGNIIEEWLIWAGRALSKYEKDIKWISYESSLTQSDLYTSSQNDKSQTFWYRTPSPSKRSTSNLSSQRALHKSPFLLLDSSSSTNSNIDSSSSLLRLPEYSRQSNLPIKSKLPMHLSPYLYKTPITIIESKAKYESEKGNVYDNIDRC 604          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000018677.1 (SMESG000018677.1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 326/330 (98.79%), Postives = 328/330 (99.39%), Query Frame = 3
Query:   84 MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETI 1073
            MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIY YIEELRKEKDGFKLQAKRLNEENIWLREELK+TQDKLQKKELEFIELDEKNKNLNFLIELQNNQNIENNLNAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGN NLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRET+
Sbjct:    1 MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYCYIEELRKEKDGFKLQAKRLNEENIWLREELKMTQDKLQKKELEFIELDEKNKNLNFLIELQNNQNIENNLNAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNGNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETV 330          

HSP 2 Score: 72.7886 bits (177), Expect = 2.075e-13
Identity = 43/115 (37.39%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  963 PKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGIL 1307
            P    TL+ L + YA QG +  A PLC+  L+  E   G +HPDVA  LN LAL+  ++G F E  +    AL I   +       V  T N+L+  Y KQG + +AE L +  L
Sbjct:  210 PPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDAL 324          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000018677.1 (SMESG000018677.1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 293/296 (98.99%), Postives = 294/296 (99.32%), Query Frame = 3
Query:   84 MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKV 971
            MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIY YIEELRKEKDGFKLQAKRLNEENIWLREELK+TQDKLQKKELEFIELDEKNKNLNFLIELQNNQNIENNLNAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGN NLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKV
Sbjct:    1 MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNLYRIKELVKFCISDTEDMESIYCYIEELRKEKDGFKLQAKRLNEENIWLREELKMTQDKLQKKELEFIELDEKNKNLNFLIELQNNQNIENNLNAKNPKSTDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNGNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKV 296          

HSP 2 Score: 57.7658 bits (138), Expect = 1.402e-8
Identity = 31/75 (41.33%), Postives = 41/75 (54.67%), Query Frame = 3
Query:  963 PKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNI 1187
            P    TL+ L + YA QG +  A PLC+  L+  E   G +HPDVA  LN LAL+  ++G F E  +    AL I
Sbjct:  210 PPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEI 284          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000018676.1 (SMESG000018676.1)

HSP 1 Score: 432.95 bits (1112), Expect = 5.888e-146
Identity = 250/251 (99.60%), Postives = 250/251 (99.60%), Query Frame = 3
Query: 1317 MDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSNSLPEKRHITSNGLNDSNATNDENFMNNPPYGFEMKQKNKEDXXXXXXXXXXXXXXYFRENKETAGNIIEEWLIWAGRALSKYEKDIKWISYESSLTQSDLYTSSQNDKSQTFWYRTPSPSKRSTSNLSSQRALHKSPFXXXXXXXXXXXXXXXXXXXXXXPEYSRQSNLPIKSKLPMHLSPYLYKTPITIIESKAKYESEKGNVYDNIDRC 2069
            MDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSNSLPEKRHITSNGLND NATNDENFMNNPPYGFEMKQKNKEDKLVLLNALKLLASLYFRENKETAGNIIEEWLIWAGRALSKYEKDIKWISYESSLTQSDLYTSSQNDKSQTFWYRTPSPSKRSTSNLSSQRALHKSPFLLLDSSSSTNSNIDSSSSLLRLPEYSRQSNLPIKSKLPMHLSPYLYKTPITIIESKAKYESEKGNVYDNIDRC
Sbjct:    1 MDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSNSLPEKRHITSNGLNDPNATNDENFMNNPPYGFEMKQKNKEDKLVLLNALKLLASLYFRENKETAGNIIEEWLIWAGRALSKYEKDIKWISYESSLTQSDLYTSSQNDKSQTFWYRTPSPSKRSTSNLSSQRALHKSPFLLLDSSSSTNSNIDSSSSLLRLPEYSRQSNLPIKSKLPMHLSPYLYKTPITIIESKAKYESEKGNVYDNIDRC 251          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000010732.1 (SMESG000010732.1)

HSP 1 Score: 330.487 bits (846), Expect = 4.522e-103
Identity = 186/405 (45.93%), Postives = 261/405 (64.44%), Query Frame = 3
Query:  252 VKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLREELKLTQDKLQKKELEFIELDEKNKNLNFLXXXXXXXXXXXXXXAKNPK----------STDLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNTPYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHYHPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATLNNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCHNQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDAETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPSN 1436
            ++  I + E +  +Y +++    E++  K+Q  RLN+EN WLR+EL  TQ +L+  E    +L+E+NK ++F+ E++     ++    K+P           S+DL   +E+K Q P ++     +S++S  +                  F         E+P RL+TLH LVIQYA+QGRYE+A+PLCKQ L+DLE++SGH HPDVATMLNILALVYRD+G ++EA   L +AL IR+KTLGP    VAATLNNL+VLY K+G + EAEPLC+ AL IRE  LG  HPDVAKQLNNLALLC NQGK++EVE YYQRAL IYL      D NV KTK +LA++Y+KQ K+  AE+L K IL    ++++ G++ + + KPIWV+AEER++   ++  +  L S+
Sbjct:   64 IELGIEEAELIIQLYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDS---GKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDVMMQSQSSSVSHGS-----------------GF---------EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEF-GKD-NPQQKPIWVLAEERQECFTKNKEIPYLSSD 437          
The following BLAST results are available for this feature:
BLAST of Kinesin light chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLC23.200e-10844.83kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC23.200e-10844.83kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC23.200e-10844.83kinesin light chain 2 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC14.646e-10747.81kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC14.990e-10747.81kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc-25.395e-10642.38Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-25.395e-10642.38Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-26.232e-10642.38Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-26.232e-10642.38Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-26.829e-10642.29Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Klc4.479e-10946.58gene:FBgn0010235 transcript:FBtr0331556[more]
Klc4.764e-10946.58gene:FBgn0010235 transcript:FBtr0075951[more]
Klc4.764e-10946.58gene:FBgn0010235 transcript:FBtr0331555[more]
back to top
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc41.434e-10645.29kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
klc41.434e-10645.29kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
klc1a1.522e-10445.94kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
klc1a2.390e-10445.94kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
klc31.020e-10346.84kinesin light chain 3 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hira1.514e-9864.68histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira1.708e-9864.68histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira1.893e-9865.11histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira2.119e-9864.29histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira4.070e-9864.68histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klc29.193e-10944.37kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc29.193e-10944.37kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc29.193e-10944.37kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc22.467e-10844.14kinesin light chain 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc16.701e-10747.56kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Kinesin light chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46824|KLC_DROME4.775e-10846.58Kinesin light chain OS=Drosophila melanogaster OX=... [more]
sp|P46825|KLC_DORPE1.247e-10746.82Kinesin light chain OS=Doryteuthis pealeii OX=1051... [more]
sp|Q9H0B6|KLC2_HUMAN1.537e-10744.83Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=K... [more]
sp|Q5R581|KLC1_PONAB1.543e-10647.81Kinesin light chain 1 OS=Pongo abelii OX=9601 GN=K... [more]
sp|O88448|KLC2_MOUSE1.587e-10643.91Kinesin light chain 2 OS=Mus musculus OX=10090 GN=... [more]
back to top
BLAST of Kinesin light chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2Z6332.798e-11147.19TPR_REGION domain-containing protein OS=Ciona savi... [more]
A0A1S3IGZ41.422e-11048.22kinesin light chain isoform X10 OS=Lingula unguis ... [more]
H2XXU01.908e-11046.98TPR_REGION domain-containing protein OS=Ciona inte... [more]
A0A1S3IGY92.924e-11048.22kinesin light chain isoform X5 OS=Lingula unguis O... [more]
A0A1I8HH064.410e-11047.56TPR_REGION domain-containing protein OS=Macrostomu... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc35.843e-11047.63kinesin light chain 1 [Source:NCBI gene;Acc:103044... [more]
klc33.891e-10947.63kinesin light chain 1 [Source:NCBI gene;Acc:103044... [more]
klc33.891e-10947.63kinesin light chain 1 [Source:NCBI gene;Acc:103044... [more]
klc1a1.165e-10847.59kinesin light chain 1 [Source:NCBI gene;Acc:103045... [more]
klc1a2.240e-10847.59kinesin light chain 1 [Source:NCBI gene;Acc:103045... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009139.12.295e-11247.34pep scaffold:Pmarinus_7.0:GL480151:1445:19017:1 ge... [more]
klc1a3.479e-10948.06kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000001329.13.349e-2552.29pep scaffold:Pmarinus_7.0:GL484789:104:2647:1 gene... [more]
nphp36.975e-2032.35nephronophthisis 3 [Source:NCBI gene;Acc:562601][more]
back to top
BLAST of Kinesin light chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinesin light chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO430092.276e-10748.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376033.314e-2633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365934.367e-2230.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287253.283e-1128.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499383.252e-1028.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc1a7.226e-10744.88kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
klc1a3.428e-10644.99kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
ENSORLT00000016251.23.592e-10648.57kinesin light chain 1 [Source:NCBI gene;Acc:101171... [more]
klc34.333e-10647.63kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
ENSORLT00000010213.21.207e-10446.63kinesin light chain 2 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of Kinesin light chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023454.10.000e+080.66SMESG000023454.1[more]
SMESG000018677.12.075e-1398.79SMESG000018677.1[more]
SMESG000018677.11.402e-898.99SMESG000018677.1[more]
SMESG000018676.15.888e-14699.60SMESG000018676.1[more]
SMESG000010732.14.522e-10345.93SMESG000010732.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029694 ID=SMED30029694|Name=Kinesin light chain|organism=Schmidtea mediterranea sexual|type=transcript|length=2800bp
TAAGTTGATATTTTATTATTTAAACTAATATTCTCATTATTTTAATTAAA
ATTTTTATATATTTCCTTTTCCAAATTAGTAAAATGAAATCATCTGACGA
TAATACTCCAATATTTGGCATAAAGTGTGAGAAAAAGACATTTGAAAAGC
TGAAAACTGAAATAGACAATTTATTTTCCGAACTCAGTTTAAACCAGTGT
TATTTTCAAAATGATGATATGATAATGAACTTATATCGAATTAAAGAGTT
AGTTAAATTTTGCATTTCTGATACTGAGGATATGGAGTCTATTTATTTTT
ATATTGAAGAACTGCGTAAAGAAAAGGACGGTTTTAAATTACAAGCCAAA
CGTTTAAATGAAGAAAACATATGGCTAAGAGAAGAATTAAAACTGACTCA
AGATAAATTGCAGAAAAAAGAATTGGAATTCATAGAATTGGATGAAAAGA
ATAAAAATCTCAATTTTCTTATTGAATTACAAAATAATCAAAACATTGAA
AATAATCTGAATGCGAAAAATCCAAAGTCTACCGATTTGTCTAATGTTAA
CGAAAACAAATCTCAAATTCCATTAAATATAGCAACGTCAATGACTAATT
CAACAATGAGCTTTAATAATATTACATCAGTAATGGAAAATACCACCGGA
AATAGTAACCTTCTGCGTGTTAGCTTTAACACTCCATATTCACTGCCTGT
CCACGAAGTTCCACCAAGGCTAAAAACGCTTCATCAATTAGTAATTCAAT
ATGCAACCCAAGGTCGATATGAAATTGCCATACCACTATGTAAACAAACT
CTTCAAGATCTTGAGCAGAGTAGTGGTCACTATCACCCCGATGTAGCTAC
TATGCTCAATATTTTGGCATTGGTATACAGAGATAAAGGTGATTTTCAAG
AAGCAGTCGAATCATTGACTGAGGCTTTGGAGATTCGAAAGAAAACTCTT
GGACCAGATTCACCAAAAGTCGCTGCTACACTCAATAACTTATCAGTTCT
CTATGCTAAACAAGGAAATCATGCTGAAGCAGAACCTTTGTGTAGAGATG
CATTAAAAATAAGAGAAACCATACTTGGTCCTCATCACCCAGATGTCGCC
AAACAGTTAAATAATCTTGCTCTATTATGTCACAATCAAGGAAAATTTGA
TGAGGTTGAGAAATATTACCAACGTGCTCTCAATATTTATCTAACATCAT
TTCCATCTACGGACTCGAATGTTATCAAGACAAAAAATAGTTTGGCATCT
TCGTATATTAAACAAGGAAAGTATCAGGATGCTGAAACACTTCTTAAAGG
AATTCTCAATGAAGCAATGGATAAGCAGTGGAATGGAAGGGAGAGAGATG
CTAAGAGTAAACCTATTTGGGTAATTGCTGAAGAAAGAGAAAAATTGAAA
AACCGATCTATGTCAATGGAGATCTTACCATCAAATTCACTACCAGAAAA
ACGTCATATTACTTCAAATGGCCTAAATGACTCAAATGCGACTAACGATG
AAAATTTTATGAATAATCCACCATATGGATTTGAAATGAAACAGAAAAAT
AAAGAAGACAAACTAGTTCTCTTGAATGCTTTAAAATTATTGGCATCTCT
TTATTTCCGTGAAAATAAAGAAACAGCGGGGAACATCATTGAAGAATGGC
TTATCTGGGCTGGTCGAGCTCTTAGTAAATATGAAAAGGATATAAAATGG
ATATCATATGAAAGTTCACTTACACAAAGTGATTTGTATACATCTAGTCA
AAATGATAAATCACAAACGTTTTGGTATCGAACACCAAGTCCGAGTAAAC
GGTCAACATCTAACCTGTCTAGCCAGAGAGCTCTACACAAATCTCCGTTT
TTATTATTAGATTCCTCATCCTCTACTAATTCAAATATAGATAGTTCATC
AAGTTTACTCAGGCTTCCAGAATATTCAAGGCAATCCAATTTGCCGATTA
AATCCAAGTTACCGATGCATTTATCTCCATATTTATATAAAACTCCTATT
ACAATCATTGAATCAAAGGCGAAATATGAATCTGAAAAAGGCAACGTCTA
TGACAACATTGACAGATGTTAAAAACAAAGTATGTTATTTTCATAATACA
TAAGCCAATAATGTGTCAGAACAGTTTTCTCATTTTGTCTATAAAATATT
TATTTATCATTATAATAAAATCTTAAATAAGCAAATCAAATTCATTTTTT
ATTAACTCTTTCAGCCCGAATATCGTATATTTTCATAAACATTTTATGTC
TAATTACTGAAGACCGTTTTTTGAGCTTTATGTATTTAAGCGATGAATTT
CATAAACTGCCGTTTAATTCATCATAAAATTTAAACTTCCACATATCTCA
TATTTACAATATATATCTTAGTTGTCTGTTAGCTAATTGTGTACAAAAGA
ACAAAACAACTTATGTTGCATCAATTTGGAATCAGGATATTGTGTAGTAG
ATTCATTTCAAGTTTTTTGAAGGCAGAGATTTGGGATTCACGAAAATTAA
CTTATAGAGACAATTTTTTCTTATGGTATTGCATTGGACCAAGCTTTGAG
CCTCTACATACCTTACTCTAGTCGAGAATCTAAAAAGTTTAGTATTACCA
ATAAATATATAGTGCCAATCAATATTGTGGTTACATTTAATTAAAAATGA
TTTGATTAATAGAAAGCACTACTCAAACATACGTTTATGATATACTTCGA
TAGCTTTCCTGTCACCTTCAGCTAGGATAAAAAAAACTAGATATTTTAGA
TTTAATAAAAAAATTACAAAAAAATATTAATTTAATTTAAATAATCAATT
back to top

protein sequence of SMED30029694-orf-1

>SMED30029694-orf-1 ID=SMED30029694-orf-1|Name=SMED30029694-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=663bp
MKSSDDNTPIFGIKCEKKTFEKLKTEIDNLFSELSLNQCYFQNDDMIMNL
YRIKELVKFCISDTEDMESIYFYIEELRKEKDGFKLQAKRLNEENIWLRE
ELKLTQDKLQKKELEFIELDEKNKNLNFLIELQNNQNIENNLNAKNPKST
DLSNVNENKSQIPLNIATSMTNSTMSFNNITSVMENTTGNSNLLRVSFNT
PYSLPVHEVPPRLKTLHQLVIQYATQGRYEIAIPLCKQTLQDLEQSSGHY
HPDVATMLNILALVYRDKGDFQEAVESLTEALEIRKKTLGPDSPKVAATL
NNLSVLYAKQGNHAEAEPLCRDALKIRETILGPHHPDVAKQLNNLALLCH
NQGKFDEVEKYYQRALNIYLTSFPSTDSNVIKTKNSLASSYIKQGKYQDA
ETLLKGILNEAMDKQWNGRERDAKSKPIWVIAEEREKLKNRSMSMEILPS
NSLPEKRHITSNGLNDSNATNDENFMNNPPYGFEMKQKNKEDKLVLLNAL
KLLASLYFRENKETAGNIIEEWLIWAGRALSKYEKDIKWISYESSLTQSD
LYTSSQNDKSQTFWYRTPSPSKRSTSNLSSQRALHKSPFLLLDSSSSTNS
NIDSSSSLLRLPEYSRQSNLPIKSKLPMHLSPYLYKTPITIIESKAKYES
EKGNVYDNIDRC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0005871kinesin complex
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0030426growth cone
GO:0031410cytoplasmic vesicle
GO:0042995cell projection
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR002151Kinesin_light
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 13..33
NoneNo IPR availableCOILSCoilCoilcoord: 74..122
NoneNo IPR availablePFAMPF13424TPR_12coord: 253..328
e-value: 3.7E-20
score: 72.0
NoneNo IPR availablePFAMPF13374TPR_10coord: 339..369
e-value: 5.9E-5
score: 22.8
NoneNo IPR availablePANTHERPTHR45783FAMILY NOT NAMEDcoord: 15..528
IPR002151Kinesin light chainPRINTSPR00381KINESINLIGHTcoord: 372..393
score: 53.64
coord: 86..103
score: 54.44
coord: 337..357
score: 81.9
coord: 293..310
score: 70.0
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 255..288
e-value: 0.0011
score: 28.2
coord: 339..372
e-value: 0.0033
score: 26.7
coord: 381..414
e-value: 410.0
score: 0.8
coord: 297..330
e-value: 0.04
score: 23.1
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 297..330
score: 6.756
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 339..372
score: 7.169
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 381..414
score: 5.399
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 255..288
score: 9.942
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 199..530
e-value: 7.8E-95
score: 319.4
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 250..404
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 255..414
score: 16.166