BHLH domain-containing protein

Overview
NameBHLH domain-containing protein
Smed IDSMED30029687
Length (bp)660
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BHLH domain-containing protein (SMED30029687) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BHLH domain-containing protein (SMED30029687) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029687

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30029687h1SMcG0010773 SmedASXL_006184SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30029687h1SMcG0010773 dd_Smed_v4_6869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029687h1SMcG0010773 dd_Smed_v4_6869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029687h1SMcG0010773 dd_Smed_v4_6869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30029687h1SMcG0010773 DN303577smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30029687h1SMcG0010773 DN303577smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30029687h1SMcG0010773 DN303577smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BHLH domain-containing protein vs. Ensembl Human
Match: PTF1A (pancreas associated transcription factor 1a [Source:HGNC Symbol;Acc:HGNC:23734])

HSP 1 Score: 62.003 bits (149), Expect = 7.492e-11
Identity = 33/72 (45.83%), Postives = 46/72 (63.89%), Query Frame = 3
Query:  201 TKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
             +L + R+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  LSE++
Sbjct:  159 AELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE-----------KRLSKVDTLRLAIGYINFLSELV 219          
BLAST of BHLH domain-containing protein vs. Ensembl Human
Match: FERD3L (Fer3 like bHLH transcription factor [Source:HGNC Symbol;Acc:HGNC:16660])

HSP 1 Score: 57.7658 bits (138), Expect = 5.512e-10
Identity = 31/74 (41.89%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  210 HRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDK 431
            + QR+AANIRER+RM ++N AF+QLR  +P ++ +           K LS+IETL+ AI YI  ++E++   +K
Sbjct:  100 YAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYE-----------KRLSRIETLRLAIVYISFMTELLESCEK 162          
BLAST of BHLH domain-containing protein vs. Ensembl Human
Match: ATOH1 (atonal bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:797])

HSP 1 Score: 55.8398 bits (133), Expect = 9.754e-9
Identity = 38/93 (40.86%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  198 VTKLHRQRR-AANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCK 473
            V  + +QRR AAN RER+RM  +N AF+QLR+ +P ++ D           K LSK ETL+ A  YI  LSE++       Q   P    SCK
Sbjct:  153 VNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNND-----------KKLSKYETLQMAQIYINALSELLQTPSGGEQP--PPPPASCK 232          
BLAST of BHLH domain-containing protein vs. Ensembl Human
Match: ASCL4 (achaete-scute family bHLH transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:24311])

HSP 1 Score: 52.7582 bits (125), Expect = 3.648e-8
Identity = 32/87 (36.78%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  222 RAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISE----IDKSAQLVWPNQQLSC 470
            R  N RERQR+R +N  + +LRDHLP             +  K LSK+ETL+ AI YI  L E++      ++ +A  V P ++  C
Sbjct:   76 RKRNERERQRVRCVNEGYARLRDHLP-----------RELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAGAV-PQRRAEC 150          
BLAST of BHLH domain-containing protein vs. Ensembl Human
Match: NEUROD6 (neuronal differentiation 6 [Source:HGNC Symbol;Acc:HGNC:13804])

HSP 1 Score: 53.5286 bits (127), Expect = 6.879e-8
Identity = 44/110 (40.00%), Postives = 58/110 (52.73%), Query Frame = 3
Query:  171 LPRQTGL--DPVTKLHRQR-----RAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQM 479
            LPR+ GL     TKL  +R     + AN RER RM  +N A + LR  +P YS           +++ LSKIETL+ A +YI  LSEI+  I K   L+   Q L CK +
Sbjct:   73 LPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYS-----------KTQKLSKIETLRLAKNYIWALSEIL-RIGKRPDLLTFVQNL-CKGL 169          
BLAST of BHLH domain-containing protein vs. Ensembl Celegans
Match: hlh-13 (Helix-loop-helix protein 13 [Source:UniProtKB/Swiss-Prot;Acc:Q20561])

HSP 1 Score: 55.8398 bits (133), Expect = 7.343e-10
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLV 446
            +R+ A+IRER+RM SIN+AF +LR+++P +  +           K LSKI+TL  AI+YI  L +++   + S Q +
Sbjct:   42 ERQTASIRERKRMCSINVAFIELRNYIPTFPYE-----------KRLSKIDTLNLAIAYINMLDDVLRTPEDSGQYI 107          
BLAST of BHLH domain-containing protein vs. Ensembl Celegans
Match: lin-32 (pep chromosome:WBcel235:X:2229208:2230122:-1 gene:WBGene00003018.1 transcript:T14F9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-32)

HSP 1 Score: 52.373 bits (124), Expect = 1.031e-8
Identity = 36/84 (42.86%), Postives = 50/84 (59.52%), Query Frame = 3
Query:  195 PVTKLHRQRR-AANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQL 443
            P  +L R RR AAN RER+RM ++N+A+++LR+ LP   ID           K LSK ETL+ A  YI  LS+I+ +  K+  L
Sbjct:   65 PSPQLLRMRRSAANERERRRMNTLNVAYDELREVLP--EIDS---------GKKLSKFETLQMAQKYIECLSQILKQDSKNENL 137          
BLAST of BHLH domain-containing protein vs. Ensembl Celegans
Match: hlh-1 (Myoblast determination protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:P22980])

HSP 1 Score: 47.7506 bits (112), Expect = 2.149e-6
Identity = 40/138 (28.99%), Postives = 60/138 (43.48%), Query Frame = 3
Query:  174 PRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQM-----EMDYLCFDTEGNLVNLHCHLLCSSREDEQLF 572
            PR+T LD       +R+AA +RER+R+R +N AFE ++            N   R     L K+E L++AI YI  L  ++ +  K  +++  NQ L   Q        DY+             H   SS   E +F
Sbjct:  145 PRRTKLD-------RRKAATMRERRRLRKVNEAFEVVKQRT-------CPNPNQR-----LPKVEILRSAIDYINNLERMLQQAGKMTKIMEQNQHLQMTQQINGAPPHDYVT----------SSHFASSSYNPENMF 253          
BLAST of BHLH domain-containing protein vs. Ensembl Celegans
Match: hlh-19 (Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q20941])

HSP 1 Score: 44.2838 bits (103), Expect = 5.635e-6
Identity = 30/74 (40.54%), Postives = 40/74 (54.05%), Query Frame = 3
Query:  219 RRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII-SEIDKSA 437
            R  AN RER R +SI  AF  LR+HLP            +++ +  SK ETLK+A  YI  L  I+  EI+ S+
Sbjct:    3 RERANARERCRQKSIGNAFNMLRNHLP-----------KQLRDRKPSKAETLKSAAQYISHLLRILEKEIENSS 65          
BLAST of BHLH domain-containing protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0081567)

HSP 1 Score: 70.4774 bits (171), Expect = 1.997e-14
Identity = 49/146 (33.56%), Postives = 74/146 (50.68%), Query Frame = 3
Query:  198 VTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSIKAPIWRPKDIFKPVIIP 635
             +++ +QR+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TLK AISYI  LSE++ +     +     Q+   K+     +  D  G +     H L   R+ ++   S + A  W P+D   P   P
Sbjct:   76 ASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYE-----------KRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGV----AHSLSWYRKGDRYPGSKLYARTWTPEDPRGPHSQP 206          
BLAST of BHLH domain-containing protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0334670)

HSP 1 Score: 70.0922 bits (170), Expect = 2.985e-14
Identity = 49/146 (33.56%), Postives = 74/146 (50.68%), Query Frame = 3
Query:  198 VTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSIKAPIWRPKDIFKPVIIP 635
             +++ +QR+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TLK AISYI  LSE++ +     +     Q+   K+     +  D  G +     H L   R+ ++   S + A  W P+D   P   P
Sbjct:   81 ASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYE-----------KRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGV----AHSLSWYRKGDRYPGSKLYARTWTPEDPRGPHSQP 211          
BLAST of BHLH domain-containing protein vs. Ensembl Fly
Match: cato (gene:FBgn0024249 transcript:FBtr0087183)

HSP 1 Score: 68.1662 bits (165), Expect = 5.754e-14
Identity = 40/99 (40.40%), Postives = 59/99 (59.60%), Query Frame = 3
Query:  165 KKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIIS----EIDKSAQLVW 449
            K  P QT L P  +  R+R+AAN RER+RM  +N AFE+LR+ +P  SID+            LSK ETL+ A SYI+ L ++++    E+D +A  ++
Sbjct:   88 KSSPEQTNLSPTVQ-KRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQ-----------KLSKFETLQMAQSYILALCDLLNNGDVEVDAAAYTIF 174          
BLAST of BHLH domain-containing protein vs. Ensembl Fly
Match: Fer3 (gene:FBgn0037937 transcript:FBtr0082435)

HSP 1 Score: 60.077 bits (144), Expect = 6.333e-11
Identity = 31/68 (45.59%), Postives = 47/68 (69.12%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIIS 419
            QRRAANIRER+RM ++N AF++LR  +P ++ +           K LS+IETL+ AI+YI  ++E++S
Sbjct:   87 QRRAANIRERRRMFNLNEAFDKLRRKVPTFAYE-----------KRLSRIETLRLAITYIGFMAELLS 143          
BLAST of BHLH domain-containing protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0344012)

HSP 1 Score: 55.4546 bits (132), Expect = 5.609e-9
Identity = 32/79 (40.51%), Postives = 48/79 (60.76%), Query Frame = 3
Query:  183 TGLDPVTKLHRQRRAANIRERQRMRS-INLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
             G    +    QR+AAN+RER+R++S IN AF++LR H+P +  +           K LSKI+TL+ AI+YI  L E++
Sbjct:  137 VGAATASSYKMQRQAANVRERKRIQSSINSAFDELRVHVPTFPYE-----------KRLSKIDTLRLAIAYISLLREVL 204          
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Match: atoh7 (atonal bHLH transcription factor 7 [Source:NCBI gene;Acc:58216])

HSP 1 Score: 65.855 bits (159), Expect = 2.047e-13
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSA--QLVWPNQQLSCKQMEMDYLCFDT 506
            R+R AAN RER+RM+ +N AF++LR  +P +            Q K LSK ETL+ A+SYIM L+ I+S+  +    Q  W N Q    Q E  ++ +D+
Sbjct:   28 RRRMAANARERKRMQGLNTAFDRLRKVVPQWG-----------QDKKLSKYETLQMALSYIMALNRILSDAGRHVDPQKDWLNLQFDGLQTEGYFMHYDS 116          
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 62.7734 bits (151), Expect = 5.276e-12
Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            QR AANIRER+RM SIN AFE+LR H+P +  +           K LSKI+TL+ AI+YI  L EI+
Sbjct:   66 QRHAANIRERKRMLSINSAFEELRCHVPTFPYE-----------KRLSKIDTLRLAIAYIALLREIL 121          
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:368662])

HSP 1 Score: 62.003 bits (149), Expect = 3.128e-11
Identity = 52/161 (32.30%), Postives = 79/161 (49.07%), Query Frame = 3
Query:  150 PHLLPKKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEI-----DKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSI--KAPIWRPKD 611
            PH     L R+  +    ++ + R+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L+E++          S  L  P + + C +        D +  L  L  H L S  +++QL   +I   A +W P+D
Sbjct:   94 PHRDGGLLKRRRRMRSEVEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE-----------KRLSKVDTLRLAIGYINFLAELVQSDMPIRNPHSDALNQPKKVIICHRGTRSPSPNDPDYGLPPLAGHSL-SWTDEKQLKDQNIIRTAKVWTPED 242          
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 55.8398 bits (133), Expect = 3.091e-10
Identity = 30/67 (44.78%), Postives = 45/67 (67.16%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            QR+AANIRER+RM S+N AF++LR  +P ++ +           K LS+IETL+ AI YI  +++I+
Sbjct:   25 QRQAANIRERKRMFSLNEAFDRLRRRVPTFAYE-----------KRLSRIETLRLAIVYIAFMTDIL 80          
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Match: tcf15 (transcription factor 15 [Source:ZFIN;Acc:ZDB-GENE-980605-20])

HSP 1 Score: 54.6842 bits (130), Expect = 5.511e-9
Identity = 32/84 (38.10%), Postives = 48/84 (57.14%), Query Frame = 3
Query:  165 KKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            +++ R+T +  V  + +QR AAN RER R +S+N AF  LR  +P   +D           + LSKIETL+ A SYI  L+ ++
Sbjct:   49 RRMSRKTTVGSVV-IVKQRNAANARERDRTQSVNTAFTALRTLIPTEPVD-----------RKLSKIETLRLASSYISHLANVL 120          
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000031930.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:55646956:55647657:1 gene:ENSXETG00000008961.1 transcript:ENSXETT00000031930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 4.469e-12
Identity = 37/72 (51.39%), Postives = 48/72 (66.67%), Query Frame = 3
Query:  204 KLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIIS 419
            K+HRQ  AANIRER+RM SIN AFE+LR  +P +  +           K LSKI+TL+ AI+YI  LS+I+S
Sbjct:   82 KVHRQ--AANIRERRRMLSINSAFEELRGRVPTFPYE-----------KRLSKIDTLRLAIAYIALLSDILS 140          
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Match: ppil6 (peptidylprolyl isomerase like 6 [Source:Xenbase;Acc:XB-GENE-979458])

HSP 1 Score: 59.6918 bits (143), Expect = 5.866e-11
Identity = 32/73 (43.84%), Postives = 46/73 (63.01%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDK 431
            ++R AAN RER+RM+ +N AF+ LR  +P +  D           K LSK ETL+ A+SYIM L+ I+SE ++
Sbjct:   34 KRRMAANARERRRMQGLNTAFDSLRKVVPQWGED-----------KKLSKYETLQMALSYIMALNRILSEAER 95          
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Match: PTF1A (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:100494161])

HSP 1 Score: 60.8474 bits (146), Expect = 1.744e-10
Identity = 48/147 (32.65%), Postives = 73/147 (49.66%), Query Frame = 3
Query:  201 TKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII--------SEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSI--KAPIWRPKD 611
             ++ + R+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  LSE++           D   Q   P + + C +        D +  L  L  H L S  +++QL   ++   A +W P+D
Sbjct:  165 AEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE-----------KRLSKVDTLRLAIGYINFLSELVQSDLPLRNPNTDSGHQ---PKKVIICHRGTRSPSPSDPDYGLPPLAGHSL-SWTDEKQLRDQNVVRTAKVWTPED 296          
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Match: ferd3l (Fer3-like bHLH transcription factor [Source:NCBI gene;Acc:100124312])

HSP 1 Score: 53.5286 bits (127), Expect = 9.859e-9
Identity = 29/69 (42.03%), Postives = 45/69 (65.22%), Query Frame = 3
Query:  210 HRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            + QR+AANIRER+RM ++N AF+ LR  +P ++ +           K LS+IETL+ AI YI  ++E++
Sbjct:   64 YAQRQAANIRERKRMFNLNEAFDLLRKKVPTFAYE-----------KRLSRIETLRLAIVYISFMTEML 121          
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:549260])

HSP 1 Score: 53.1434 bits (126), Expect = 2.152e-8
Identity = 32/74 (43.24%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  195 PVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            PV K   QR+AAN RER R +S+N AF  LR  +P   +D           + LSKIETL+ A SYI  L+ ++
Sbjct:   59 PVVK---QRQAANARERDRTQSVNTAFTALRTLIPTEPVD-----------RKLSKIETLRLASSYISHLANVL 118          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Ptf1a (pancreas specific transcription factor, 1a [Source:MGI Symbol;Acc:MGI:1328312])

HSP 1 Score: 62.003 bits (149), Expect = 5.159e-11
Identity = 33/72 (45.83%), Postives = 46/72 (63.89%), Query Frame = 3
Query:  201 TKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
             +L + R+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  LSE++
Sbjct:  156 AELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE-----------KRLSKVDTLRLAIGYINFLSELV 216          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Ferd3l (Fer3 like bHLH transcription factor [Source:MGI Symbol;Acc:MGI:2150010])

HSP 1 Score: 56.6102 bits (135), Expect = 1.039e-9
Identity = 30/69 (43.48%), Postives = 46/69 (66.67%), Query Frame = 3
Query:  210 HRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            + QR+AANIRER+RM ++N AF+QLR  +P ++ +           K LS+IETL+ AI YI  ++E++
Sbjct:  102 YAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYE-----------KRLSRIETLRLAIVYISFMTELL 159          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Tcf15 (transcription factor 15 [Source:MGI Symbol;Acc:MGI:104664])

HSP 1 Score: 56.9954 bits (136), Expect = 1.158e-9
Identity = 33/77 (42.86%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  186 GLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            G  PV  + RQR+AAN RER R +S+N AF  LR  +P   +D           + LSKIETL+ A SYI  L+ ++
Sbjct:   62 GAGPVVVV-RQRQAANARERDRTQSVNTAFTALRTLIPTEPVD-----------RKLSKIETLRLASSYIAHLANVL 126          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Atoh1 (atonal bHLH transcription factor 1 [Source:MGI Symbol;Acc:MGI:104654])

HSP 1 Score: 56.225 bits (134), Expect = 5.834e-9
Identity = 38/93 (40.86%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  198 VTKLHRQRR-AANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCK 473
            V  + +QRR AAN RER+RM  +N AF+QLR+ +P ++ D           K LSK ETL+ A  YI  LSE++   +   Q   P    SCK
Sbjct:  150 VNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNND-----------KKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPT--ASCK 229          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Neurod2 (neurogenic differentiation 2 [Source:MGI Symbol;Acc:MGI:107755])

HSP 1 Score: 52.7582 bits (125), Expect = 8.171e-8
Identity = 32/72 (44.44%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  201 TKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            +KL RQ+  AN RER RM  +N A + LR  +P YS           +++ LSKIETL+ A +YI  LSEI+
Sbjct:  120 SKLRRQK--ANARERNRMHDLNAALDNLRKVVPCYS-----------KTQKLSKIETLRLAKNYIWALSEIL 178          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8AW52|ATOH7_DANRE (Protein atonal homolog 7 OS=Danio rerio OX=7955 GN=atoh7 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.546e-12
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSA--QLVWPNQQLSCKQMEMDYLCFDT 506
            R+R AAN RER+RM+ +N AF++LR  +P +            Q K LSK ETL+ A+SYIM L+ I+S+  +    Q  W N Q    Q E  ++ +D+
Sbjct:   28 RRRMAANARERKRMQGLNTAFDRLRKVVPQWG-----------QDKKLSKYETLQMALSYIMALNRILSDAGRHVDPQKDWLNLQFDGLQTEGYFMHYDS 116          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|O57598|ATOH7_CHICK (Protein atonal homolog 7 OS=Gallus gallus OX=9031 GN=ATOH7 PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 5.260e-11
Identity = 37/107 (34.58%), Postives = 55/107 (51.40%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHC 533
            ++R AAN RER+RM+ +N AF++LR  +P +            Q K LSK ETL+ A+SYIM L+ I++E ++                      + TE   +NLHC
Sbjct:   39 KRRLAANARERRRMQGLNTAFDRLRKVVPQWG-----------QDKKLSKYETLQMALSYIMALTRILAEAER----------------------YSTEREWINLHC 112          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|O13125|ATO7A_XENLA (Protein atonal homolog 7-A OS=Xenopus laevis OX=8355 GN=atoh7-a PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.900e-10
Identity = 36/86 (41.86%), Postives = 51/86 (59.30%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQL---VWPNQQ 461
            ++R AAN RER+RM+ +N AF+ LR  +P +  D           K LSK ETL+ A+SYIM LS I+SE ++ ++     W N Q
Sbjct:   33 KRRLAANARERRRMQGLNTAFDSLRKVVPQWGED-----------KQLSKYETLQMALSYIMALSRILSEAERYSRTDPEEWTNIQ 107          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7ZSX3|PTF1A_DANRE (Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.361e-10
Identity = 52/161 (32.30%), Postives = 79/161 (49.07%), Query Frame = 3
Query:  150 PHLLPKKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEI-----DKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSI--KAPIWRPKD 611
            PH     L R+  +    ++ + R+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L+E++          S  L  P + + C +        D +  L  L  H L S  +++QL   +I   A +W P+D
Sbjct:   94 PHRDGGLLKRRRRMRSEVEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE-----------KRLSKVDTLRLAIGYINFLAELVQSDMPIRNPHSDALNQPKKVIICHRGTRSPSPNDPDYGLPPLAGHSL-SWTDEKQLKDQNIIRTAKVWTPED 242          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|O13126|ATO7B_XENLA (Protein atonal homolog 7-B OS=Xenopus laevis OX=8355 GN=atoh7-b PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.692e-10
Identity = 32/73 (43.84%), Postives = 46/73 (63.01%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDK 431
            ++R AAN RER+RM+ +N AF+ LR  +P +  D           K LSK ETL+ A+SYIM LS I++E ++
Sbjct:   33 KRRLAANARERRRMQGLNTAFDSLRKVVPQWGED-----------KKLSKYETLQMALSYIMALSRILTEAER 94          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A2B4S7X4 (Pancreas transcription factor 1 subunit alpha OS=Stylophora pistillata OX=50429 GN=ptf1a PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.001e-13
Identity = 52/134 (38.81%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDT-EGNLVNLHCHLLCSSREDEQLFHSSI-KAPIWRPKD 611
            QR AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L+E+IS     +Q + P      +++ + +  F T E  L  L  H L  +   +    SSI KA IW P+D
Sbjct:   45 QRHAANLRERKRMQSINEAFEGLRHHIPTLPYE-----------KRLSKVDTLRLAIGYIGFLTEMISSDMSHSQALQPTSSEQPRKVMICHRGFGTQEYGLPPLTGHSLSWTDSKKPKLSSSIMKAKIWTPED 167          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A3M6UMA4 (BHLH domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00018593 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.348e-13
Identity = 52/134 (38.81%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDT-EGNLVNLHCHLLCSSREDEQLFHSSI-KAPIWRPKD 611
            QR AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L+E+IS     +Q + P      +++ + +  F T E  L  L  H L  +   +    SSI KA IW P+D
Sbjct:   45 QRHAANLRERKRMQSINEAFEGLRHHIPTLPYE-----------KRLSKVDTLRLAIGYIGFLTEMISSDMSHSQALQPTSSEQPRKVMICHRGFGTQEYGLPPLTGHSLSWTDSKKPKLSSSIMKAKIWTPED 167          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: N6ULR3 (BHLH domain-containing protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=109546681 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.256e-12
Identity = 52/157 (33.12%), Postives = 72/157 (45.86%), Query Frame = 3
Query:  180 QTGLDPVTKLHRQRR-------------AANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSIKAPIWRPKD 611
              G +P  + HR RR             AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TLK AI YI  LSE++     S    +   + S ++ E   +     G L   H   L  SR  E   +  + A +W P+D
Sbjct:   65 NVGTNPKERSHRHRRKNKCPQQQIQQRQAANLRERKRMQSINDAFEGLRAHIPTLPYE-----------KRLSKVDTLKLAIGYINFLSELVKADRNSNTEYFNGNRRSSQKDEPKKIIVRGAGGLYTAHS--LSWSRNKEPNANGMMHAKVWVPED 208          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A3P8Z0U8 (Atonal bHLH transcription factor 7 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.532e-12
Identity = 41/102 (40.20%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDK--SAQLVWPNQQLSCKQMEMDYLCFDTEG 512
            R+R AAN RER+RM+ +N AF++LR  +P +            Q K LSK ETL+ A+SYIM L+ I+++  +  +    W + Q  C Q E +Y CF T G
Sbjct:   24 RRRMAANARERKRMQGLNTAFDRLRKVVPQWG-----------QDKQLSKYETLQMALSYIMALNRILTDAQRCNAPSRQWLDLQFDCAQPE-NYQCFSTTG 113          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: B7PVR4 (N-twist protein, putative (Fragment) OS=Ixodes scapularis OX=6945 GN=8032068 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.669e-11
Identity = 40/85 (47.06%), Postives = 50/85 (58.82%), Query Frame = 3
Query:  174 PRQTGLDPVTKLHR----QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            P Q G  PV         QRRAANIRER+RM SIN AFE+LR H+P +  +           K LSKI+TL+ AI+YI  L E++
Sbjct:    9 PLQQGCVPVVPFAGPYKVQRRAANIRERKRMMSINTAFEELRCHVPTFPFE-----------KRLSKIDTLRLAIAYIALLRELL 82          
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-34f9.3 (neurogenic differentiation factor 1-like [Source:NCBI gene;Acc:107197807])

HSP 1 Score: 63.929 bits (154), Expect = 3.259e-12
Identity = 36/67 (53.73%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            QR AANIRER+RM SIN AFEQLR H+P +  +           K LSKI+TL+ AI+YI  L EI+
Sbjct:  121 QRHAANIRERKRMLSINSAFEQLRCHVPTFPYE-----------KRLSKIDTLRLAIAYIALLREIL 176          
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:103046795])

HSP 1 Score: 60.8474 bits (146), Expect = 5.360e-11
Identity = 48/138 (34.78%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  219 RRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISE-----IDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSI--KAPIWRPKD 611
            R+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L+E++          S  L  P + + C ++       D +  L  L  H L S  +++QL   +I   A +W P+D
Sbjct:   94 RQAANVRERRRMQSINDAFEGLRSHIPTLPYE-----------KRLSKVDTLRLAIGYINFLAELVQSDAPIRSSSSEALNPPKKIIICHRVTRPPSPNDPDYGLPPLAGHSL-SWTDEKQLKDQNIIRTAKVWTPED 219          
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 55.4546 bits (132), Expect = 2.515e-10
Identity = 30/66 (45.45%), Postives = 44/66 (66.67%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEI 413
            QR+AANIRER+RM S+N AF++LR  +P ++ +           K LS+IETL+ AI YI  ++E+
Sbjct:   16 QRQAANIRERKRMFSLNEAFDELRKKVPTFAYE-----------KRLSRIETLRLAIVYISFMTEL 70          
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Match: scxa (scleraxis bHLH transcription factor a [Source:ZFIN;Acc:ZDB-GENE-060503-414])

HSP 1 Score: 55.8398 bits (133), Expect = 1.934e-9
Identity = 34/82 (41.46%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  171 LPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            LP  T   P+    RQR AAN RER R  S+N AF  LR  +P    D           + LSKIETL+ A SYI  L  ++
Sbjct:   64 LPPDTRPGPMLGEGRQRNAANARERDRTNSVNTAFTALRTLIPTEPAD-----------RKLSKIETLRLASSYISHLGNVL 134          
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Match: scxb (basic helix-loop-helix transcription factor scleraxis-like [Source:NCBI gene;Acc:103029811])

HSP 1 Score: 53.9138 bits (128), Expect = 1.030e-8
Identity = 32/74 (43.24%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  195 PVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            P+T++ RQR AAN RER R  S+N+AF  LR  +P    D           + LSKIETL+ A SYI  L  ++
Sbjct:   73 PITEV-RQRNAANARERDRTNSVNVAFTALRTLIPTEPAD-----------RKLSKIETLRLASSYISHLENVL 134          
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 60.4622 bits (145), Expect = 2.495e-12
Identity = 36/77 (46.75%), Postives = 49/77 (63.64%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEI-ISEIDKSAQL 443
            QR AAN+RER+RM SIN AFE+LR H+P +  +           K LSKI+TL+ AI+YI  L +I +S+ D  A +
Sbjct:   34 QRTAANVRERRRMLSINSAFEELRCHVPTFPYE-----------KRLSKIDTLRLAIAYIALLRDILLSDTDPKAYV 99          
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004072.1 (pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 gene:ENSPMAG00000003727.1 transcript:ENSPMAT00000004072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.431e-10
Identity = 31/66 (46.97%), Postives = 41/66 (62.12%), Query Frame = 3
Query:  219 RRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            R+AAN RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L E++
Sbjct:  133 RQAANQRERRRMQSINAAFEGLRAHIPTLPYE-----------KRLSKVDTLRLAIGYISFLGELV 187          
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:558148])

HSP 1 Score: 51.2174 bits (121), Expect = 1.670e-8
Identity = 34/89 (38.20%), Postives = 46/89 (51.69%), Query Frame = 3
Query:  210 HRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQ--------LVWP 452
            H QR AAN RER RMR ++ AF +L+  LP    D             LSK++TL+ A SYI  L +I++  D++ Q        L WP
Sbjct:   95 HGQRNAANARERARMRVLSKAFSRLKTTLPWVPAD-----------TKLSKLDTLRLASSYIGHLRQILA--DETYQNGFVHPVNLTWP 170          
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Match: ASCL4 (achaete-scute family bHLH transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:24311])

HSP 1 Score: 49.2914 bits (116), Expect = 4.420e-8
Identity = 28/66 (42.42%), Postives = 37/66 (56.06%), Query Frame = 3
Query:  222 RAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIIS 419
            R  N RERQR++ +N  + +LRDHLP    DE          K LSK+ETL+ AI YI  L  ++ 
Sbjct:   58 RKRNERERQRVKCVNEGYARLRDHLP----DE-------FSDKRLSKVETLRAAIRYIKHLQAMLG 112          
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Match: neurod1 (neuronal differentiation 1 [Source:NCBI gene;Acc:30169])

HSP 1 Score: 50.447 bits (119), Expect = 6.831e-8
Identity = 29/71 (40.85%), Postives = 40/71 (56.34%), Query Frame = 3
Query:  204 KLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            +   +R  AN RER RM  +N A + LR  +P YS           +++ LSKIETL+ A +YI  LSEI+
Sbjct:   20 RFKMRRVKANARERNRMHGLNAALDNLRKVVPCYS-----------KTQKLSKIETLRLAKNYIWALSEIL 79          
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Match: EDO43849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI0])

HSP 1 Score: 59.6918 bits (143), Expect = 2.179e-12
Identity = 33/67 (49.25%), Postives = 43/67 (64.18%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            QR AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L+E+I
Sbjct:    3 QRHAANLRERKRMQSINEAFEGLRKHIPTLPYE-----------KRLSKVDTLRLAIGYIGFLTEMI 58          
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Match: EDO46240 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW6])

HSP 1 Score: 56.9954 bits (136), Expect = 2.120e-10
Identity = 39/99 (39.39%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  198 VTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYL 494
            +T L +QR+ AN RER RMRSI+ A   LR HLP   +          + K LSKI+TL+ AI YI  L EI+ + D    +   N QL  + ++ + L
Sbjct:   32 LTGLSKQRQTANARERNRMRSISDALLHLRYHLPQTVV---------AKDKKLSKIQTLRLAIRYISDLFEIL-QSDDGQGINISNGQLCAEYLDGNDL 120          
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Match: EDO42907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S063])

HSP 1 Score: 50.8322 bits (120), Expect = 4.013e-9
Identity = 27/71 (38.03%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  207 LHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIIS 419
            + +QRR AN RER R++ +N AFE LR+ +PL +++           K  SKI+T++ A  YI  L++++S
Sbjct:    1 VSKQRRTANERERNRVQQVNAAFETLRNKIPLRALE-----------KKPSKIDTIRLATRYIQDLTQLLS 60          
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Match: EDO48977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI67])

HSP 1 Score: 49.6766 bits (117), Expect = 1.207e-8
Identity = 27/70 (38.57%), Postives = 42/70 (60.00%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISE 422
            ++R   N RER+RMR +N AF+ LRD LP Y           I   +++KI TL+ AI+YI  L++++ +
Sbjct:    2 KKRLLVNARERERMRVLNNAFQSLRDALPCY-----------IADGHMAKITTLRLAINYIKALTDVLRD 60          
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Match: EDO42924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZZ0])

HSP 1 Score: 49.2914 bits (116), Expect = 1.432e-8
Identity = 31/68 (45.59%), Postives = 38/68 (55.88%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            +QR+AAN RER R  S+N AF  LR  +P    D           + LSKIETL+ A SYI  LS I+
Sbjct:    1 KQRQAANARERNRTHSVNAAFNALRLLIPTEPSD-----------RKLSKIETLRLASSYIAHLSTIL 57          
BLAST of BHLH domain-containing protein vs. Ensembl Medaka
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:101160350])

HSP 1 Score: 64.3142 bits (155), Expect = 4.952e-12
Identity = 51/147 (34.69%), Postives = 74/147 (50.34%), Query Frame = 3
Query:  201 TKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII--------SEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSI--KAPIWRPKD 611
             ++ + R+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L+E++        S  D  AQ   P + + C +        D +  L  L  H L  S E +QL   +I   A +W P+D
Sbjct:  114 VEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE-----------KRLSKVDTLRLAIGYINFLAELVQSDLPIRNSNSDAHAQ---PKKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWSDE-KQLREQNIIRTAKVWTPED 245          
BLAST of BHLH domain-containing protein vs. Ensembl Medaka
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 62.3882 bits (150), Expect = 9.994e-12
Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            QR AANIRER+RM SIN AFE+LR H+P +  +           K LSKI+TL+ AI+YI  L EI+
Sbjct:  125 QRHAANIRERKRMLSINSAFEELRCHVPTFPYE-----------KRLSKIDTLRLAIAYIALLREIL 180          
BLAST of BHLH domain-containing protein vs. Ensembl Medaka
Match: atoh7 (atonal bHLH transcription factor 7 [Source:NCBI gene;Acc:101155052])

HSP 1 Score: 59.6918 bits (143), Expect = 3.065e-11
Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  213 RQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSA 437
            R+R AAN RER+RM+ +N AF++LR  +P +            Q K LSK ETL+ A+SYIM LS I+++  + A
Sbjct:   31 RRRMAANARERKRMQGLNTAFDRLRKVVPQWG-----------QDKKLSKYETLQMALSYIMALSRILTDPRRHA 94          
BLAST of BHLH domain-containing protein vs. Ensembl Medaka
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:101172734])

HSP 1 Score: 53.9138 bits (128), Expect = 8.419e-9
Identity = 44/135 (32.59%), Postives = 63/135 (46.67%), Query Frame = 3
Query:   36 PQIKHF*NSRFTILVNMIYENNSWFNFPTQISY-SDYQIPHLLPKKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSA 437
            P   H   S FT+  +   EN S  +  ++ SY    +      +KL   T +     + +QR AAN RER R +S+N AF  LR  +P   +D           + LSKIETL+ A SYI  L+ ++   D  A
Sbjct:    8 PMATHLIYSDFTV-TSEDDENRSESDGSSEQSYCGSSEKRRRASRKLEGDTAV-----VIKQRSAANARERGRTQSVNTAFTALRTLIPTEPVD-----------RKLSKIETLRLASSYISHLANVLLTGDGCA 125          
BLAST of BHLH domain-containing protein vs. Ensembl Medaka
Match: atoh1a (atonal bHLH transcription factor 1 [Source:NCBI gene;Acc:101170025])

HSP 1 Score: 54.299 bits (129), Expect = 1.664e-8
Identity = 31/75 (41.33%), Postives = 44/75 (58.67%), Query Frame = 3
Query:  195 PVTKLHRQRR-AANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII 416
            P+  + +QRR AAN RER+RM  +N AF++LR  +P +  D           K LSK ETL+ A  YI  L+E++
Sbjct:  145 PINGIQKQRRVAANARERRRMHGLNHAFDELRSVIPAFDND-----------KKLSKYETLQMAQIYINALAELL 208          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000040081.1 (SMESG000040081.1)

HSP 1 Score: 394.045 bits (1011), Expect = 8.457e-142
Identity = 191/191 (100.00%), Postives = 191/191 (100.00%), Query Frame = 3
Query:   84 MIYENNSWFNFPTQISYSDYQIPHLLPKKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSIKAPIWRPKDIFKPVIIPDISLLFE 656
            MIYENNSWFNFPTQISYSDYQIPHLLPKKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSIKAPIWRPKDIFKPVIIPDISLLFE
Sbjct:    1 MIYENNSWFNFPTQISYSDYQIPHLLPKKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSIKAPIWRPKDIFKPVIIPDISLLFE 191          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000044960.1 (SMESG000044960.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.172e-12
Identity = 47/130 (36.15%), Postives = 69/130 (53.08%), Query Frame = 3
Query:  159 LPKKLPRQTGLDPVT------KLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLH 530
            L K  PR+      +      KL RQR+AAN+RER+RM+SIN AFE+LR H+P    +           K LSK++TL+ AI YI  L  I+ ++D+  + ++    ++  Q       F TE NL + H
Sbjct:   22 LKKNFPRKNSDSRFSRSKCPEKLARQRQAANMRERKRMQSINDAFEKLRVHIPTMPYE-----------KRLSKVDTLRMAIGYINFLGGIM-QVDQGEE-IYEKTFIANDQ-------FQTESNLKSSH 131          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000000956.1 (SMESG000000956.1)

HSP 1 Score: 63.1586 bits (152), Expect = 6.667e-12
Identity = 49/148 (33.11%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  216 QRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIISE-------IDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCS-------SREDEQLFHSSIKAPIWRPKDIF 617
            +R+AANIRER+RM+SIN AFE LR H+P    +           K LSK++TL+ AISYI  L E+I         ID S   +   +   C  +E   +      N  +    ++C         RE   +F  + KA IW P+ + 
Sbjct:  103 ERQAANIRERRRMQSINEAFEGLRCHIPTMPYE-----------KRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAI---RSAEC-SIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVL 235          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000079648.1 (SMESG000079648.1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.220e-11
Identity = 47/147 (31.97%), Postives = 77/147 (52.38%), Query Frame = 3
Query:  204 KLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEII---SEID---------KSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHCHLLCSSREDEQLFHSSIKAPIWRPK 608
            KL  QR+AAN+RER+RM+SIN AFE LR H+P    +           K LSK++TL+ AI YI  L +++   S ID          S +++  ++ ++ ++ + D         +V  H     + RE +   ++++ A IWRP+
Sbjct:   99 KLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYE-----------KRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEIL-----IVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 229          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 60.077 bits (144), Expect = 8.135e-11
Identity = 34/86 (39.53%), Postives = 52/86 (60.47%), Query Frame = 3
Query:  162 PKKLPRQTGLDPVTKLHRQRRAANIRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTAISYIMKLSEIIS 419
            P   P++  +  V     QRRAANIRER+RM S+N AF+ LR  +P ++ +           K LS+IETL+ AI+YI  ++E+++
Sbjct:  131 PSNKPKRKRISTVA----QRRAANIRERRRMYSLNEAFDSLRKRVPTFAYE-----------KRLSRIETLRLAITYICFMTELLN 201          
The following BLAST results are available for this feature:
BLAST of BHLH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTF1A7.492e-1145.83pancreas associated transcription factor 1a [Sourc... [more]
FERD3L5.512e-1041.89Fer3 like bHLH transcription factor [Source:HGNC S... [more]
ATOH19.754e-940.86atonal bHLH transcription factor 1 [Source:HGNC Sy... [more]
ASCL43.648e-836.78achaete-scute family bHLH transcription factor 4 [... [more]
NEUROD66.879e-840.00neuronal differentiation 6 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hlh-137.343e-1038.96Helix-loop-helix protein 13 [Source:UniProtKB/Swi... [more]
lin-321.031e-842.86pep chromosome:WBcel235:X:2229208:2230122:-1 gene:... [more]
hlh-12.149e-628.99Myoblast determination protein 1 homolog [Source:... [more]
hlh-195.635e-640.54Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q20... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fer11.997e-1433.56gene:FBgn0037475 transcript:FBtr0081567[more]
Fer12.985e-1433.56gene:FBgn0037475 transcript:FBtr0334670[more]
cato5.754e-1440.40gene:FBgn0024249 transcript:FBtr0087183[more]
Fer36.333e-1145.59gene:FBgn0037937 transcript:FBtr0082435[more]
Fer25.609e-940.51gene:FBgn0038402 transcript:FBtr0344012[more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atoh72.047e-1339.00atonal bHLH transcription factor 7 [Source:NCBI ge... [more]
si:dkey-34f9.35.276e-1252.24si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
ptf1a3.128e-1132.30pancreas associated transcription factor 1a [Sourc... [more]
ferd3l3.091e-1044.78Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
tcf155.511e-938.10transcription factor 15 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031930.14.469e-1251.39pep primary_assembly:Xenopus_tropicalis_v9.1:9:556... [more]
ppil65.866e-1143.84peptidylprolyl isomerase like 6 [Source:Xenbase;Ac... [more]
PTF1A1.744e-1032.65pancreas associated transcription factor 1a [Sourc... [more]
ferd3l9.859e-942.03Fer3-like bHLH transcription factor [Source:NCBI g... [more]
tcf152.152e-843.24transcription factor 15 [Source:NCBI gene;Acc:5492... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptf1a5.159e-1145.83pancreas specific transcription factor, 1a [Source... [more]
Ferd3l1.039e-943.48Fer3 like bHLH transcription factor [Source:MGI Sy... [more]
Tcf151.158e-942.86transcription factor 15 [Source:MGI Symbol;Acc:MGI... [more]
Atoh15.834e-940.86atonal bHLH transcription factor 1 [Source:MGI Sym... [more]
Neurod28.171e-844.44neurogenic differentiation 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AW52|ATOH7_DANRE1.546e-1239.00Protein atonal homolog 7 OS=Danio rerio OX=7955 GN... [more]
sp|O57598|ATOH7_CHICK5.260e-1134.58Protein atonal homolog 7 OS=Gallus gallus OX=9031 ... [more]
sp|O13125|ATO7A_XENLA1.900e-1041.86Protein atonal homolog 7-A OS=Xenopus laevis OX=83... [more]
sp|Q7ZSX3|PTF1A_DANRE2.361e-1032.30Pancreas transcription factor 1 subunit alpha OS=D... [more]
sp|O13126|ATO7B_XENLA2.692e-1043.84Protein atonal homolog 7-B OS=Xenopus laevis OX=83... [more]
back to top
BLAST of BHLH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4S7X44.001e-1338.81Pancreas transcription factor 1 subunit alpha OS=S... [more]
A0A3M6UMA44.348e-1338.81BHLH domain-containing protein OS=Pocillopora dami... [more]
N6ULR36.256e-1233.12BHLH domain-containing protein (Fragment) OS=Dendr... [more]
A0A3P8Z0U86.532e-1240.20Atonal bHLH transcription factor 7 OS=Esox lucius ... [more]
B7PVR41.669e-1147.06N-twist protein, putative (Fragment) OS=Ixodes sca... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-34f9.33.259e-1253.73neurogenic differentiation factor 1-like [Source:N... [more]
ptf1a5.360e-1134.78pancreas associated transcription factor 1a [Sourc... [more]
ferd3l2.515e-1045.45Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
scxa1.934e-941.46scleraxis bHLH transcription factor a [Source:ZFIN... [more]
scxb1.030e-843.24basic helix-loop-helix transcription factor sclera... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-34f9.32.495e-1246.75si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
ENSPMAT00000004072.11.431e-1046.97pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 ge... [more]
tcf211.670e-838.20transcription factor 21 [Source:NCBI gene;Acc:5581... [more]
ASCL44.420e-842.42achaete-scute family bHLH transcription factor 4 [... [more]
neurod16.831e-840.85neuronal differentiation 1 [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438492.179e-1249.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462402.120e-1039.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429074.013e-938.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489771.207e-838.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429241.432e-845.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptf1a4.952e-1234.69pancreas associated transcription factor 1a [Sourc... [more]
si:dkey-34f9.39.994e-1252.24si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
atoh73.065e-1144.00atonal bHLH transcription factor 7 [Source:NCBI ge... [more]
tcf158.419e-932.59transcription factor 15 [Source:NCBI gene;Acc:1011... [more]
atoh1a1.664e-841.33atonal bHLH transcription factor 1 [Source:NCBI ge... [more]
back to top
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040081.18.457e-142100.00SMESG000040081.1[more]
SMESG000044960.11.172e-1236.15SMESG000044960.1[more]
SMESG000000956.16.667e-1233.11SMESG000000956.1[more]
SMESG000079648.13.220e-1131.97SMESG000079648.1[more]
SMESG000029000.18.135e-1139.53SMESG000029000.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029687 ID=SMED30029687|Name=BHLH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=660bp
CAGATATGTTCTTTAAAATCGATAAATATTAGCACCCGCAGATAAAACAT
TTTTAGAACTCGCGTTTTACAATTTTAGTGAACATGATCTATGAAAACAA
TTCTTGGTTCAATTTTCCAACACAAATATCTTATTCAGATTATCAAATTC
CCCATTTGTTGCCGAAAAAATTACCAAGACAAACTGGATTGGATCCGGTC
ACGAAACTTCATCGGCAAAGAAGAGCAGCCAATATTCGAGAGAGACAACG
AATGAGATCTATCAATTTGGCCTTTGAACAGTTGCGAGACCATTTACCTC
TCTATTCAATTGACGAGTCTCAAAATGACGAAAATCGAATTCAGAGTAAA
AATTTATCAAAAATTGAAACATTGAAAACGGCTATTTCCTATATTATGAA
ATTATCCGAGATTATTTCTGAAATTGACAAAAGTGCTCAATTAGTTTGGC
CAAATCAGCAACTTTCCTGCAAGCAGATGGAAATGGATTATCTTTGCTTT
GACACTGAAGGAAATTTGGTCAATTTGCATTGCCACCTCCTCTGTTCAAG
TAGAGAGGATGAACAACTTTTCCATTCGTCAATTAAAGCTCCAATATGGA
GGCCTAAGGATATATTTAAGCCGGTTATAATTCCAGATATTTCATTGTTA
TTTGAATAAA
back to top

protein sequence of SMED30029687-orf-1

>SMED30029687-orf-1 ID=SMED30029687-orf-1|Name=SMED30029687-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=192bp
MIYENNSWFNFPTQISYSDYQIPHLLPKKLPRQTGLDPVTKLHRQRRAAN
IRERQRMRSINLAFEQLRDHLPLYSIDESQNDENRIQSKNLSKIETLKTA
ISYIMKLSEIISEIDKSAQLVWPNQQLSCKQMEMDYLCFDTEGNLVNLHC
HLLCSSREDEQLFHSSIKAPIWRPKDIFKPVIIPDISLLFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0002075pigment cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 50..113
e-value: 1.5E-14
score: 64.3
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 45..107
e-value: 1.4E-15
score: 57.0
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 44..107
score: 15.974
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 44..109
e-value: 7.43286E-13
score: 58.7647
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 39..112
e-value: 4.5E-20
score: 73.0
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 44..126
NoneNo IPR availablePANTHERPTHR19290:SF97BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR AMOS-RELATEDcoord: 45..117
NoneNo IPR availablePANTHERPTHR19290BASIC HELIX-LOOP-HELIX PROTEIN NEUROGENIN-RELATEDcoord: 45..117