Germinal-center associated nuclear protein

Overview
NameGerminal-center associated nuclear protein
Smed IDSMED30029685
Length (bp)3973
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Germinal-center associated nuclear protein (SMED30029685) t-SNE clustered cells

Violin plots show distribution of expression levels for Germinal-center associated nuclear protein (SMED30029685) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Germinal-center associated nuclear protein (SMED30029685) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Germinal-center associated nuclear protein (SMED30029685) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029685

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029685h1SMcG0008358 SmedASXL_017683SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029685h1SMcG0008358 SmedASXL_017683SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Germinal-center associated nuclear protein vs. Ensembl Human
Match: MCM3AP (minichromosome maintenance complex component 3 associated protein [Source:HGNC Symbol;Acc:HGNC:6946])

HSP 1 Score: 276.944 bits (707), Expect = 5.907e-75
Identity = 156/403 (38.71%), Postives = 235/403 (58.31%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEF--CRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            ++K+ LL++ D +  + + K   LD+     GTC DMCPEKERY RE ++ +SVFE    T   D   AVKEY R  ADQ+E LPH LRP  VL RTM+YL+T+I+DQ + ++    WY F+WNRTR I+KDITQQ+LC+   V++IE+  RFHI C+ ++CE+    F+ K+N EN+  CLQ+LK+MY DL      CA+E EF+ Y ++L+L+KG++L E Q+    V NS ++ F +  + A+ +NN+VRFF+L++ +  + +CLLH + + +R  A    N AY  +     ++   PL  + R + F D E+A +F  C  +       SD   + LN S     E   K  +S+  +++    +  I NGG  +  +    P C   SF+    Y G
Sbjct:  604 KEKYRLLDQRDRIMRQARVKRTDLDKARTFVGTCLDMCPEKERYMRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPLPVLSRTMDYLVTQIMDQKEGSLR--DWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLSLNKGDILREVQQFHPAVRNSSEVKFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFSQIRKDALRALNFAYTVSTQ---RSTIFPLDGVVRMLLFRDCEEATDFLTCHGLT-----VSDGC-VELNRSAFLEPEGLSKTRKSVFITRKLTVSVGEIVNGG-PLPPVPRHTPVC---SFNSQNKYIG 991          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Human
Match: MCM3AP (minichromosome maintenance complex component 3 associated protein [Source:HGNC Symbol;Acc:HGNC:6946])

HSP 1 Score: 276.944 bits (707), Expect = 5.907e-75
Identity = 156/403 (38.71%), Postives = 235/403 (58.31%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEF--CRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            ++K+ LL++ D +  + + K   LD+     GTC DMCPEKERY RE ++ +SVFE    T   D   AVKEY R  ADQ+E LPH LRP  VL RTM+YL+T+I+DQ + ++    WY F+WNRTR I+KDITQQ+LC+   V++IE+  RFHI C+ ++CE+    F+ K+N EN+  CLQ+LK+MY DL      CA+E EF+ Y ++L+L+KG++L E Q+    V NS ++ F +  + A+ +NN+VRFF+L++ +  + +CLLH + + +R  A    N AY  +     ++   PL  + R + F D E+A +F  C  +       SD   + LN S     E   K  +S+  +++    +  I NGG  +  +    P C   SF+    Y G
Sbjct:  604 KEKYRLLDQRDRIMRQARVKRTDLDKARTFVGTCLDMCPEKERYMRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPLPVLSRTMDYLVTQIMDQKEGSLR--DWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLSLNKGDILREVQQFHPAVRNSSEVKFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFSQIRKDALRALNFAYTVSTQ---RSTIFPLDGVVRMLLFRDCEEATDFLTCHGLT-----VSDGC-VELNRSAFLEPEGLSKTRKSVFITRKLTVSVGEIVNGG-PLPPVPRHTPVC---SFNSQNKYIG 991          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Human
Match: SAC3D1 (SAC3 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30179])

HSP 1 Score: 113.62 bits (283), Expect = 3.263e-26
Identity = 86/356 (24.16%), Postives = 151/356 (42.42%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFE------KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQ-KDVFEPKLNEENLKNCLQTLKDMYS-DLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDN 1498
            GTC DMCP  ER  RE ++ +   E      ++    D ++AVKEY R  A +    P  LRP  VL  T+ YL  E+ +  D  ++R +  +F+ +R R++  D+  Q   +     ++E      +   A L  D  +   +P L +  ++    +L+  Y+    P     +P F+   ++ NL   E L E  +L + +   P L   + V  A    N  R FRLL+    + SC +   +   R  A   + +A+ T K        +PL  +   +  D + +A + C++    + G+   + +   Y +      S    + LV+SK   + L  +    +   G D 
Sbjct:    9 GTCPDMCPAAERAQREREHRLHRLEVVPGCRQDPPRADPQRAVKEYSRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESAD--IARAEVASFVADRLRAVLLDLALQGAGDAEAAVVLEAALATLLTVVARLGPDAARGPADPVLLQAQVQEGFGSLRRCYARGAGPHP--RQPAFQGLFLLYNLGSVEALHEVLQLPAALRACPPLRKALAVDAAFREGNAARLFRLLQTLPYLPSCAVQCHVGHARREALARFARAFSTPKG-----QTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRYVEEGLPPAS--TCKVLVESKLRGRTLEEVVMAEEEDEGTDR 353          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Human
Match: SAC3D1 (SAC3 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30179])

HSP 1 Score: 113.62 bits (283), Expect = 3.263e-26
Identity = 86/356 (24.16%), Postives = 151/356 (42.42%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFE------KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQ-KDVFEPKLNEENLKNCLQTLKDMYS-DLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDN 1498
            GTC DMCP  ER  RE ++ +   E      ++    D ++AVKEY R  A +    P  LRP  VL  T+ YL  E+ +  D  ++R +  +F+ +R R++  D+  Q   +     ++E      +   A L  D  +   +P L +  ++    +L+  Y+    P     +P F+   ++ NL   E L E  +L + +   P L   + V  A    N  R FRLL+    + SC +   +   R  A   + +A+ T K        +PL  +   +  D + +A + C++    + G+   + +   Y +      S    + LV+SK   + L  +    +   G D 
Sbjct:    9 GTCPDMCPAAERAQREREHRLHRLEVVPGCRQDPPRADPQRAVKEYSRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESAD--IARAEVASFVADRLRAVLLDLALQGAGDAEAAVVLEAALATLLTVVARLGPDAARGPADPVLLQAQVQEGFGSLRRCYARGAGPHP--RQPAFQGLFLLYNLGSVEALHEVLQLPAALRACPPLRKALAVDAAFREGNAARLFRLLQTLPYLPSCAVQCHVGHARREALARFARAFSTPKG-----QTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRYVEEGLPPAS--TCKVLVESKLRGRTLEEVVMAEEEDEGTDR 353          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Human
Match: SAC3D1 (SAC3 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30179])

HSP 1 Score: 70.4774 bits (171), Expect = 1.533e-12
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFE------KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQN 766
            GTC DMCP  ER  RE ++ +   E      ++    D ++AVKEY R  A +    P  LRP  VL  T+ YL  E+ +  D  ++R +  +F+ +R R++  D+  Q 
Sbjct:    9 GTCPDMCPAAERAQREREHRLHRLEVVPGCRQDPPRADPQRAVKEYSRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESAD--IARAEVASFVADRLRAVLLDLALQG 116          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Celegans
Match: F20D12.2 (pep chromosome:WBcel235:IV:7948643:7953548:1 gene:WBGene00017642.1 transcript:F20D12.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F20D12.2)

HSP 1 Score: 190.66 bits (483), Expect = 7.022e-49
Identity = 125/386 (32.38%), Postives = 193/386 (50.00%), Query Frame = 2
Query:  461 CQDMCPEKERYSREYKNFISVFEKNGKTFD--SRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNV-SRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPD--SCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLE-QSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMV-SFDDNGSYTGTRPIPQNLAAPSKPI 1597
            C++MC EKERY R  +  +S +E +  + D      VK+Y R  ADQ+  LPH LR   ++ +T  YLL  ++D + D+   RG WY FLWNRTR+++K++TQ +L +   +N++E+  R HI     LC+   + F+P +N E L  CLQTL+ +Y D      SC NEPEFRSY ++L+++   +L +     S V  S  +   + +  A   NNY RFFRLL+ Q+  +  C+ H+  A  R  A  + + +Y             PL  + R + FD+ E           EI G SD  +I+   ++   + V P      +  K+ N KLS +  G      I +    C +  SF+    YT  + +   L+    PI
Sbjct:  291 CEEMCTEKERYQRIVQKGVSPYECDIVSGDVSHEMMVKQYARSAADQERPLPHELRSEKIMNQTTCYLLHNVLDDFPDSADQRGAWYNFLWNRTRALRKEVTQLSLSDTLALNLVERCTRLHILFGYVLCDLGVEQFDPAMNNETLGKCLQTLRHLYEDFEKRGISCENEPEFRSYDVMLHMNDTNVLAQVLAYRSEVRQSQPVRLALQLATAFRDNNYFRFFRLLQTQASYLQCCVAHKLFAVTRSNAIRIMSISYGIGNI------PYPLDKLQRILGFDNTEDLTVMLNIYELEIEG-SD--VILAKDARYTLNNVVPLKPNQWIDEKK-NGKLSQVVYGPGLFQFIAS---RCDVSNSFNHRNEYTNDKILEMILSGSDIPI 663          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Celegans
Match: F20D12.2 (pep chromosome:WBcel235:IV:7948674:7953548:1 gene:WBGene00017642.1 transcript:F20D12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F20D12.2)

HSP 1 Score: 190.66 bits (483), Expect = 7.022e-49
Identity = 125/386 (32.38%), Postives = 193/386 (50.00%), Query Frame = 2
Query:  461 CQDMCPEKERYSREYKNFISVFEKNGKTFD--SRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNV-SRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPD--SCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLE-QSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMV-SFDDNGSYTGTRPIPQNLAAPSKPI 1597
            C++MC EKERY R  +  +S +E +  + D      VK+Y R  ADQ+  LPH LR   ++ +T  YLL  ++D + D+   RG WY FLWNRTR+++K++TQ +L +   +N++E+  R HI     LC+   + F+P +N E L  CLQTL+ +Y D      SC NEPEFRSY ++L+++   +L +     S V  S  +   + +  A   NNY RFFRLL+ Q+  +  C+ H+  A  R  A  + + +Y             PL  + R + FD+ E           EI G SD  +I+   ++   + V P      +  K+ N KLS +  G      I +    C +  SF+    YT  + +   L+    PI
Sbjct:  291 CEEMCTEKERYQRIVQKGVSPYECDIVSGDVSHEMMVKQYARSAADQERPLPHELRSEKIMNQTTCYLLHNVLDDFPDSADQRGAWYNFLWNRTRALRKEVTQLSLSDTLALNLVERCTRLHILFGYVLCDLGVEQFDPAMNNETLGKCLQTLRHLYEDFEKRGISCENEPEFRSYDVMLHMNDTNVLAQVLAYRSEVRQSQPVRLALQLATAFRDNNYFRFFRLLQTQASYLQCCVAHKLFAVTRSNAIRIMSISYGIGNI------PYPLDKLQRILGFDNTEDLTVMLNIYELEIEG-SD--VILAKDARYTLNNVVPLKPNQWIDEKK-NGKLSQVVYGPGLFQFIAS---RCDVSNSFNHRNEYTNDKILEMILSGSDIPI 663          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Celegans
Match: tag-115 (pep chromosome:WBcel235:IV:13237282:13239441:-1 gene:WBGene00006466.1 transcript:JC8.13a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-115)

HSP 1 Score: 76.6406 bits (187), Expect = 1.899e-14
Identity = 78/300 (26.00%), Postives = 133/300 (44.33%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFEKNGKT---------FDSRKAVKEYDRCVAD-QKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSR------GQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHI----FCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYS---DLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKF 1285
             +C+ MCP  E   R   + I   E    T          D  K VKEY R  AD  K + P  LRP  VLQ T++YLL ++   + D  S          ++F+ +R RSI++D+  QNL  +  V +IE++  F+I     C    C+     ++PKL++  L+ C     +  S   D+ P+   +   F   +   +    ++    +KL    FN      + ++  +  ++NY RFF + +Q D +L   L   ++ +R  A +  + A      F+T   ++P   +S  + F
Sbjct:    2 ASCESMCPVAEINFRSRNHLIDQLEATASTSSGPRSKYVADPTKMVKEYSRSAADTHKYNKPELLRPFPVLQHTIDYLL-DLYSPFKDRRSAITSKQFASIFSFVSDRLRSIRQDMIMQNLRGDFTVILIEKMLPFYIETDGACKMAKCQS----YDPKLHDFQLEECFGRWFEEVSNSTDIIPNPLISACFFFRQLHRKSSILHDLYLFRRKLPHESFN-----LIQSIISSFYSSNYRRFFDIFQQLDPLLKHSLSDCVSILRQSAMKNISVA------FKTPVARLPSQLLSDWLGF 285          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Celegans
Match: tag-115 (pep chromosome:WBcel235:IV:13237281:13239414:-1 gene:WBGene00006466.1 transcript:JC8.13a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-115)

HSP 1 Score: 76.6406 bits (187), Expect = 1.899e-14
Identity = 78/300 (26.00%), Postives = 133/300 (44.33%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFEKNGKT---------FDSRKAVKEYDRCVAD-QKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSR------GQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHI----FCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYS---DLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKF 1285
             +C+ MCP  E   R   + I   E    T          D  K VKEY R  AD  K + P  LRP  VLQ T++YLL ++   + D  S          ++F+ +R RSI++D+  QNL  +  V +IE++  F+I     C    C+     ++PKL++  L+ C     +  S   D+ P+   +   F   +   +    ++    +KL    FN      + ++  +  ++NY RFF + +Q D +L   L   ++ +R  A +  + A      F+T   ++P   +S  + F
Sbjct:    2 ASCESMCPVAEINFRSRNHLIDQLEATASTSSGPRSKYVADPTKMVKEYSRSAADTHKYNKPELLRPFPVLQHTIDYLL-DLYSPFKDRRSAITSKQFASIFSFVSDRLRSIRQDMIMQNLRGDFTVILIEKMLPFYIETDGACKMAKCQS----YDPKLHDFQLEECFGRWFEEVSNSTDIIPNPLISACFFFRQLHRKSSILHDLYLFRRKLPHESFN-----LIQSIISSFYSSNYRRFFDIFQQLDPLLKHSLSDCVSILRQSAMKNISVA------FKTPVARLPSQLLSDWLGF 285          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Celegans
Match: hpo-10 (pep chromosome:WBcel235:III:5879845:5882428:1 gene:WBGene00017158.1 transcript:F01F1.1c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-10)

HSP 1 Score: 75.8702 bits (185), Expect = 1.358e-13
Identity = 61/244 (25.00%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  608 PHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLD---EAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLST------ISRQVKFDDIEQALEF 1312
            P  +RP +VL+ +    L  + D+Y    +R + Y++L ++ RSI++D+T Q + NE  V + E  AR  +                  + E    C   LK +YS++  ++CAN+ EF +Y ++  +     +D     ++LT  +  +  + F +NV +A+  NNYV+FFRL + +  +   ++  F+   R +A  +  KA+  T +++  A  + +        +  ++K+ D+E    F
Sbjct:  415 PSEVRPLEVLRLS----LQNVRDKYR---ARAE-YSYLTSQMRSIRQDLTVQVIRNEFTVEVYEINARISL---------------ENADREEFNKCQSQLKLLYSEI--ENCANQAEFVAYRLLYYIAMDNQIDINALLRELTPELKENDCVEFALNVRKAVTMNNYVKFFRLFKNAPRMCPYIMDLFVDRERKKALGIITKAFRPTITYKLIAEFLSMKESTLIDWLEEELKWTDVEVGGTF 633          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Fly
Match: xmas (gene:FBgn0286809 transcript:FBtr0474622)

HSP 1 Score: 213.001 bits (541), Expect = 2.019e-55
Identity = 134/381 (35.17%), Postives = 208/381 (54.59%), Query Frame = 2
Query:  401 NVDEIKEKNLRLDRP------MIAGTCQDMCPEKERYSREYKNFISVFE---KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVD---QYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSD--LILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISR--SLVQSKRDNQKLSTIFNGGQSVTG 1489
            +V + ++K LRL+R          G C DMCPEKER  RE++  ++ +E    + +     +A+K+Y R  ADQ+  LPH LR    L  TM+YL+ EI+D   + D     G W+ F+W+RTRSI+K+ITQQ LC+   V ++EQ ARFHI C+A L +    VF+ K+N ENL  CLQTLK MY DL      C  E EFR Y+++LNL     L +  +L + + + P++   I  Y A+   N+VRFF+LL   D   + +C+L  +   +R        +AY + +  E  +  +PLS I+  + F   ++A +F +    +I   ++   +VL  S+++  E   K+ R   LV+ KR       + + G+ V+G
Sbjct:  176 SVLDARDKLLRLNRTQHKLSGATQGHCADMCPEKERVLREFQRQVAYYELQPGSDELICHERALKQYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISERQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPSVFDSKINAENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLPAELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLIQAYRSPRKDEVSS--LPLSYIAELLSFASEQEAADFVQHYGLQI---NEAGRVVL--SRMHTVETEYKLPRQYELVEVKR-------VKSVGEVVSG 542          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Fly
Match: xmas (gene:FBgn0286809 transcript:FBtr0474624)

HSP 1 Score: 213.386 bits (542), Expect = 2.049e-55
Identity = 133/386 (34.46%), Postives = 209/386 (54.15%), Query Frame = 2
Query:  368 QDKFELLEKLDNVDEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFE---KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVD---QYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSD--LILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISR--SLVQSKRDNQKLSTIFNGGQSVTG 1489
            ++KF +L+  D +  +     +L      G C DMCPEKER  RE++  ++ +E    + +     +A+K+Y R  ADQ+  LPH LR    L  TM+YL+ EI+D   + D     G W+ F+W+RTRSI+K+ITQQ LC+   V ++EQ ARFHI C+A L +    VF+ K+N ENL  CLQTLK MY DL      C  E EFR Y+++LNL     L +  +L + + + P++   I  Y A+   N+VRFF+LL   D   + +C+L  +   +R        +AY + +  E  +  +PLS I+  + F   ++A +F +    +I   ++   +VL  S+++  E   K+ R   LV+ KR       + + G+ V+G
Sbjct:  172 EEKFSVLDARDKLLRLNRTQHKLS-GATQGHCADMCPEKERVLREFQRQVAYYELQPGSDELICHERALKQYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISERQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPSVFDSKINAENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLPAELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLIQAYRSPRKDEVSS--LPLSYIAELLSFASEQEAADFVQHYGLQI---NEAGRVVL--SRMHTVETEYKLPRQYELVEVKR-------VKSVGEVVSG 542          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Fly
Match: CG3437 (gene:FBgn0035998 transcript:FBtr0301032)

HSP 1 Score: 86.2705 bits (212), Expect = 1.851e-17
Identity = 73/303 (24.09%), Postives = 123/303 (40.59%), Query Frame = 2
Query:  449 IAGTCQDMCPEKERYSREYKNFISVFE-KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFR---------SYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVN 1327
            + G+C+  CP+ E   R  +  +  FE KNG+       VKE+ R  AD K  +P  +R    L +T+ YLL +I+   D        Y F+++R R+++++I  Q       + ++E I  F  +    LCE+  + F+ K+  ++L+ CL  +   Y +L     + EP  R         S   + NL   E    A  L   V           +  A    N  R    + Q   IL  +    +  +R    +++  AY        K   +P+  + R + FD      + CR  N
Sbjct:    4 VRGSCESFCPDGEAKMRIREKLLHYFELKNGQKNKPGVLVKEFTRSAADVKMPMPKEMRTEAALTKTVEYLLKDII--LDTRKPYNVAYDFIFDRLRAVRREIVIQMYDASQKICLLEPIVMFLAYSRYRLCEEPIEKFDLKICNQHLQECLTGVLCCYEELEDLESSREPTVRELERRCFIESLYQLFNLGSPESFTRALTLPDYVRRDATFKLCFGICLAFQQGNLYRVLMGVPQLPHILCAVAAAKLQVIRRSLLQIFTHAY------NNKQLTVPVPYLLRLLLFDGPTGLQDQCRHYN 298          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Zebrafish
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:ZFIN;Acc:ZDB-GENE-040715-1])

HSP 1 Score: 281.182 bits (718), Expect = 1.867e-76
Identity = 156/418 (37.32%), Postives = 240/418 (57.42%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRPMI-AGTCQDMCPEKERYSREYKNFISVFE--KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG----TRPIPQNLAAPSK 1591
            ++++ LLE+ D +  + + K   LD   +  GTC DMCPEKERY RE +N +SVFE   + +  D   A+KEY R  ADQ+E LPH LRP  VL  TM+YL+T+I+DQ + N     WY F+WNRTR I+KDITQQ+LC+   V++IE+  RFHI C+  LC++    F+ K+N EN+  CLQ+LK+MY DL      C  E EFR Y +++ L+ G++L E Q+    +  SP+++F + V+ A+ +NN+VRFF+L+  +  + SC+LHR+   +R +A ++ N A+        ++   P+    R + F +  +A EF   + Q  +  SD  M+ L+ +     + S    +S+   K+    +  + NGG     + N      + SFD N  YTG    + P P  L AP++
Sbjct:  656 EERYRLLEQRDKILRQARPKRTDLDMSKVFVGTCPDMCPEKERYMRETRNQLSVFEVVPDTEKVDHYAAIKEYSRSSADQEEPLPHELRPLPVLSMTMDYLVTQIMDQGEGNCR--DWYDFVWNRTRGIRKDITQQHLCDPETVSLIEKCTRFHIHCAHHLCQEPMMSFDAKINNENMTKCLQSLKEMYQDLATKEVYCPKEAEFRQYNVLVKLNDGDILREVQQFRKEIRESPEVTFAVQVFAALNSNNFVRFFKLVSAASYLSSCILHRYFNQVRRQALKILNVAFTVGSQ---RSTIFPVEDFVRMLMFRNATEATEF---IQQYGLTVSDG-MVELSRTAYQEPDYSLPQKKSVAIEKKRTVLIGEVVNGGP----LPNPPQHSPVCSFDSNNKYTGDGLSSEPPPAVLKAPAE 1060          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Zebrafish
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:ZFIN;Acc:ZDB-GENE-040715-1])

HSP 1 Score: 277.715 bits (709), Expect = 2.712e-75
Identity = 155/415 (37.35%), Postives = 237/415 (57.11%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRPMI-AGTCQDMCPEKERYSREYKNFISVFE--KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG----TRPIPQNLAA 1582
            ++++ LLE+ D +  + + K   LD   +  GTC DMCPEKERY RE +N +SVFE   + +  D   A+KEY R  ADQ+E LPH LRP  VL  TM+YL+T+I+DQ + N     WY F+WNRTR I+KDITQQ+LC+   V++IE+  RFHI C+  LC++    F+ K+N EN+  CLQ+LK+MY DL      C  E EFR Y +++ L+ G++L E Q+    +  SP+++F + V+ A+ +NN+VRFF+L+  +  + SC+LHR+   +R +A ++ N A+        ++   P+    R + F +  +A EF   + Q  +  SD  M+ L+ +     + S    +S+   K+    +  + NGG     + N      + SFD N  YTG    + P P  L A
Sbjct:  656 EERYRLLEQRDKILRQARPKRTDLDMSKVFVGTCPDMCPEKERYMRETRNQLSVFEVVPDTEKVDHYAAIKEYSRSSADQEEPLPHELRPLPVLSMTMDYLVTQIMDQGEGNCR--DWYDFVWNRTRGIRKDITQQHLCDPETVSLIEKCTRFHIHCAHHLCQEPMMSFDAKINNENMTKCLQSLKEMYQDLATKEVYCPKEAEFRQYNVLVKLNDGDILREVQQFRKEIRESPEVTFAVQVFAALNSNNFVRFFKLVSAASYLSSCILHRYFNQVRRQALKILNVAFTVGSQ---RSTIFPVEDFVRMLMFRNATEATEF---IQQYGLTVSDG-MVELSRTAYQEPDYSLPQKKSVAIEKKRTVLIGEVVNGGP----LPNPPQHSPVCSFDSNNKYTGDGLSSEPPPAVLKA 1057          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Zebrafish
Match: si:zfos-452g4.1 (si:zfos-452g4.1 [Source:ZFIN;Acc:ZDB-GENE-030131-4791])

HSP 1 Score: 118.242 bits (295), Expect = 5.702e-28
Identity = 83/326 (25.46%), Postives = 158/326 (48.47%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFEKNGKTFDSR-------KAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQW---YTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVS 1402
            G+C  MCP  E   RE ++ +  FE    T   R       +AVKEY R  A +  +    LRP  VL +T++YL    VD+   + +   W   Y+F+++R RS+++D+  Q +     V ++E+  RF ++ S  LC     +++P++N+ +L+  L  L + YS+       ++ EF++  ++ NL   + +     L   + +S  +   + V +A +  N VR  RL ++ D +  C +HR + P R     +Y+  +       ++  + PL  +++ +   +   A+E C   + ++ G        +N+SK +F+E S
Sbjct:   35 GSCMTMCPAYELRQREAQSRLHRFEMLPGTEQDRLPRADISRAVKEYSRPAAGKDSTRASDLRPPSVLLKTVSYL----VDEVATSSTFQPWTEVYSFVFDRLRSVRQDMIIQRVSGPDCVAVLEKSVRFLLYSSYRLCGQPLQLYDPRINDTHLQESLSWLLESYSE---GKHQHQEEFQALALLYNLGSAQAVQHVLALPERIRSSLAVRLALEVSRAHMERNPVRLLRLAKKLDFMQVCAVHRHLLPCRRDLLLLYSHGH------SSRNYRYPLQRLAQLLCLKE-ALAVELCTVYSVKVTGD------CVNFSKSSFTEAS 340          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Zebrafish
Match: si:zfos-452g4.1 (si:zfos-452g4.1 [Source:ZFIN;Acc:ZDB-GENE-030131-4791])

HSP 1 Score: 84.7297 bits (208), Expect = 1.991e-17
Identity = 51/168 (30.36%), Postives = 88/168 (52.38%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFEKNGKTFDSR-------KAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQW---YTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSD 928
            G+C  MCP  E   RE ++ +  FE    T   R       +AVKEY R  A +  +    LRP  VL +T++YL    VD+   + +   W   Y+F+++R RS+++D+  Q +     V ++E+  RF ++ S  LC     +++P++N+ +L+  L  L + YS+
Sbjct:   54 GSCMTMCPAYELRQREAQSRLHRFEMLPGTEQDRLPRADISRAVKEYSRPAAGKDSTRASDLRPPSVLLKTVSYL----VDEVATSSTFQPWTEVYSFVFDRLRSVRQDMIIQRVSGPDCVAVLEKSVRFLLYSSYRLCGQPLQLYDPRINDTHLQESLSWLLESYSE 217          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Zebrafish
Match: leng8 (leukocyte receptor cluster (LRC) member 8 [Source:NCBI gene;Acc:100037367])

HSP 1 Score: 65.0846 bits (157), Expect = 6.268e-10
Identity = 63/298 (21.14%), Postives = 115/298 (38.59%), Query Frame = 2
Query:  419 EKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEF 1312
            ++ L  D   I GTCQD+           KN++ +                   C  D     P  +RP  VL+++    L  +   +  N    Q Y +   + +SI++D+T Q +  +  V + E  AR  +                K + E    C   LK +Y D P D+      +R    +   + G++  E   LT+ +   P ++  + +  A    N+ RFFRL +++  + + L+ +F+   R  A     K++  + S E          +   + F D++  L F
Sbjct:  579 QEGLSWDDCPIVGTCQDIT----------KNYLRLT------------------CAPD-----PSTVRPVPVLRKS----LIAVKAHWKSN----QDYVYACEQMKSIRQDLTVQGVRTDFTVEVYETHARIALE---------------KGDHEEFNQCQTQLKALYKDCPSDNVGEFTAYRLIYYIFTKNSGDLTTELVYLTTELRADPCVAHALELRTAWALGNFHRFFRLYQKAPRMAAYLIDKFVERERNIALRAILKSFRPSVSVE---------YVQSSLAFPDLDTCLAF 811          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Xenopus
Match: ube3b (ubiquitin protein ligase E3B [Source:Xenbase;Acc:XB-GENE-1010563])

HSP 1 Score: 278.485 bits (711), Expect = 2.632e-75
Identity = 160/401 (39.90%), Postives = 232/401 (57.86%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLP--PDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            +DK+ LL + D +  + + K   LD+  +  GTC DMCPEKERY RE +  +S+FE    T   D   A+KEY R  ADQ+E LP+ LRPT VL  TM+YL+T+I+D+ + N    +WY F+WNRTR I+KDITQQ+LCN + V+++E+  RFHI C+  LCE+    F+ K+N ENL  CL +LK+MY DL     SC  EPEFR Y ++L+L+KG++L E Q+  S V +S ++ F + V+ A+ + N+VRFF+L+  +  + SC+LHR+   +R  A  V N AY  T S + +    PL ++ + + F D  +A EF  S    +        + LN S     EV P   +    S++    +  I NG  S+       P   + SFD    YTG
Sbjct:  981 EDKYLLLNQRDKILRQARVKRTELDQAKLFVGTCPDMCPEKERYMRETRKQLSIFELLPGTDKVDHATAIKEYSRSSADQEEPLPYELRPTHVLSMTMDYLVTQIMDKGEGNYR--EWYDFVWNRTRGIRKDITQQHLCNLSTVSLMEKCMRFHIHCAFELCEEPMSSFDAKINNENLTKCLLSLKEMYQDLHNRGISCPCEPEFRGYSVLLSLNKGDILREVQEFHSTVLHSEEVKFAVQVFAALNSTNFVRFFKLIRSASYLNSCILHRYFNQIRRDALRVLNVAY--TPSIQ-RPTLFPLESMLQMLFFQDTNEATEFLNSYGLSV----SEGNVELNRSAFFEPEVLPHPKKCFFISQKRQVSVGEIVNGA-SLPHFALHYP---LSSFDALNKYTG 1368          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Xenopus
Match: ube3b (ubiquitin protein ligase E3B [Source:Xenbase;Acc:XB-GENE-1010563])

HSP 1 Score: 277.715 bits (709), Expect = 3.775e-75
Identity = 160/401 (39.90%), Postives = 232/401 (57.86%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLP--PDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            +DK+ LL + D +  + + K   LD+  +  GTC DMCPEKERY RE +  +S+FE    T   D   A+KEY R  ADQ+E LP+ LRPT VL  TM+YL+T+I+D+ + N    +WY F+WNRTR I+KDITQQ+LCN + V+++E+  RFHI C+  LCE+    F+ K+N ENL  CL +LK+MY DL     SC  EPEFR Y ++L+L+KG++L E Q+  S V +S ++ F + V+ A+ + N+VRFF+L+  +  + SC+LHR+   +R  A  V N AY  T S + +    PL ++ + + F D  +A EF  S    +        + LN S     EV P   +    S++    +  I NG  S+       P   + SFD    YTG
Sbjct:  981 EDKYLLLNQRDKILRQARVKRTELDQAKLFVGTCPDMCPEKERYMRETRKQLSIFELLPGTDKVDHATAIKEYSRSSADQEEPLPYELRPTHVLSMTMDYLVTQIMDKGEGNYR--EWYDFVWNRTRGIRKDITQQHLCNLSTVSLMEKCMRFHIHCAFELCEEPMSSFDAKINNENLTKCLLSLKEMYQDLHNRGISCPCEPEFRGYSVLLSLNKGDILREVQEFHSTVLHSEEVKFAVQVFAALNSTNFVRFFKLIRSASYLNSCILHRYFNQIRRDALRVLNVAY--TPSIQ-RPTLFPLESMLQMLFFQDTNEATEFLNSYGLSV----SEGNVELNRSAFFEPEVLPHPKKCFFISQKRQVSVGEIVNGA-SLPHFALHYP---LSSFDALNKYTG 1368          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Xenopus
Match: ube3b (ubiquitin protein ligase E3B [Source:Xenbase;Acc:XB-GENE-1010563])

HSP 1 Score: 275.789 bits (704), Expect = 8.890e-75
Identity = 160/401 (39.90%), Postives = 233/401 (58.10%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLP--PDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            +DK+ LL + D +  + + K   LD+  +  GTC DMCPEKERY RE +  +S+FE    T   D   A+KEY R  ADQ+E LP+ LRPT VL  TM+YL+T+I+D+ + N    +WY F+WNRTR I+KDITQQ+LCN + V+++E+  RFHI C+  LCE+    F+ K+N ENL  CL +LK+MY DL     SC  EPEFR Y ++L+L+KG++L E Q+  S V +S ++ F + V+ A+ + N+VRFF+L+  +  + SC+LHR+   +R  A  V N AY  T S + +    PL ++ + + F D  +A EF  S    +   +    + LN S     EV P   +    S++    +  I NG  S+       P   + SFD    YTG
Sbjct:  501 EDKYLLLNQRDKILRQARVKRTELDQAKLFVGTCPDMCPEKERYMRETRKQLSIFELLPGTDKVDHATAIKEYSRSSADQEEPLPYELRPTHVLSMTMDYLVTQIMDKGEGNYR--EWYDFVWNRTRGIRKDITQQHLCNLSTVSLMEKCMRFHIHCAFELCEEPMSSFDAKINNENLTKCLLSLKEMYQDLHNRGISCPCEPEFRGYSVLLSLNKGDILREVQEFHSTVLHSEEVKFAVQVFAALNSTNFVRFFKLIRSASYLNSCILHRYFNQIRRDALRVLNVAY--TPSIQ-RPTLFPLESMLQMLFFQDTNEATEFLNSYGLSVSEGN----VELNRSAFFEPEVLPHPKKCFFISQKRQVSVGEIVNGA-SLPHFALHYP---LSSFDALNKYTG 888          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Xenopus
Match: ube3b (ubiquitin protein ligase E3B [Source:Xenbase;Acc:XB-GENE-1010563])

HSP 1 Score: 275.789 bits (704), Expect = 1.107e-74
Identity = 160/401 (39.90%), Postives = 233/401 (58.10%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLP--PDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            +DK+ LL + D +  + + K   LD+  +  GTC DMCPEKERY RE +  +S+FE    T   D   A+KEY R  ADQ+E LP+ LRPT VL  TM+YL+T+I+D+ + N    +WY F+WNRTR I+KDITQQ+LCN + V+++E+  RFHI C+  LCE+    F+ K+N ENL  CL +LK+MY DL     SC  EPEFR Y ++L+L+KG++L E Q+  S V +S ++ F + V+ A+ + N+VRFF+L+  +  + SC+LHR+   +R  A  V N AY  T S + +    PL ++ + + F D  +A EF  S    +   +    + LN S     EV P   +    S++    +  I NG  S+       P   + SFD    YTG
Sbjct:  507 EDKYLLLNQRDKILRQARVKRTELDQAKLFVGTCPDMCPEKERYMRETRKQLSIFELLPGTDKVDHATAIKEYSRSSADQEEPLPYELRPTHVLSMTMDYLVTQIMDKGEGNYR--EWYDFVWNRTRGIRKDITQQHLCNLSTVSLMEKCMRFHIHCAFELCEEPMSSFDAKINNENLTKCLLSLKEMYQDLHNRGISCPCEPEFRGYSVLLSLNKGDILREVQEFHSTVLHSEEVKFAVQVFAALNSTNFVRFFKLIRSASYLNSCILHRYFNQIRRDALRVLNVAY--TPSIQ-RPTLFPLESMLQMLFFQDTNEATEFLNSYGLSVSEGN----VELNRSAFFEPEVLPHPKKCFFISQKRQVSVGEIVNGA-SLPHFALHYP---LSSFDALNKYTG 894          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Xenopus
Match: ube3b (ubiquitin protein ligase E3B [Source:Xenbase;Acc:XB-GENE-1010563])

HSP 1 Score: 275.789 bits (704), Expect = 1.117e-74
Identity = 160/401 (39.90%), Postives = 233/401 (58.10%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLP--PDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            +DK+ LL + D +  + + K   LD+  +  GTC DMCPEKERY RE +  +S+FE    T   D   A+KEY R  ADQ+E LP+ LRPT VL  TM+YL+T+I+D+ + N    +WY F+WNRTR I+KDITQQ+LCN + V+++E+  RFHI C+  LCE+    F+ K+N ENL  CL +LK+MY DL     SC  EPEFR Y ++L+L+KG++L E Q+  S V +S ++ F + V+ A+ + N+VRFF+L+  +  + SC+LHR+   +R  A  V N AY  T S + +    PL ++ + + F D  +A EF  S    +   +    + LN S     EV P   +    S++    +  I NG  S+       P   + SFD    YTG
Sbjct:  540 EDKYLLLNQRDKILRQARVKRTELDQAKLFVGTCPDMCPEKERYMRETRKQLSIFELLPGTDKVDHATAIKEYSRSSADQEEPLPYELRPTHVLSMTMDYLVTQIMDKGEGNYR--EWYDFVWNRTRGIRKDITQQHLCNLSTVSLMEKCMRFHIHCAFELCEEPMSSFDAKINNENLTKCLLSLKEMYQDLHNRGISCPCEPEFRGYSVLLSLNKGDILREVQEFHSTVLHSEEVKFAVQVFAALNSTNFVRFFKLIRSASYLNSCILHRYFNQIRRDALRVLNVAY--TPSIQ-RPTLFPLESMLQMLFFQDTNEATEFLNSYGLSVSEGN----VELNRSAFFEPEVLPHPKKCFFISQKRQVSVGEIVNGA-SLPHFALHYP---LSSFDALNKYTG 927          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Mouse
Match: Mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:MGI Symbol;Acc:MGI:1930089])

HSP 1 Score: 281.567 bits (719), Expect = 1.524e-76
Identity = 156/402 (38.81%), Postives = 236/402 (58.71%), Query Frame = 2
Query:  368 QDKFELLEKLDNV---DEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            ++K+ LL++ D +     +K  +L   R  + GTC DMCPEKERY RE ++ +SVFE    T   D   AVKEY R  ADQ+E LPH LRP+ VL RTM+YL+T+I+DQ + ++    WY F+WNRTR I+KDITQQ+LC+   V++IE+  RFHI C+ ++CE+    F+ K+N EN+  CLQ+LK+MY DL      CA+E EF+ Y ++LNL+KG++L E Q+    V NSP+++F +  + A+ +NN+VRFF+L++ +  + +CLLH +   +R  A    N AY  +     ++   PL  + R + F D E+A  F   +N   +  +D   + LN S     E   K  +S+   ++    +  + NGG  +  +    P C   SF+    Y G
Sbjct:  597 EEKYRLLDQRDRIMRQARVKRTDLDKARAFV-GTCPDMCPEKERYLRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPSAVLSRTMDYLVTQIMDQKEGSLR--DWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLNLNKGDILREVQQFHPDVRNSPEVNFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFNQIRKDALRALNVAYTVSTQ---RSTVFPLDGVVRMLLFRDSEEATNF---LNYHGLTVADGC-VELNRSAFLEPEGLCKARKSVFIGRKLTVSVGEVVNGG-PLPPVPRHTPVC---SFNSQNKYVG 984          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Mouse
Match: Mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:MGI Symbol;Acc:MGI:1930089])

HSP 1 Score: 83.1889 bits (204), Expect = 9.568e-19
Identity = 38/67 (56.72%), Postives = 49/67 (73.13%), Query Frame = 2
Query:  548 DSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKK 748
            D   AVKEY R  ADQ+E LPH LRP+ VL RTM+YL+T+I+DQ + ++    WY F+WNRTR I+K
Sbjct:   10 DHAAAVKEYSRSSADQEEPLPHELRPSAVLSRTMDYLVTQIMDQKEGSLR--DWYDFVWNRTRGIRK 74          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Mouse
Match: Sac3d1 (SAC3 domain containing 1 [Source:MGI Symbol;Acc:MGI:1913656])

HSP 1 Score: 75.8702 bits (185), Expect = 1.230e-13
Identity = 77/300 (25.67%), Postives = 132/300 (44.00%), Query Frame = 2
Query:  443 PMIAGTCQDMCPEKERYSREYKNFISVFE------KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWL-CEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRS 1321
            PM  G C DMCP  ER  RE +  +   E       N    D ++ VKEY R  A +    P  LRP  VL  T+ YL  E+  + D  VS  +  +F+ +R R+++ D++ Q + +     ++E      +   A +  E+ +   +P L +  ++    +L+  Y+         +  F+   ++ NL   E L E  +L + +   P L   + V  A   +N+ R FRLL     + SC +   I   R +A    ++A  T K        +PL  I   +  D +++A + C++
Sbjct:   79 PM--GLCPDMCPAAERARRERERRLHRLEVEPGGRGNAPRADPKRTVKEYSRPAAGKPRPPPSLLRPPPVLLATVRYLAGEVAGRGD--VSCAEVASFVADRLRAVRLDLSLQGVDDADAATVLEAALATLLAVVARVRPEETRGAADPVLLQTQVQEGFGSLRRCYAR-GKGPYPRQAAFQGLFLLYNLGSVEALQEVLQLPAALRACPPLQAALAVDAAFREDNHARLFRLLRTLPYLQSCAVQEHIGYARRKALARLSRALSTPKG-----QTLPLDFIEHFLALDGLQEARDLCQA 368          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Mouse
Match: Leng8 (leukocyte receptor cluster (LRC) member 8 [Source:MGI Symbol;Acc:MGI:2142195])

HSP 1 Score: 54.299 bits (129), Expect = 1.176e-6
Identity = 56/236 (23.73%), Postives = 95/236 (40.25%), Query Frame = 2
Query:  563 VKEYDR--CVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMM---VLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIP 1255
             K Y R  C  D     P  +RP  VL++++  + +   ++ D        Y F   + +SI++D+T Q +  E  V + E  AR  +                K + E    C   LK +Y++   +   N  EF +Y +   +   + G++  E   LT  +   P ++  + +  A    NY RFFRL   +  +   L+ +F    R  A +   K YV   S    A  +P
Sbjct:  559 TKHYLRLTCAPD-----PSTVRPVAVLKKSLCMVKSHWKEKQD--------YAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALE---------------KGDHEEFNQCQTQLKSLYAE---NLAGNVGEFTAYRILYYIFTKNSGDITTELAYLTREMKADPCVAHALALRAAWALGNYHRFFRLYCHAPCMSGYLVDKFADRERKAALKAMIKTYVALHSAAFCAVALP 763          
BLAST of Germinal-center associated nuclear protein vs. UniProt/SwissProt
Match: sp|Q9WUU9|GANP_MOUSE (Germinal-center associated nuclear protein OS=Mus musculus OX=10090 GN=Mcm3ap PE=1 SV=2)

HSP 1 Score: 281.567 bits (719), Expect = 1.066e-75
Identity = 156/402 (38.81%), Postives = 236/402 (58.71%), Query Frame = 2
Query:  368 QDKFELLEKLDNV---DEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            ++K+ LL++ D +     +K  +L   R  + GTC DMCPEKERY RE ++ +SVFE    T   D   AVKEY R  ADQ+E LPH LRP+ VL RTM+YL+T+I+DQ + ++    WY F+WNRTR I+KDITQQ+LC+   V++IE+  RFHI C+ ++CE+    F+ K+N EN+  CLQ+LK+MY DL      CA+E EF+ Y ++LNL+KG++L E Q+    V NSP+++F +  + A+ +NN+VRFF+L++ +  + +CLLH +   +R  A    N AY  +     ++   PL  + R + F D E+A  F   +N   +  +D   + LN S     E   K  +S+   ++    +  + NGG  +  +    P C   SF+    Y G
Sbjct:  597 EEKYRLLDQRDRIMRQARVKRTDLDKARAFV-GTCPDMCPEKERYLRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPSAVLSRTMDYLVTQIMDQKEGSLR--DWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLNLNKGDILREVQQFHPDVRNSPEVNFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFNQIRKDALRALNVAYTVSTQ---RSTVFPLDGVVRMLLFRDSEEATNF---LNYHGLTVADGC-VELNRSAFLEPEGLCKARKSVFIGRKLTVSVGEVVNGG-PLPPVPRHTPVC---SFNSQNKYVG 984          
BLAST of Germinal-center associated nuclear protein vs. UniProt/SwissProt
Match: sp|O60318|GANP_HUMAN (Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2)

HSP 1 Score: 276.944 bits (707), Expect = 2.837e-74
Identity = 156/403 (38.71%), Postives = 235/403 (58.31%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEF--CRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG 1552
            ++K+ LL++ D +  + + K   LD+     GTC DMCPEKERY RE ++ +SVFE    T   D   AVKEY R  ADQ+E LPH LRP  VL RTM+YL+T+I+DQ + ++    WY F+WNRTR I+KDITQQ+LC+   V++IE+  RFHI C+ ++CE+    F+ K+N EN+  CLQ+LK+MY DL      CA+E EF+ Y ++L+L+KG++L E Q+    V NS ++ F +  + A+ +NN+VRFF+L++ +  + +CLLH + + +R  A    N AY  +     ++   PL  + R + F D E+A +F  C  +       SD   + LN S     E   K  +S+  +++    +  I NGG  +  +    P C   SF+    Y G
Sbjct:  604 KEKYRLLDQRDRIMRQARVKRTDLDKARTFVGTCLDMCPEKERYMRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPLPVLSRTMDYLVTQIMDQKEGSLR--DWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLSLNKGDILREVQQFHPAVRNSSEVKFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFSQIRKDALRALNFAYTVSTQ---RSTIFPLDGVVRMLLFRDCEEATDFLTCHGLT-----VSDGC-VELNRSAFLEPEGLSKTRKSVFITRKLTVSVGEIVNGG-PLPPVPRHTPVC---SFNSQNKYIG 991          
BLAST of Germinal-center associated nuclear protein vs. UniProt/SwissProt
Match: sp|Q9U3V9|XMAS2_DROME (Protein xmas-2 OS=Drosophila melanogaster OX=7227 GN=xmas-2 PE=1 SV=3)

HSP 1 Score: 213.001 bits (541), Expect = 2.024e-54
Identity = 134/381 (35.17%), Postives = 208/381 (54.59%), Query Frame = 2
Query:  401 NVDEIKEKNLRLDRP------MIAGTCQDMCPEKERYSREYKNFISVFE---KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVD---QYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSD--LILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISR--SLVQSKRDNQKLSTIFNGGQSVTG 1489
            +V + ++K LRL+R          G C DMCPEKER  RE++  ++ +E    + +     +A+K+Y R  ADQ+  LPH LR    L  TM+YL+ EI+D   + D     G W+ F+W+RTRSI+K+ITQQ LC+   V ++EQ ARFHI C+A L +    VF+ K+N ENL  CLQTLK MY DL      C  E EFR Y+++LNL     L +  +L + + + P++   I  Y A+   N+VRFF+LL   D   + +C+L  +   +R        +AY + +  E  +  +PLS I+  + F   ++A +F +    +I   ++   +VL  S+++  E   K+ R   LV+ KR       + + G+ V+G
Sbjct:  176 SVLDARDKLLRLNRTQHKLSGATQGHCADMCPEKERVLREFQRQVAYYELQPGSDELICHERALKQYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISERQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPSVFDSKINAENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLPAELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLIQAYRSPRKDEVSS--LPLSYIAELLSFASEQEAADFVQHYGLQI---NEAGRVVL--SRMHTVETEYKLPRQYELVEVKR-------VKSVGEVVSG 542          
BLAST of Germinal-center associated nuclear protein vs. UniProt/SwissProt
Match: sp|O74889|SAC31_SCHPO (SAC3 family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC576.05 PE=1 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 7.147e-40
Identity = 131/430 (30.47%), Postives = 211/430 (49.07%), Query Frame = 2
Query:  314 FKTFKPNISITKKFYPNLQ-DKFELLEKLDNVD-EIKEKNLRLDRPM----------IAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYD--DNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENL-KNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNN-----------------YVRFFRLLEQSDL--ILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPK----ISRSLVQSKRDNQKLSTIFNGGQ 1477
            F+  +   S  K+F   L+ ++FE L  L   + E+  +N  +D P             GTC DMCPE ER  REY+N +  +E N +T   D   AVK + R  A  +++LP  +RP  VL+++++YL+ +IV   D  +N      + F+ +RTRSI++D T QN  +   V   E+IAR+HI C   LCE  K  F  +   E L K  LQ+L + Y DL      C NEPEFRSY ++ +L   +++ ++Q L   +F+  ++   + +      NN                 Y RFF+L++   +  +++CLL      +R  A +   KA+++  +        P   + R + FD +EQA  F R    E+   +  + I LN +   F++  P      S++LV+SK  N+  + I NG +
Sbjct:   47 FEDVEAQDSRQKRFSSTLEGNRFEELRSLREKEREVAIQNGLIDDPTKPRQLDEAVTFVGTCPDMCPEYEREQREYQNNLERWEINPETGRVDKNLAVKAFHRPAAGNEQALPSDVRPPPVLKKSLDYLVDKIVCGPDPLENT-----HFFVRDRTRSIRQDFTLQNCRDLDAVACHERIARYHILCIHQLCE--KKQFSAQQEVEQLRKGILQSLCEFYDDLRKVKIRCPNEPEFRSYAIITHLRDPDVVRQSQILPIEIFDDQRVQLALRLSALAQKNNERVGHILPRNTEACPNLYTRFFKLVQSPAVTYLMACLLESHFMSIRKGALKAMRKAFMSAHA------NFPCGDLKRILHFDTVEQAASFSRYYGLEVSDDNGELSINLNKTAF-FNDSKPDFRQLFSQTLVESKLQNRSFADIINGSR 462          
BLAST of Germinal-center associated nuclear protein vs. UniProt/SwissProt
Match: sp|F4JAU2|SAC3B_ARATH (SAC3 family protein B OS=Arabidopsis thaliana OX=3702 GN=SAC3B PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.032e-30
Identity = 94/309 (30.42%), Postives = 153/309 (49.51%), Query Frame = 2
Query:  446 MIAGTCQDMCPEKERYSREYKNFISVFEK-NGKTFDSRK--AVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQK-----DVFEPKLNEENLKNCLQTLKDMYSDLPPD--SCANEPEFRSYMMVLNLDK--------GEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKF--DDIEQALEF 1312
            +I G C DMCPE ER  RE K  +  +E+ +G    + K  AVK+Y R    ++E++   +RP  +LQ TM YLL+ +   Y++N      Y FLW+R R+I+ D+  Q++ N+  + ++EQ+ R HI     LCE  K     + F+  LN E +      L  MY D      +   E EFR Y  +L LDK         E+  +   +T  +  + ++ F  NV +A  T N++ FFRL  ++  + +CL+H   + +R +A    +      +        +P+S +S  +    +DIE  LE+
Sbjct:  480 LIIGVCPDMCPESERGERERKGDLDHYERVDGDRNQTSKSLAVKKYTRTA--EREAI--LIRPMPILQNTMEYLLSLLDRPYNENFL--GMYNFLWDRMRAIRMDLRMQHIFNQEAITLLEQMIRLHIIAMHELCEYTKGEGFSEGFDAHLNIEQMNKTSVELFQMYDDHRKKGITVPTEKEFRGYYALLKLDKHPGYKVEPSELSLDLANMTPEIRQTSEVLFARNVARACRTGNFIAFFRLARKASYLQACLMHAHFSKLRTQALASLHSGLQINQG-------LPVSDMSNWIGMEEEDIEALLEY 775          
BLAST of Germinal-center associated nuclear protein vs. TrEMBL
Match: A0A5K3ESF5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 2.370e-79
Identity = 163/381 (42.78%), Postives = 221/381 (58.01%), Query Frame = 2
Query:  449 IAGTCQDMCPEKERYSREYKNFISVFE-------KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRG---QWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPP-----DSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRS--LVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNG 1540
            I+GTC+DMCPE ERY RE +  +SVFE        +    D +KAVK+Y R  ADQ E LP  LRP +VLQRTMNYLL  I D+ + + S      WY FLW RTR+I+KDITQQ LC+ T+V+I+E+I RFHIFC+A L +   D F+P++N ENL  CLQTLK++Y DL       D C  EPEFR+YM+++ L+   +LDE QK    +  SP++ F I ++ A+   NYVRFFRL+  SD + +CLLHR+ + +R  A    + A+      E      PLST   Q+ F+    A  FC   N  +   SD+ +I    S     E +    R+  L++ KR  Q L+ +FNGG   T      P+    SFD +G
Sbjct:  346 ISGTCRDMCPETERYFRELRQRVSVFECLNSEISSSLWQMDHKKAVKDYSRSAADQAEPLPRELRPPEVLQRTMNYLLAAIADRPELDQSGNLWKPWYEFLWTRTRAIRKDITQQRLCSSTVVSIVEKITRFHIFCAARLVDQSMDAFDPRINSENLTQCLQTLKELYGDLRKGGAVMDQCLCEPEFRAYMILMKLNDCSVLDEVQKFPEALRKSPEVQFAIAIHSAVTERNYVRFFRLVRTSDCLTACLLHRYFSQVRSHALFALSAAFSRHPKHEVG---FPLSTFVHQLAFESRTDAKAFCEHWNLLV---SDDDLIFQRQSPPREPEFAWHERRAPKLIEDKRAGQTLADLFNGGP--TDSSYATPDPVHSSFDSHG 718          
BLAST of Germinal-center associated nuclear protein vs. TrEMBL
Match: A0A068YAT2 (80 kDa MCM3 associated protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000794600 PE=4 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 2.977e-79
Identity = 181/481 (37.63%), Postives = 263/481 (54.68%), Query Frame = 2
Query:  254 PENKIAYRL---TSNKNFSKIRNFKTFKPNISITKKFYPN------LQDKFELLEKLDNVDEIKEKN----------LRLDRPMIAGTCQDMCPEKERYSREYKNFISVFE-KNGKT------FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRG---QWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDL---PPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRS--LVQSKRDNQKLSTIFNGGQSVTGIDNEL--PECRMVSFDDNGSYTGTRPIPQNLAAPS 1588
            P  + +YR    TS+  F    +  TF PN ++     P       +Q++  +LE  D  +  + ++          L  ++ +I GTC DMCPE ERY RE +  +SVFE ++G         D  +AVK+Y R  ADQ E LP  LRP +VLQRTMNYLL+ I D+ + + +      WY FLW RTR+I+KDITQQ LC+  IV+I+E+I RFHIFC+A L +   D F+P++N ENL  CLQTLK++Y DL   P D C  EPEFR+YM+++ L+   +LDE QK    +  S ++ F I V+ A+  +NYVRFFRL+  +D + +CLLHR+ + +R  A    + A+      E      PL+T   Q+ F+  + A  FC   N  + G  DN +I   +S     E++ +  R+  L++ KR  + L+ +FNGG     ID     P     SFD  G     + I ++   PS
Sbjct:  228 PYEECSYRKNEPTSSLPFQDSTSPPTFFPNNAMKDTAGPGTGAALTVQERLAVLEASDKAEHERRQSTCSHPDLTNKLPNNQSIIVGTCPDMCPETERYLRELRQRVSVFECQSGGLSSAPWQMDHTRAVKDYSRSAADQAEPLPWELRPPEVLQRTMNYLLSAIADRPEIDTTGNLWKPWYEFLWTRTRAIRKDITQQRLCSPAIVSIVEKITRFHIFCAARLMDQSIDAFDPRINSENLTQCLQTLKELYGDLQGAPADLCPCEPEFRAYMILMKLNDCSVLDEVQKFPDALRKSKEVQFAIAVHSAVAEHNYVRFFRLVRVADCLTACLLHRYFSQVRSHALLALSAAFCRHPRHEVT---FPLATFVNQLGFESRKDAQAFCEHWNLHVSG--DN-LIFKRHSPPREPELAWQERRAFNLIEGKRLGRSLADLFNGGP----IDPSYAKPGPVHSSFDSGGHLLSVQEIQESPYYPS 698          
BLAST of Germinal-center associated nuclear protein vs. TrEMBL
Match: A0A443S658 (SAC3 / GANP domain containing protein-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_02573 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 5.028e-79
Identity = 146/346 (42.20%), Postives = 219/346 (63.29%), Query Frame = 2
Query:  449 IAGTCQDMCPEKERYSREYKNFISVFE-KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQ 1477
            + GTC DMCPE ERY R   N +S+FE  + K  D    VKEY R  ADQ+E LPH LRP  +LQRTM+YL+  I D+Y+ N+  G+WY F+W+R R+I+KD+TQQ+LC+ T V ++E+ ARFHIFC  +LCE+   VF+ K+N+ NL  CLQ+LKD Y DL  +   C NEPEFR Y ++LNL++  +L E ++    +  S  + F INVY A   NN+++FF+L++Q+  + +C++HR+    RF A ++++K+Y    S E    Q P++ + RQ  F+D ++   FC++V   I G+  NI++  + +  N + +    S  L++ KRD   +  I NG Q
Sbjct:   50 VLGTCPDMCPEYERYFRAETNQLSIFEMTDNKEPDEFAMVKEYRRSGADQEEPLPHELRPPLILQRTMDYLVCNIADRYEQNI--GEWYDFVWSRLRAIRKDVTQQHLCDNTSVQLLEKCARFHIFCCHYLCEEDSVVFDRKINDGNLSQCLQSLKDFYYDLSLNGVYCENEPEFRCYEILLNLNESGLLGEVKRWRKELRESALIKFAINVYLAYTNNNFIKFFQLVDQATYLNACIIHRYFNEFRFVALKIFHKSYTKRTSNE----QYPITELIRQFGFNDYKEVSSFCKAVGVNINGE--NIVLNRDNNVENITGIPCVRSYRLIEQKRDGLCVGEIINGAQ 387          
BLAST of Germinal-center associated nuclear protein vs. TrEMBL
Match: W6UTE3 (MCM3-associated protein OS=Echinococcus granulosus OX=6210 GN=EGR_00184 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 6.222e-79
Identity = 169/436 (38.76%), Postives = 247/436 (56.65%), Query Frame = 2
Query:  362 NLQDKFELLEKLDNVDEIKEKN----------LRLDRPMIAGTCQDMCPEKERYSREYKNFISVFE-KNGKT------FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRG---QWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDL---PPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRS--LVQSKRDNQKLSTIFNGGQSVTGIDNEL--PECRMVSFDDNGSYTGTRPIPQNLAAPS 1588
             +Q++  +LE  D  +  + ++          L  ++ +I GTC DMCPE ERY RE +  +SVFE ++G +       D  +AVK+Y R  ADQ E LP  LRP +VLQRTMNYLL+ I D+ + + +      WY FLW RTR+I+KDITQQ LC+  IV+I+E+I RFHIFC+A L +   D F+P++N ENL  CLQTLK++Y DL   P D C  EPEFR+YM+++ L+   +LDE QK    +  S ++ F I V+ A+  +N+VRFFRL+  +D + +CLLHR+ + +R  A    + A+      E      PL+T   Q+ F+  + A  FC   N  + G  DN +I   +S     E++ +  R+  L++ KR  + L+ +FNGG     ID     P     SFD  G     + I ++   PS
Sbjct:  273 TVQERLAVLEASDKAEHERRQSTCSHPDLTNKLPSNQSIIVGTCPDMCPETERYLRELRQRVSVFECQSGGSSSAPWQMDHTRAVKDYSRSAADQAEPLPWELRPPEVLQRTMNYLLSAIADRPEIDTTGNLWKPWYEFLWTRTRAIRKDITQQRLCSPAIVSIVEKITRFHIFCAARLVDQSMDAFDPRINSENLTQCLQTLKELYGDLQGAPADLCPCEPEFRAYMILMKLNDCSVLDEVQKFPDALRKSKEVQFAIAVHSAVAEHNHVRFFRLVRAADCLTACLLHRYFSQVRSHALLALSAAFCRHPRHEVT---FPLATFVNQLGFESRKDAQAFCEHWNLHVSG--DN-LIFKRHSLPREPELAWQERRAFNLIEGKRLGRSLADLFNGGP----IDPSYAKPGPVHSSFDSGGHLLSVQEIQESPYYPS 698          
BLAST of Germinal-center associated nuclear protein vs. TrEMBL
Match: A0A068W7C4 (80 kDa MCM3 associated protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000794600 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 7.037e-79
Identity = 169/436 (38.76%), Postives = 247/436 (56.65%), Query Frame = 2
Query:  362 NLQDKFELLEKLDNVDEIKEKN----------LRLDRPMIAGTCQDMCPEKERYSREYKNFISVFE-KNGKT------FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRG---QWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDL---PPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRS--LVQSKRDNQKLSTIFNGGQSVTGIDNEL--PECRMVSFDDNGSYTGTRPIPQNLAAPS 1588
             +Q++  +LE  D  +  + ++          L  ++ +I GTC DMCPE ERY RE +  +SVFE ++G +       D  +AVK+Y R  ADQ E LP  LRP +VLQRTMNYLL+ I D+ + + +      WY FLW RTR+I+KDITQQ LC+  IV+I+E+I RFHIFC+A L +   D F+P++N ENL  CLQTLK++Y DL   P D C  EPEFR+YM+++ L+   +LDE QK    +  S ++ F I V+ A+  +N+VRFFRL+  +D + +CLLHR+ + +R  A    + A+      E      PL+T   Q+ F+  + A  FC   N  + G  DN +I   +S     E++ +  R+  L++ KR  + L+ +FNGG     ID     P     SFD  G     + I ++   PS
Sbjct:  273 TVQERLAVLEASDKAEHERRQSTCSHPDLTNKLPSNQSIIVGTCPDMCPETERYLRELRQRVSVFECQSGGSSSAPWQMDHTRAVKDYSRSAADQAEPLPWELRPPEVLQRTMNYLLSAIADRPEIDTTGNLWKPWYEFLWTRTRAIRKDITQQRLCSPAIVSIVEKITRFHIFCAARLVDQSMDAFDPRINSENLTQCLQTLKELYGDLQGAPADLCPCEPEFRAYMILMKLNDCSVLDEVQKFPDALRKSKEVQFAIAVHSAVAEHNHVRFFRLVRAADCLTACLLHRYFSQVRSHALLALSAAFCRHPRHEVT---FPLATFVNQLGFESRKDAQAFCEHWNLHVSG--DN-LIFKRHSLPREPELAWQERRAFNLIEGKRLGRSLADLFNGGP----IDPSYAKPGPVHSSFDSGGHLLSVQEIQESPYYPS 698          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Cavefish
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:ZFIN;Acc:ZDB-GENE-040715-1])

HSP 1 Score: 280.026 bits (715), Expect = 3.890e-76
Identity = 162/429 (37.76%), Postives = 237/429 (55.24%), Query Frame = 2
Query:  326 KPNISITKKFYPNLQDKFELLEKLDNVDEIKEKNLRLDRP---------MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTG--TRPIP 1567
            +P IS+     P +    E  E+   + E ++K LR  RP         +  GTC DMCPEKERY RE +N +SVFE   +T   D   A+KEY R  ADQ+E LPH LRP  VL  TM+YL+T+I+DQ + N     WY F+WNRTR I+KDITQQ+LC+   V +IE+  RFHI C+  LC++    F+ K+N EN+  CLQ+LK+MY DL      C +E EFR Y ++L L++G+ML E Q+    V NS ++ F +  + A+ +NN+VRFF+L++ +  + SC+LHR+   MR  A +  N AY        ++   P+  ++R + F    +A  F +     +     + M+ L+ +     ++     +S+   K+ N  +  I NGGQ +       P C   SFD N  Y G  T P+P
Sbjct:  655 RPVISLPSSLQPLIGQLAETSEEKYRLLEQRDKILRQSRPKRTDLDLSKVFVGTCPDMCPEKERYMRETRNQLSVFELVPETEKVDHFAAIKEYSRSSADQEEPLPHELRPLPVLSMTMDYLVTQIMDQGEGNYR--DWYDFVWNRTRGIRKDITQQHLCDPDTVALIEKCTRFHIHCAHHLCQEPMMSFDTKINNENMTKCLQSLKEMYQDLATKEVYCPHEAEFRQYNVLLKLNEGDMLREVQQFREEVRNSAEVKFAVQAFAALNSNNFVRFFKLVKAASYLASCILHRYFNQMRRSALKALNIAYTVGSQ---RSTVFPVEDLARMLMFRSAAEATHFLQLYGLNVT----DGMVELSRTAYQEPDLPIPQRKSVDIEKKMNVLIGEIVNGGQ-LPNPPQHRPVC---SFDLNNKYIGETTYPMP 1070          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Cavefish
Match: si:zfos-452g4.1 (SAC3 domain containing 1 [Source:NCBI gene;Acc:103021768])

HSP 1 Score: 126.716 bits (317), Expect = 1.081e-30
Identity = 94/355 (26.48%), Postives = 167/355 (47.04%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFEKNGKT-------FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQW---YTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKIS------RSLVQSKRDNQKLSTIFNG 1471
            GTC  MCP  E + RE +N +  FE    T        D  + VKEY R  A +  +    LRP DVL +T+ YL    VD    N     W   Y+F+++R RS+++D+  Q +      +++E+  RF ++ S  LC     +++P +N+ +L+  L  L + Y++       ++ EF++  ++ NL   +    A  L   V  SP +   + V +A +  N VR  RL ++ D + +C LHR +   R     +YN  +       +K  + P+  ++  +  +    A++ C++   +I G  D ++    +SK +F+E SP           LV+ K+    + +I +G
Sbjct:   48 GTCSTMCPNSEVWQREAQNRLHRFEMLAGTERDRLPRADVTRVVKEYSRPAAGKDTTRASELRPPDVLLKTVCYL----VDDIAANPKLQPWTEVYSFVFDRLRSVRQDMVIQRISGPDCASVLERTVRFLLYASYRLCGQPLRLYDPHINDTHLQESLSWLLECYAE---GQHKHQDEFQALSLLYNLGSPQATQHALALPHKVRTSPPVQLALAVSRAYMERNPVRLLRLAQKLDFLQACALHRHLLSCRRDLLLLYNHGH------SSKNCRFPIQKLADILSLEQ-SLAVQLCQAHGIQING--DWVV----FSKGSFTE-SPSEGLQCAHMHKLVEDKQRGLSVGSIIHG 381          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Cavefish
Match: ENSAMXT00000034136.1 (leukocyte receptor cluster member 8 [Source:NCBI gene;Acc:103044145])

HSP 1 Score: 52.7582 bits (125), Expect = 2.650e-6
Identity = 58/288 (20.14%), Postives = 108/288 (37.50%), Query Frame = 2
Query:  449 IAGTCQDMCPEKERYSREYKNFISVFEKNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEF 1312
            I GTCQD+           KN++ +                   C  D     P  +RP  VL+++    L  +   +  N    Q Y +   + +SI++D+T Q +  +  V + E  AR  +                K + E    C   LK +Y D P D+      +R    +   + G++  E   LT  +     +S  + +  A    NY +FF+L +++  + + L+ +F+   R  A     K +  +         +P+  +   + F  ++  L F
Sbjct:  598 IVGTCQDIT----------KNYLRL------------------TCAPD-----PSTVRPVSVLRKS----LVAVKGHWKTN----QDYQYACEQMKSIRQDLTVQGVRTDFTVEVYETHARIAL---------------EKGDHEEFNQCQTQLKALYKDCPSDNVGEFTAYRLLYYIFTKNSGDLTTELVYLTPELREDDCVSHALALRAAWALGNYHKFFQLYKRAPRMAAYLIDKFVERERKLALGAILKTFRPS---------VPMEYVQSSLAFPCLDTCLAF 820          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007904.1 (pep scaffold:Pmarinus_7.0:GL480340:6186:21414:1 gene:ENSPMAG00000007140.1 transcript:ENSPMAT00000007904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.626 bits (688), Expect = 1.206e-77
Identity = 155/439 (35.31%), Postives = 239/439 (54.44%), Query Frame = 2
Query:  362 NLQDKFELLEKLD-NVDEIKEKNLRLDRP-MIAGTCQDMCPEKERYSREYKNFISVFEKNGKT--FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFN---GGQSVTGIDNELPECRMVSFDDNGSYTG--------------TRPIPQNLAAPS---KPIP 1600
            N ++K++LLE  D  + + + +   L++   I GTC DMCPEKERY RE +  +S++E    T   +    +KEY R  ADQ+E LPH LRP  VL  TM YL+  +++  +DN +  +WY F+WNRTR I+KDITQQ+LC    V++IE+  RFH+ C+  LC+     FEPK+N ENL  CLQ+LK+MY DL      C+ EPEFR Y ++LNL+ G++L E Q+    + NS  + F + V+ A+ +NN+VRFF+L++ +  + +CLLHR+   +R  A +  N A    +    +++ +PL  +   + F   ++A EF       +  ++    + LN S      + P+ + ++ +S     KL+T+      G  + G    +P     SFD  G Y G               RPI Q   + +    PIP
Sbjct:  171 NSEEKYQLLELRDKQMRQARTRRTELEKAKAIVGTCSDMCPEKERYLREIRKQLSIYEVIPGTDKVNHAAVIKEYSRSSADQEEPLPHELRPPHVLDMTMQYLVNSVMNIGEDNWA--EWYDFVWNRTRGIRKDITQQHLCEPISVSLIEKCTRFHVLCAHHLCQQPMATFEPKINNENLTKCLQSLKEMYQDLANKGIYCSGEPEFRGYSVLLNLNHGDILREVQQFREEIRNSSPVKFAVQVFSALNSNNFVRFFKLVKSASYLNACLLHRYFTQVRRDALKALNVALTVPQ----RSSSLPLQQMMHTLLFTSEKEAAEFFSHYGLNVTDET----VELNRSSF----IEPECTLAMKKSSFIECKLTTLLGEVVNGAPLGGAPRHVPSS---SFDLQGQYAGEGSAEGPIETNKDSQRPIAQGRGSSADAVAPIP 592          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Sea Lamprey
Match: si:zfos-452g4.1 (si:zfos-452g4.1 [Source:ZFIN;Acc:ZDB-GENE-030131-4791])

HSP 1 Score: 122.479 bits (306), Expect = 2.517e-30
Identity = 84/316 (26.58%), Postives = 149/316 (47.15%), Query Frame = 2
Query:  548 DSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSR----GQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISR--SLVQSKRDNQKLSTIFNGGQ 1477
            D  +AVKEY R  A +       LRP  VL RT++YL+  ++   D+  +R     + Y F ++R R++++D   Q      IV ++E+  R  ++ +  LCE+    FEP + + +L+ C   L   YS    + C NE +F++  ++ N+   + +  A +    + NS  +   +++ +  L  N+VRFFRL+     + SC  HR    +R +A   Y+  +        +  + PL+ +S  +  D   +A   C+     +VG+     I    + +      PK +R  +LV SKR+   L  I +G Q
Sbjct:   37 DPARAVKEYSRPAAGKHRPRASELRPPAVLLRTVDYLIDGVLCPADEASARSTPFAEAYEFTFDRLRAVRQDAVVQRAGGPHIVLVLEKSVRVMVYATYRLCEETLARFEPTITDCHLQECFSWLLRNYSS---ERCHNEGDFQALHILYNMGSFKAMHYALQRPPEIRNSQVMRLALDINRCYLEGNFVRFFRLVRHLPFLHSCAAHRHFRFVRQQALRTYSHGH------SVRNCRYPLARLSELLGLDSAGEARSLCQHCGI-LVGEDG--CIAFQKTAMKAPVDLPKSARCVALVDSKREEWTLREILHGLQ 340          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Yeast
Match: SAC3 (mRNA export factor; required for biogenesis of the small ribosomal subunit; component of TREX-2 complex (Sac3p-Thp1p-Sus1p-Cdc31p) involved in transcription elongation and mRNA export from the nucleus; involved in post-transcriptional tethering of active genes to the nuclear periphery and to non-nascent mRNP; similar to the human germinal center-associated nuclear protein (GANP) [Source:SGD;Acc:S000002566])

HSP 1 Score: 111.309 bits (277), Expect = 5.756e-25
Identity = 106/409 (25.92%), Postives = 186/409 (45.48%), Query Frame = 2
Query:  362 NLQDKFELLEKLDNVDE--IKEKNL---------RLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKN---GKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDL--PPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNN----------------YVRFFRLLEQSD--LILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIV-GQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLS--TIFNGGQ 1477
            +L + +E L+K+ N +   ++EK L           D  +  GTC DMCP  ER  R  +  +  +EKN    K     KA+K + R  A     LP  +RP  +L +T++Y++  ++    +  S G    FLW+R RSI++D T QN      V+  E+I R H+     + +   + F  +   E L   L TL ++Y D+     +C NE EFR+Y ++  +   +  +  Q+L   +F   KL  +   ++ +++N+                Y RFF+L++     L++   L   +  +RF A          + +   K   IP   +   + F++ ++ +EFC   + EI+ G + ++  + +YS    SE  P     L   +R  QK +   + NGG+
Sbjct:  156 DLNELYETLKKMRNTERSIMEEKGLVDKADSAKDLYDAIVFQGTCLDMCPTFERSRRNVEYTVYSYEKNQPNDKKASRTKALKVFARPAAAAAPPLPSDVRPPHILVKTLDYIVDNLLTTLPE--SEG----FLWDRMRSIRQDFTYQNYSGPEAVDCNERIVRIHLLILHIMVKSNVE-FSLQQELEQLHKSLITLSEIYDDVRSSGGTCPNEAEFRAYALLSKIRDPQYDENIQRLPKHIFQD-KLVQMALCFRRVISNSAYTERGFVKTENCLNFYARFFQLMQSPSLPLLMGFFLQMHLTDIRFYALRAL------SHTLNKKHKPIPFIYLENMLLFNNRQEIIEFCNYYSIEIINGDAADLKTLQHYSH-KLSETQPLKKTYLTCLERRLQKTTYKGLINGGE 549          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Nematostella
Match: EDO31533 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXM6])

HSP 1 Score: 254.218 bits (648), Expect = 1.046e-75
Identity = 126/306 (41.18%), Postives = 192/306 (62.75%), Query Frame = 2
Query:  449 IAGTCQDMCPEKERYSREYKNFISVFEKNGKTF---DSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPD---SCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQS 1348
            + G C DMCPEKERY RE +  + VFE    ++   +  KA+KEYDR  AD+ E LPH LRP  VL+ TM+YL+T ++D  +   +  +W+ F+WNRTR I+KDITQQ+LC+   V +IE+ ARFHIFC+ +LC +    F+ ++N ENL  CLQTLK  Y DL  +   +C +E EFR+Y ++LNL++G++L +A K    +  SP + F  +V+ A+ +NN+VRFF+L++ +D + +C+LHR+   +R  A    N +  T      K    PL  +++ + F+D ++A +FC     E+   S
Sbjct:    3 VKGACPDMCPEKERYMREDRRRLHVFETVPGSYSMVNHSKAIKEYDRSAADKDEPLPHELRPIPVLKMTMDYLVTNVMDIGEGRWA--EWFDFVWNRTRGIRKDITQQHLCDVDAVELIEKTARFHIFCAHYLCGEDMMTFDSRINTENLTKCLQTLKQFYGDLQKNQGVTCPHEAEFRAYDILLNLNEGDILRQAMKYREEIQRSPIVKFATSVFHALDSNNFVRFFKLVKCADYMCACILHRYFTQVRSMALRTMNYSLTTP----NKEMYYPLEELAQVLAFEDADEASDFCTFFGLEVTESS 302          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Nematostella
Match: EDO34367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK1])

HSP 1 Score: 108.612 bits (270), Expect = 3.293e-26
Identity = 73/220 (33.18%), Postives = 110/220 (50.00%), Query Frame = 2
Query:  563 VKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQW---YTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAY 1213
            VKE+ R  A ++  L   LRP  VL +TM YL+ +++D+ D       W   Y F+++R R+I++D+  Q + +ET V+I+EQ  RFHI     L     + F+PK+N  +   CL+ L  +Y  +      N PEF SY ++ NLD    L    +L   V           +  A L  NYV F RLL +   +    +  ++  MR RA +V N AY
Sbjct:    5 VKEFSRPAAGRQTDLSD-LRPPHVLLKTMEYLIGDVLDRKD-----FPWKIIYNFIFDRIRAIRQDMVIQRVADETAVSILEQATRFHILSHHKLAGMPIEDFDPKINGIHTTECLKRLLVLYKHV---FSRNRPEFESYYLLCNLDNTNALIHGLQLPKSVRVEVNYQLSWKLALAYLHGNYVLFIRLLHRLPRLSLFAVVSYVRDMRIRALDVMNTAY 215          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Nematostella
Match: EDO48284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJL8])

HSP 1 Score: 58.9214 bits (141), Expect = 5.409e-9
Identity = 58/228 (25.44%), Postives = 100/228 (43.86%), Query Frame = 2
Query:  617 LRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLD---EAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDD 1291
            +RP +VL++++     E+V    D+    Q Y +   + +SI++D+T Q + +E  V + E  AR  +                K + E    C   LK +Y+   P    +  EF +Y ++ ++  G  L+   E  KLT G    P +   +  Y A   +NY  FF+L   S  + + L+  FI   R  A +V  K+Y  T         +P+S +  ++ F D
Sbjct:  150 VRPKEVLKKSL-----EMVK---DHWKTKQDYVYACEQFKSIRQDLTVQGIRDEFTVEVYETHARVAL---------------EKGDREEFNQCQTQLKALYASNAP---GHVREFTAYRLLYHIMIGNTLEVTTEVLKLTPGEKADPAIKHALQFYSARALSNYHNFFQLYLSSPNMSAYLVDLFIQRERTTAIKVLIKSYRPT---------LPVSFVQSELGFPD 342          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Nematostella
Match: EDO28318 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T6])

HSP 1 Score: 53.1434 bits (126), Expect = 6.680e-7
Identity = 32/93 (34.41%), Postives = 47/93 (50.54%), Query Frame = 2
Query:  371 DKFELLEKLDNV--DEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKNGKTF--------DSRKAVKEYDRCVADQKE-SLPHH 616
            D+F +L+ +D      +K+         + G C DMCPEKERY RE +  + VFE    ++        +  KA+KEYDR  AD+   + P H
Sbjct:  476 DRFRILDMIDKKIRQGVKKATDISTAKAVKGACPDMCPEKERYMREDRRRLHVFETVPGSYSMEENPKVNHSKAIKEYDRSAADKGYITSPSH 568          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Medaka
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:NCBI gene;Acc:101157016])

HSP 1 Score: 285.804 bits (730), Expect = 3.675e-78
Identity = 156/403 (38.71%), Postives = 230/403 (57.07%), Query Frame = 2
Query:  368 QDKFELLEKLDNV-DEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFE--KNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDS--CANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTGTRP 1561
            ++KF LLE+ D +  + + K   LD   + GTC DMCPEKERY RE +N +SVFE   N +  +   A+KEY R  ADQ+E LPH LRP  VL+ TM+YL+T+I+D   DN     WY F+WNRTRSI+KDITQQ LC    V++IE+  RFH+ C+  LCE+    F+PK+N EN+  CLQ+LK+MY DL      C +E EFR Y ++L L+ G++L   Q+    V NSP+L F +  + A+ +NN+VRFF+L++ +  +  CLLHR+   +R +A +V N A         ++  +P+  ++R + F +  +A +F +     +     + M+ L+       E+ P   RS V   +       + NGG  +    +  P+C   SFD    Y G  P
Sbjct:  590 EEKFRLLEQRDKILRQGRSKRTDLDLAFV-GTCPDMCPEKERYMRETRNQLSVFEVIPNTEMVNHTAAIKEYSRSSADQEEPLPHELRPLPVLKMTMDYLVTQIMDLGQDNYR--DWYDFVWNRTRSIRKDITQQRLCCPQTVSLIEKCTRFHVHCAHHLCEEHMSSFDPKINTENMTKCLQSLKEMYEDLAAHQTFCPSEAEFRQYSVLLKLNDGDILRSVQQFRDEVRNSPELKFAVQAFAAVNSNNFVRFFKLVKGASYLAGCLLHRYFNQVRAKALKVLNMALTVGP----RSTPLPVEDVARMLMFPNSAEATDFVQQFGLNVT----DGMVELSRVVYQEPEIPPSPKRSAVIIAKKTVLNGEVVNGG-PLPIPPHHTPQC---SFDLQNKYRGELP 977          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Medaka
Match: si:zfos-452g4.1 (SAC3 domain containing 1 [Source:NCBI gene;Acc:101157769])

HSP 1 Score: 133.65 bits (335), Expect = 5.961e-33
Identity = 90/300 (30.00%), Postives = 145/300 (48.33%), Query Frame = 2
Query:  455 GTCQDMCPEKERYSREYKNFISVFEKNGKTFDSRK-------AVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQW---YTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMY-SDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDD--IEQALEFC 1315
            GTCQ MCP +E   R  +N +  FE    T   R+       AVKEY R  A +  + P  LRP  VL +T++YL+ EI        SR  W   Y F+++R RS+K+D+  Q +       ++E I RF I+ S  LC +   +++P++N+ +L+  L  L D Y +D  P+   N+ EF++  ++ NLD       A +L   +  S  ++  +++ QA L  N VR  RL      + +C LHR +   R     +Y      +  F ++  + PL  ++R +  D     Q  + C
Sbjct:   59 GTCQTMCPVQELQDRVAQNRLHHFEMVPGTEKDRRPKGDPLRAVKEYARPAAGKDATNPTDLRPPAVLLKTVHYLINEIAA----TPSRHPWTEVYGFVFDRLRSVKQDMIIQRVSGSECAALLEPIVRFLIYASYRLCGEPLRLYDPRINDTHLQEYLSWLLDCYTADGGPNP--NQEEFQALGLLYNLDSMRARQHAMELPQQLRTSSSVTLAMSIGQAFLERNPVRLLRLAGGLSFLQTCALHRHLVACRRDLLLIY------SHGFSSRNCRFPLDRLARLLHLDSALAAQLCQLC 346          
BLAST of Germinal-center associated nuclear protein vs. Ensembl Medaka
Match: si:zfos-452g4.1 (SAC3 domain containing 1 [Source:NCBI gene;Acc:101157769])

HSP 1 Score: 123.635 bits (309), Expect = 4.485e-30
Identity = 86/294 (29.25%), Postives = 142/294 (48.30%), Query Frame = 2
Query:  470 MCPEKERYSREYKNFISVFEKNGKT-------FDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQW---YTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMY-SDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCR 1318
            MCP +E   R  +N +  FE    T        D  +AVKEY R  A +  + P  LRP  VL +T++YL+ EI        SR  W   Y F+++R RS+K+D+  Q +       ++E I RF I+ S  LC +   +++P++N+ +L+  L  L D Y +D  P+   N+ EF++  ++ NLD       A +L   +  S  ++  +++ QA L  N VR  RL      + +C LHR +   R     +Y      +  F ++  + PL  ++R +  D    A + C+
Sbjct:    1 MCPVQELQDRVAQNRLHHFEMVPGTEKDRRPKGDPLRAVKEYARPAAGKDATNPTDLRPPAVLLKTVHYLINEIAA----TPSRHPWTEVYGFVFDRLRSVKQDMIIQRVSGSECAALLEPIVRFLIYASYRLCGEPLRLYDPRINDTHLQEYLSWLLDCYTADGGPNP--NQEEFQALGLLYNLDSMRARQHAMELPQQLRTSSSVTLAMSIGQAFLERNPVRLLRLAGGLSFLQTCALHRHLVACRRDLLLIY------SHGFSSRNCRFPLDRLARLLHLDSALAA-QLCQ 281          
BLAST of Germinal-center associated nuclear protein vs. Planmine SMEST
Match: SMESG000008313.1 (SMESG000008313.1)

HSP 1 Score: 2142.47 bits (5550), Expect = 0.000e+0
Identity = 1099/1107 (99.28%), Postives = 1100/1107 (99.37%), Query Frame = 2
Query:  107 MNYKNSYSRTDQTKKTFSLNKNKDLFPRNSYKRKAXXXXXXXXXXXXKLPENKIAYRLTSNKNFSKIRNFKTFKPNISITKKFYPNLQDKFELLEKLDNVDEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTGTRPIPQNLAAPSKPIPDQAXXXXXXXXXXXXXXXXXXXXXXTNENVSLDNFPVKEDKPETSNIFRQSAATIGYEPNKLNNLFSKPTTGSVGLFGLFSNNQKPLNEAGGIFHQSKPTLLFSDLQP--AAAGCDLFQKPTNPNQFQSIADAQQHPGGLSERLAQFMERNIPQSTPEPISKLPLFTPAELHDISKTISENLLTEFVSIGCRKEIEISISSEKRNQVEIERIFSGILGNTIKHAVTESVGNHNANRKAVINSIAEDFIAEIVGNETEITISYVEXXXXXXXXXXXXXXXXLFFQRWQRHCRNLVNSRKCLSNLRAAPRMKTDFAVCQEFRGKVRKVNTDWFVRRGGGGDWSKRPITSRLDQLTGGGCNPPVIVTDTHSTDCQTLVSYFNVSSMKLQQFILDFVKYRYINVLDRLLASLEFSNRVHPALEVLISDYNATINEMEKIVQSKSIEFIDFSSYILPVITIQKTDNDQKFSKQYIDQLFQKLHISQNQRKFYFCKAAEYFRNLDGNVELVDLSYFHLRLFPWINVMKHSVSNRLEKSMKSVPNRQIEIDKSVFSPVKLLQSEFVLNEISVQFCVGKLIKEPEVSTTVQLKTPKRTRYFNDLCNGINQLTKKLDE 3421
            MNYKNSYSRTDQTKKTFSLNKNKDLFPRNSYKRKADFNISDNDNDDIKLPENKIAYRLTSNKNFSKIRNFKTFKPNISITKKFYPNLQDKFELLEKLDNVDEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTGTRPIPQNLAAPSKPIPDQAEVEVISIESSEEEFSRSSPVSSTNENVSLDNFPVKEDKPE SNIFRQSAATIGYEPNKLNNLFSKPTTGSVGLFGLFSNNQKPLNEAGGIFHQSKPTLLFSDLQP  AAAGCDLFQKPTNPNQFQSIA AQQHPGGLSERL QFMERNIPQSTPEPISKLPLFTPAELHDISKTISENLLTEFVSIGCRKEIEISISSEKRNQVEIERIFSGILGNTIKHAVTESVGNHNANRK VINSI+EDFIAEIVGNETEITISYVEKKKMDKDKMFKFYRKKLFFQRWQRHCRNLVNSRKCLSNLRAAPRMKTDFAVCQEFRGKVRKVNTDWFVRRGGGGDWSKRPITSRLDQLTGGGCNPPVIVTDTHSTDCQTLVSYFNVSSMKLQQFILDFVKYRYINVLDRLLASLEFSNRVHPALEVLISDYNATINEMEKIVQSKSIE IDFSSYILPVITIQKTDNDQKFSKQYIDQLFQKLHISQNQRKFYFCKAAEYFRNLDGNVELVDLSYFHLRLFPWINVMKHSVSNRLEKSMKSVPNRQIEIDKSVFSPVKLLQSEFVLNEISVQFCVGKLIKEPEVSTTVQLKTPKRTRYFNDLCNGINQLTKKLDE
Sbjct:    1 MNYKNSYSRTDQTKKTFSLNKNKDLFPRNSYKRKADFNISDNDNDDIKLPENKIAYRLTSNKNFSKIRNFKTFKPNISITKKFYPNLQDKFELLEKLDNVDEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKNGKTFDSRKAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQWYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKDVFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEMLDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLLHRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQALEFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLSTIFNGGQSVTGIDNELPECRMVSFDDNGSYTGTRPIPQNLAAPSKPIPDQAEVEVISIESSEEEFSRSSPVSSTNENVSLDNFPVKEDKPEMSNIFRQSAATIGYEPNKLNNLFSKPTTGSVGLFGLFSNNQKPLNEAGGIFHQSKPTLLFSDLQPAAAAAGCDLFQKPTNPNQFQSIAVAQQHPGGLSERLPQFMERNIPQSTPEPISKLPLFTPAELHDISKTISENLLTEFVSIGCRKEIEISISSEKRNQVEIERIFSGILGNTIKHAVTESVGNHNANRKVVINSISEDFIAEIVGNETEITISYVEKKKMDKDKMFKFYRKKLFFQRWQRHCRNLVNSRKCLSNLRAAPRMKTDFAVCQEFRGKVRKVNTDWFVRRGGGGDWSKRPITSRLDQLTGGGCNPPVIVTDTHSTDCQTLVSYFNVSSMKLQQFILDFVKYRYINVLDRLLASLEFSNRVHPALEVLISDYNATINEMEKIVQSKSIEIIDFSSYILPVITIQKTDNDQKFSKQYIDQLFQKLHISQNQRKFYFCKAAEYFRNLDGNVELVDLSYFHLRLFPWINVMKHSVSNRLEKSMKSVPNRQIEIDKSVFSPVKLLQSEFVLNEISVQFCVGKLIKEPEVSTTVQLKTPKRTRYFNDLCNGINQLTKKLDE 1107          
The following BLAST results are available for this feature:
BLAST of Germinal-center associated nuclear protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM3AP5.907e-7538.71minichromosome maintenance complex component 3 ass... [more]
MCM3AP5.907e-7538.71minichromosome maintenance complex component 3 ass... [more]
SAC3D13.263e-2624.16SAC3 domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
SAC3D13.263e-2624.16SAC3 domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
SAC3D11.533e-1233.64SAC3 domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F20D12.27.022e-4932.38pep chromosome:WBcel235:IV:7948643:7953548:1 gene:... [more]
F20D12.27.022e-4932.38pep chromosome:WBcel235:IV:7948674:7953548:1 gene:... [more]
tag-1151.899e-1426.00pep chromosome:WBcel235:IV:13237282:13239441:-1 ge... [more]
tag-1151.899e-1426.00pep chromosome:WBcel235:IV:13237281:13239414:-1 ge... [more]
hpo-101.358e-1325.00pep chromosome:WBcel235:III:5879845:5882428:1 gene... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
xmas2.019e-5535.17gene:FBgn0286809 transcript:FBtr0474622[more]
xmas2.049e-5534.46gene:FBgn0286809 transcript:FBtr0474624[more]
CG34371.851e-1724.09gene:FBgn0035998 transcript:FBtr0301032[more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm3ap1.867e-7637.32minichromosome maintenance complex component 3 ass... [more]
mcm3ap2.712e-7537.35minichromosome maintenance complex component 3 ass... [more]
si:zfos-452g4.15.702e-2825.46si:zfos-452g4.1 [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
si:zfos-452g4.11.991e-1730.36si:zfos-452g4.1 [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
leng86.268e-1021.14leukocyte receptor cluster (LRC) member 8 [Source:... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube3b2.632e-7539.90ubiquitin protein ligase E3B [Source:Xenbase;Acc:X... [more]
ube3b3.775e-7539.90ubiquitin protein ligase E3B [Source:Xenbase;Acc:X... [more]
ube3b8.890e-7539.90ubiquitin protein ligase E3B [Source:Xenbase;Acc:X... [more]
ube3b1.107e-7439.90ubiquitin protein ligase E3B [Source:Xenbase;Acc:X... [more]
ube3b1.117e-7439.90ubiquitin protein ligase E3B [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mcm3ap1.524e-7638.81minichromosome maintenance complex component 3 ass... [more]
Mcm3ap9.568e-1956.72minichromosome maintenance complex component 3 ass... [more]
Sac3d11.230e-1325.67SAC3 domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Leng81.176e-623.73leukocyte receptor cluster (LRC) member 8 [Source:... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WUU9|GANP_MOUSE1.066e-7538.81Germinal-center associated nuclear protein OS=Mus ... [more]
sp|O60318|GANP_HUMAN2.837e-7438.71Germinal-center associated nuclear protein OS=Homo... [more]
sp|Q9U3V9|XMAS2_DROME2.024e-5435.17Protein xmas-2 OS=Drosophila melanogaster OX=7227 ... [more]
sp|O74889|SAC31_SCHPO7.147e-4030.47SAC3 family protein 1 OS=Schizosaccharomyces pombe... [more]
sp|F4JAU2|SAC3B_ARATH1.032e-3030.42SAC3 family protein B OS=Arabidopsis thaliana OX=3... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3ESF52.370e-7942.78Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068YAT22.977e-7937.6380 kDa MCM3 associated protein OS=Echinococcus mul... [more]
A0A443S6585.028e-7942.20SAC3 / GANP domain containing protein-like protein... [more]
W6UTE36.222e-7938.76MCM3-associated protein OS=Echinococcus granulosus... [more]
A0A068W7C47.037e-7938.7680 kDa MCM3 associated protein OS=Echinococcus gra... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mcm3ap3.890e-7637.76minichromosome maintenance complex component 3 ass... [more]
si:zfos-452g4.11.081e-3026.48SAC3 domain containing 1 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000034136.12.650e-620.14leukocyte receptor cluster member 8 [Source:NCBI g... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007904.11.206e-7735.31pep scaffold:Pmarinus_7.0:GL480340:6186:21414:1 ge... [more]
si:zfos-452g4.12.517e-3026.58si:zfos-452g4.1 [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC35.756e-2525.92mRNA export factor; required for biogenesis of the... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO315331.046e-7541.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343673.293e-2633.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482845.409e-925.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283186.680e-734.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mcm3ap3.675e-7838.71minichromosome maintenance complex component 3 ass... [more]
si:zfos-452g4.15.961e-3330.00SAC3 domain containing 1 [Source:NCBI gene;Acc:101... [more]
si:zfos-452g4.14.485e-3029.25SAC3 domain containing 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Germinal-center associated nuclear protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008313.10.000e+099.28SMESG000008313.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029685 ID=SMED30029685|Name=Germinal-center associated nuclear protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3973bp
AATTTTCTTACTTAAATTACAAAATATTTTACTAAAATTCAAAATCTTTA
CTCATTTATATTAGTATATTTTAAAGTATTTCTTAAAAGTTTTATATTCA
CTTTCGATGAATTATAAAAATTCCTATTCACGTACGGATCAAACGAAAAA
AACATTTTCTTTGAATAAGAATAAAGATTTATTTCCCAGAAATTCATATA
AACGGAAAGCTGATTTTAATATATCCGATAATGATAATGATGATATCAAA
TTGCCAGAAAATAAAATTGCTTATCGTTTAACATCTAATAAAAATTTTTC
AAAAATAAGAAATTTTAAAACTTTCAAGCCAAATATAAGCATTACCAAGA
AATTTTATCCTAATCTTCAAGATAAATTCGAATTATTGGAAAAATTAGAT
AATGTTGATGAGATTAAAGAAAAAAATTTGCGACTAGATCGTCCAATGAT
TGCTGGTACTTGTCAGGATATGTGTCCTGAAAAAGAAAGATATTCTCGTG
AATATAAAAATTTTATTTCCGTATTCGAAAAAAACGGTAAAACTTTTGAT
AGCCGTAAAGCAGTGAAAGAATATGATCGATGTGTTGCCGATCAAAAAGA
ATCGCTTCCTCACCATCTTCGTCCAACTGATGTTTTACAGCGTACAATGA
ATTATTTATTAACGGAAATTGTTGATCAATACGATGATAATGTTTCACGC
GGACAATGGTATACGTTTCTTTGGAACAGAACCCGATCGATAAAAAAAGA
TATAACCCAACAAAATCTATGCAACGAAACCATTGTCAACATAATCGAAC
AGATCGCACGATTCCATATATTCTGCAGCGCCTGGCTTTGTGAGGATCAA
AAAGATGTATTTGAGCCAAAATTAAACGAGGAAAACCTGAAAAATTGTCT
GCAAACCTTGAAAGACATGTATAGCGATCTGCCGCCGGACAGTTGCGCAA
ATGAGCCGGAATTCAGGAGTTATATGATGGTTTTGAATCTCGACAAAGGG
GAAATGCTCGATGAGGCTCAAAAGCTTACCAGTGGAGTTTTCAATTCACC
GAAGTTGAGTTTTGTCATTAATGTCTACCAGGCGATTCTGACGAATAATT
ACGTTCGATTCTTTCGACTTTTGGAGCAATCTGATTTGATACTGAGCTGT
CTGTTGCATAGGTTCATCGCTCCAATGAGATTCAGGGCATTTGAGGTGTA
CAATAAGGCCTATGTGACTACCAAATCTTTCGAGACCAAAGCCAATCAGA
TTCCGCTTAGTACAATTTCCCGACAAGTGAAATTCGATGATATTGAGCAA
GCTCTGGAATTTTGCCGTTCCGTAAATCAAGAAATTGTCGGCCAATCAGA
TAACATTATGATTGTGTTGAATTATTCCAAATTAAATTTCAGTGAAGTTT
CTCCGAAAATATCACGCTCGCTAGTACAAAGCAAGCGAGACAATCAAAAG
CTATCAACAATATTTAATGGCGGCCAATCAGTAACTGGAATCGATAACGA
GTTGCCAGAATGCCGAATGGTCTCATTTGACGACAACGGGAGTTACACCG
GGACAAGACCAATCCCACAGAATTTGGCCGCTCCATCTAAGCCAATACCA
GACCAGGCTGAAGTGGAAGTGATTTCTATTGAAAGTTCCGAAGAGGAATT
CTCGAGATCATCTCCAGTTTCCAGCACAAATGAAAACGTATCATTGGATA
ATTTCCCAGTGAAAGAAGATAAACCCGAAACGAGTAACATATTCCGCCAA
TCGGCTGCCACTATTGGTTATGAACCAAACAAGCTCAACAATCTGTTCAG
CAAGCCCACAACTGGATCTGTTGGATTATTTGGCTTATTCTCAAACAATC
AAAAGCCACTAAACGAAGCCGGGGGAATATTTCATCAATCGAAACCCACA
CTGCTATTTAGTGATTTACAACCCGCCGCCGCGGGTTGTGATCTTTTTCA
GAAACCGACAAATCCTAATCAATTCCAGTCGATTGCGGACGCACAGCAGC
ACCCAGGCGGGTTATCGGAACGCCTAGCGCAATTTATGGAAAGAAATATT
CCTCAGTCCACTCCGGAACCAATCAGCAAACTGCCTCTATTCACCCCAGC
CGAGTTACATGACATTTCCAAAACAATATCGGAAAACTTGCTGACGGAAT
TTGTTTCCATTGGCTGCCGTAAAGAAATCGAAATTTCTATAAGTTCCGAA
AAAAGAAACCAAGTGGAAATCGAGAGAATATTCAGCGGTATCCTAGGCAA
CACAATCAAGCACGCCGTAACCGAGTCCGTTGGCAATCATAATGCCAACA
GGAAAGCCGTCATAAACTCGATTGCCGAGGATTTCATTGCGGAAATTGTG
GGAAACGAGACCGAAATTACGATATCATATGTGGAGAAGAAGAAAATGGA
CAAAGATAAAATGTTTAAATTTTATCGGAAGAAATTATTTTTCCAGCGCT
GGCAACGCCATTGCAGGAATCTCGTAAATTCGCGGAAATGTTTATCGAAT
TTGCGAGCGGCTCCGAGAATGAAAACCGATTTCGCTGTTTGCCAGGAGTT
CCGCGGCAAAGTACGAAAGGTGAACACGGATTGGTTTGTAAGGAGAGGAG
GAGGAGGCGATTGGAGCAAGCGGCCGATAACATCGAGATTAGATCAGCTG
ACCGGCGGGGGCTGCAATCCCCCTGTAATCGTCACCGATACTCACAGCAC
TGATTGCCAGACACTCGTCTCATATTTCAACGTCTCATCGATGAAACTCC
AGCAATTCATTCTGGATTTTGTCAAATACAGATATATCAATGTTCTCGAT
CGTCTGCTGGCGAGTTTGGAGTTCTCTAATCGAGTGCATCCGGCTCTAGA
AGTTTTAATTTCCGATTACAACGCAACTATAAACGAGATGGAGAAAATTG
TCCAATCAAAATCCATTGAATTTATTGATTTTTCCAGTTATATTTTACCC
GTAATCACTATCCAAAAAACCGATAATGACCAAAAATTCAGCAAGCAATA
TATCGATCAACTTTTCCAAAAATTACACATTTCACAGAATCAGAGGAAAT
TCTATTTCTGCAAGGCGGCTGAATATTTCCGCAACCTGGACGGAAATGTT
GAGCTGGTGGACTTGTCGTATTTCCATTTGCGGCTGTTTCCATGGATAAA
TGTCATGAAGCACTCGGTGTCAAATAGACTGGAGAAATCAATGAAATCGG
TGCCCAATCGGCAAATCGAAATCGATAAATCCGTATTTTCTCCGGTGAAA
TTGCTGCAATCAGAATTTGTTTTGAATGAGATTTCTGTGCAATTCTGTGT
AGGTAAGTTGATAAAGGAGCCGGAAGTGAGTACAACAGTTCAATTGAAGA
CTCCGAAAAGAACTCGATATTTCAATGATTTGTGCAACGGAATTAATCAG
CTCACCAAGAAATTAGATGAATTCAAAAAAAATTTTTAATAAATTGTTAT
TTTCTTTTGTTTGATGATTTTAATTCAAATTTATGCGTGAGTATGTGTTA
TCGTATTAATAAAATAAATCAACATTTCATGCTATGACCGATCAATTTTC
TTTCAGAATTTGTCACCTCCAGACCACTCCATTGTAGATTTATCTAAAAA
GCTAAAAAGGGATCATTTTTATATATGTAACCATGGAAACTATATAGTTG
CAACGGTTCCCGATAATTTTTTTTTGTAGGTCATGAAAGTAGTTCATAGA
CGCAGACTCACCTAGAAAATATGTCACCTTCAGGTCAGCCTATAACATGT
ATGTTATATAGATTTATTAACTAACTAGGTTACGACTATATAGTATATTT
TTCTAAAAAGCTAAAAACGAGGATTTTTTTATAGGTCACATTACCATGGA
AACCATATAGTTGTCAAACTTTTGATTTTTACAATTTTCATAGGTTTTCA
TGTATTTCGTAAAAGTAGCTCATAGACATGCACTCGTCTAAAAAATATGT
CACCTCCAGGACAGTCAAGATCG
back to top

protein sequence of SMED30029685-orf-1

>SMED30029685-orf-1 ID=SMED30029685-orf-1|Name=SMED30029685-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1111bp
MNYKNSYSRTDQTKKTFSLNKNKDLFPRNSYKRKADFNISDNDNDDIKLP
ENKIAYRLTSNKNFSKIRNFKTFKPNISITKKFYPNLQDKFELLEKLDNV
DEIKEKNLRLDRPMIAGTCQDMCPEKERYSREYKNFISVFEKNGKTFDSR
KAVKEYDRCVADQKESLPHHLRPTDVLQRTMNYLLTEIVDQYDDNVSRGQ
WYTFLWNRTRSIKKDITQQNLCNETIVNIIEQIARFHIFCSAWLCEDQKD
VFEPKLNEENLKNCLQTLKDMYSDLPPDSCANEPEFRSYMMVLNLDKGEM
LDEAQKLTSGVFNSPKLSFVINVYQAILTNNYVRFFRLLEQSDLILSCLL
HRFIAPMRFRAFEVYNKAYVTTKSFETKANQIPLSTISRQVKFDDIEQAL
EFCRSVNQEIVGQSDNIMIVLNYSKLNFSEVSPKISRSLVQSKRDNQKLS
TIFNGGQSVTGIDNELPECRMVSFDDNGSYTGTRPIPQNLAAPSKPIPDQ
AEVEVISIESSEEEFSRSSPVSSTNENVSLDNFPVKEDKPETSNIFRQSA
ATIGYEPNKLNNLFSKPTTGSVGLFGLFSNNQKPLNEAGGIFHQSKPTLL
FSDLQPAAAGCDLFQKPTNPNQFQSIADAQQHPGGLSERLAQFMERNIPQ
STPEPISKLPLFTPAELHDISKTISENLLTEFVSIGCRKEIEISISSEKR
NQVEIERIFSGILGNTIKHAVTESVGNHNANRKAVINSIAEDFIAEIVGN
ETEITISYVEKKKMDKDKMFKFYRKKLFFQRWQRHCRNLVNSRKCLSNLR
AAPRMKTDFAVCQEFRGKVRKVNTDWFVRRGGGGDWSKRPITSRLDQLTG
GGCNPPVIVTDTHSTDCQTLVSYFNVSSMKLQQFILDFVKYRYINVLDRL
LASLEFSNRVHPALEVLISDYNATINEMEKIVQSKSIEFIDFSSYILPVI
TIQKTDNDQKFSKQYIDQLFQKLHISQNQRKFYFCKAAEYFRNLDGNVEL
VDLSYFHLRLFPWINVMKHSVSNRLEKSMKSVPNRQIEIDKSVFSPVKLL
QSEFVLNEISVQFCVGKLIKEPEVSTTVQLKTPKRTRYFNDLCNGINQLT
KKLDEFKKNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000717PCI_dom
IPR005062SAC3/GANP/THP3
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.25.40.990coord: 165..468
e-value: 2.6E-78
score: 265.7
NoneNo IPR availablePANTHERPTHR1243680 KDA MCM3-ASSOCIATED PROTEINcoord: 92..523
NoneNo IPR availablePANTHERPTHR12436:SF3GERMINAL-CENTER ASSOCIATED NUCLEAR PROTEINcoord: 92..523
IPR005062SAC3/GANP/THP3PFAMPF03399SAC3_GANPcoord: 117..409
e-value: 2.5E-94
score: 316.0
IPR000717Proteasome component (PCI) domainPROSITEPS50250PCIcoord: 256..433
score: 13.348