SMED30029683

Overview
NameSMED30029683
Smed IDSMED30029683
Length (bp)9372
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30029683 (SMED30029683) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30029683 (SMED30029683) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30029683 (SMED30029683) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30029683 (SMED30029683) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029683

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v4_3814_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v4_3814_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v4_3814_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v4_3814_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v4_3814_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v4_3814_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v4_3814_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v4_3814_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029683SMESG000027342.1 dd_Smed_v4_3814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029683SMESG000027342.1 SMESG000023213.1 SMESG000023211.1 dd_3814dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30029683SMESG000023213.1 SMESG000023211.1 dd_Smed_v6_3814_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30029683SMESG000023211.1 Contig14695newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30029683SMESG000023211.1 Contig14695newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30029683SMESG000023211.1 Contig14695uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30029683SMESG000023211.1 Contig14695uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30029683SMESG000027342.1 dd_Smed_v4_3814_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30029683 vs. Ensembl Human
Match: ITPR3 (inositol 1,4,5-trisphosphate receptor type 3 [Source:HGNC Symbol;Acc:HGNC:6182])

HSP 1 Score: 213.772 bits (543), Expect = 2.962e-54
Identity = 344/1569 (21.92%), Postives = 650/1569 (41.43%), Query Frame = -3
Query: 4889 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIED-ENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN-------------------------------VILVKESRDPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALK---DKEYKR------QQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIA-GIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKV------------HL--ECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL-------TERGQNIHEQPNILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKD-----LVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID---------------GSRDLPFPPERQGKELSK---EKKKIV----------QKYQQGDRY-LQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSD-------------------------------------EQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDH--VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH-------------YLTQYILESPHELVYYLLTKPFPKH---LKTHLT 9013
            IGD + LY E + +G++   ST    ++  +         N P    D     F++   NRY   K+Y +     +D E + D     L  + + AA+ E   N  E ++     V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ +   I P +K++S G+ V + D++IL  + + G   HAS  + L +     E+N     + + I       D  E  ++GG  V+LFH E E ++       D    ++ + +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA +E  +                               ++ V    D  ++F+L P  +Q ++  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A  ++K+         FI+     F+  LLED +   F  +     V    + + + M+   K  + RQKL+R   ++  +  +L  P   +  E   +++            H+   CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L      + +        E  Q+ HE  +I Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I++ L     +  FL +  E+LP D+RA +C +++ + VD  +   +V   + + ++  + T    K   S+  A++D            + D++   + E      +  E N L  +V+ L + L+ FG+Y    ++  L   L+G+ID               G +++    +  G  +S     +K+ V             +  DR   +  E   ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + + +       +G  P     +A      + ++   MF   + ++ +++D         +LI+L  + YA +   AL++L   +S +Q+      +  +L++      ++ +  ++  LR M +    W D                                     E    ++ I   L + C +    E+     QR+L + +   V++++L +   + D+++ E    T + L+K            P  Q  + ++L + L   L+E+E   T++ +F+NN  LC +I    +   V L A H +   ++LD L  ++K E  G  +K+ Q ++M  +  +           +S A++L+     R+ V      EDH  + Y ISL++LL+ CAEG+N Y E  C ++L +ED+++V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++               L +Y+L    + +    + PF ++   L+TH T
Sbjct:   10 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADV---VLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNA-GQPLHAS-NYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTC-----DEYKGKLQVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRTGRRNAGEKIKYCLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNE------GFISQNDRRFVIQLLEDLV---FFVSD----VPNNGQNVLDIMVT--KPNRERQKLMREQNILKQVFGILKAPFREKGGEGPLVRLEELSDQKNAPYQHMFRLCYRVL-RHSQEDYRKNQEHIAKQFGMMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIRTELRPVKEMAQS-HEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGV---DLIFLCMADEMLPFDLRASFCHLMLHVHVD-RDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDYLNNVVSEAVPF--ANEEKNKLTFEVVSLAHNLIYFGFYS-FSELLRLTRTLLGIIDCVQGPPAMLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDSGA-------DGTAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVEAGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGV---GEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGN-------PGNQALLHKHLHLFLTPGLLEAE---TMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHV-QYLDFLHTVIKAE--GKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGV------EDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQT 1496          

HSP 2 Score: 133.265 bits (334), Expect = 6.354e-30
Identity = 134/566 (23.67%), Postives = 249/566 (43.99%), Query Frame = -3
Query: 1007 IREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHN---VLCGFLLFTYFLADHPSPPRI------QYYFILIKRRLK-QNELDPADEDIIQQ---GDEGCKMRSH---LISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR-----------------------------------------SGFNTEKNL-----------YCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEK 2476
            + EE K  +    ++    +K+ DF D S  + N++ +Q+K  + P+  +F+    LW                        GS   +FN++ + N +  FF        P  E   + +    L+     +L  F +   F   +   P I        Y++ I   L     L+  ++ +      G+ G  +R +   ++  +  Y+   +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +                                         SG +  + L            CD+L  C V+VM  GL     VGD+     P   E     F   V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I  L   L +   L++H  ++ +E K   E + ++R +++  GF+  +  + +
Sbjct: 2147 LTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLW------------------------GSI--SFNLAVFINIIIAFFY-------PYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDRELDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRK--PSKDES---LFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLTAQLNELK---EQMTEQRKRRQRLGFVDVQNCISR 2671          
BLAST of SMED30029683 vs. Ensembl Human
Match: ITPR3 (inositol 1,4,5-trisphosphate receptor type 3 [Source:HGNC Symbol;Acc:HGNC:6182])

HSP 1 Score: 213.772 bits (543), Expect = 2.962e-54
Identity = 344/1569 (21.92%), Postives = 650/1569 (41.43%), Query Frame = -3
Query: 4889 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIED-ENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN-------------------------------VILVKESRDPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALK---DKEYKR------QQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIA-GIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKV------------HL--ECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL-------TERGQNIHEQPNILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKD-----LVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID---------------GSRDLPFPPERQGKELSK---EKKKIV----------QKYQQGDRY-LQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSD-------------------------------------EQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDH--VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH-------------YLTQYILESPHELVYYLLTKPFPKH---LKTHLT 9013
            IGD + LY E + +G++   ST    ++  +         N P    D     F++   NRY   K+Y +     +D E + D     L  + + AA+ E   N  E ++     V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ +   I P +K++S G+ V + D++IL  + + G   HAS  + L +     E+N     + + I       D  E  ++GG  V+LFH E E ++       D    ++ + +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA +E  +                               ++ V    D  ++F+L P  +Q ++  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A  ++K+         FI+     F+  LLED +   F  +     V    + + + M+   K  + RQKL+R   ++  +  +L  P   +  E   +++            H+   CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L      + +        E  Q+ HE  +I Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I++ L     +  FL +  E+LP D+RA +C +++ + VD  +   +V   + + ++  + T    K   S+  A++D            + D++   + E      +  E N L  +V+ L + L+ FG+Y    ++  L   L+G+ID               G +++    +  G  +S     +K+ V             +  DR   +  E   ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + + +       +G  P     +A      + ++   MF   + ++ +++D         +LI+L  + YA +   AL++L   +S +Q+      +  +L++      ++ +  ++  LR M +    W D                                     E    ++ I   L + C +    E+     QR+L + +   V++++L +   + D+++ E    T + L+K            P  Q  + ++L + L   L+E+E   T++ +F+NN  LC +I    +   V L A H +   ++LD L  ++K E  G  +K+ Q ++M  +  +           +S A++L+     R+ V      EDH  + Y ISL++LL+ CAEG+N Y E  C ++L +ED+++V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++               L +Y+L    + +    + PF ++   L+TH T
Sbjct:   10 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADV---VLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNA-GQPLHAS-NYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTC-----DEYKGKLQVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRTGRRNAGEKIKYCLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNE------GFISQNDRRFVIQLLEDLV---FFVSD----VPNNGQNVLDIMVT--KPNRERQKLMREQNILKQVFGILKAPFREKGGEGPLVRLEELSDQKNAPYQHMFRLCYRVL-RHSQEDYRKNQEHIAKQFGMMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIRTELRPVKEMAQS-HEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGV---DLIFLCMADEMLPFDLRASFCHLMLHVHVD-RDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDYLNNVVSEAVPF--ANEEKNKLTFEVVSLAHNLIYFGFYS-FSELLRLTRTLLGIIDCVQGPPAMLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDSGA-------DGTAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVEAGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGV---GEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGN-------PGNQALLHKHLHLFLTPGLLEAE---TMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHV-QYLDFLHTVIKAE--GKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGV------EDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQT 1496          

HSP 2 Score: 133.265 bits (334), Expect = 6.354e-30
Identity = 134/566 (23.67%), Postives = 249/566 (43.99%), Query Frame = -3
Query: 1007 IREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHN---VLCGFLLFTYFLADHPSPPRI------QYYFILIKRRLK-QNELDPADEDIIQQ---GDEGCKMRSH---LISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR-----------------------------------------SGFNTEKNL-----------YCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEK 2476
            + EE K  +    ++    +K+ DF D S  + N++ +Q+K  + P+  +F+    LW                        GS   +FN++ + N +  FF        P  E   + +    L+     +L  F +   F   +   P I        Y++ I   L     L+  ++ +      G+ G  +R +   ++  +  Y+   +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +                                         SG +  + L            CD+L  C V+VM  GL     VGD+     P   E     F   V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I  L   L +   L++H  ++ +E K   E + ++R +++  GF+  +  + +
Sbjct: 2147 LTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLW------------------------GSI--SFNLAVFINIIIAFFY-------PYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDRELDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRK--PSKDES---LFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLTAQLNELK---EQMTEQRKRRQRLGFVDVQNCISR 2671          
BLAST of SMED30029683 vs. Ensembl Human
Match: ITPR2 (inositol 1,4,5-trisphosphate receptor type 2 [Source:HGNC Symbol;Acc:HGNC:6181])

HSP 1 Score: 207.223 bits (526), Expect = 2.654e-52
Identity = 345/1530 (22.55%), Postives = 612/1530 (40.00%), Query Frame = -3
Query: 4997 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAV----------DEESNV----------------------ILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK-----DKE----YKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVH--------------LECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHE----QPNILYVSTDCMKSWI------------ALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE--NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG---------------DV--DDVRSLLDKLIGLIDGSRDLPFPPERQGKELSK--------------EKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMA----KFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELRE-MFENTTQ---VKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--W------------SDEQVNRME------NIFSE------------------------LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSS--------AAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNL 9013
            IGD + LY E + +G++   ST    ++  + H +     N P    D     F++   NRY   K+Y  K    +  N  +A    L  + + AAE E   N +E ++   + V+Y  VIQL  + S+KY+ VN    +  +KN M VSL+   ++ + F I P +K++SEG+ + + D+++L  + + G   HAS    LDN     E+N     + + I     +    E  ++GG  V+LFH E E ++       D   ++ H+ +R   + +A T  TS+ A+  W+IE        G    W+  FRF+H  T  YLA           +E  NV                      + V    D  ++F+L        +  V   SY R+ H+ +  W+ +       D+E     K     T ED+ +   +     E+R +D  +D     A T++K+                F+  LLED +   F  A     V    +E+ + ++   K  + RQKL+R   ++  +  +L  P   +  E + L++                 CY +L  +     RKN  Y AK   + ++Q+       +     I  L+ +NRK++++ I+  +I  FV  LR N   R+L+ L  LCV N   I   Q  I +  L      + +  +  ++      + +IL    D  + W+            A+    Q    G   D E + +   QL+LF  +C  R    I  I+  LS    +     +  E LP D+RA +C +++ + VD     SVV         + P +  ++EY    D ++          D+   F    +++  +L E  N        E N L  +V+ L   L+ FG+Y                D+    + S  ++L    DG  ++       G+ +++              +    +   +QG       E   +++ K   +E+LQ IL+   + R++  ++    +F E   N       +P +L              PSA+      I    E MF    +   V++D         +LI+L  + Y  +   AL++L   +S + +  QA  +  +L++      ++++   +  LR+  +    W             + QV   E      NI S                         LI    L    ++    +QR+L +     VV+++L +   + D ++ E       V+  A   L+      P  Q  + ++L++ L   L+E+E   T++ +F+NN +LC +I  R +   V     H +   E+L  L  IVK +  G  +K+ Q +VM  ++             A++ +   M   E    +E G   + Y I+L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ ++   Y+      +E    EI     IW+   N 
Sbjct:   11 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVHPEAGDLANPPKKFRD---CLFKVCPMNRYSAQKQYW-KAKQAKQGNHTEA---ALLKKLQHAAELEQKQNESENKKLLGEIVKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKVVLMPVNA-GQPLHASNIELLDN-PGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVVRLFHAEQEKFLTC-----DEYEKKQHIFLRTTLRQSA-TSATSSKAL--WEIEVVHHDPCRGGAGQWNSLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKIMYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKL-----ENGTITQNERRFVTKLLEDLI---FFVAD----VPNNGQEVLDVVIT--KPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQRYAPYKYMLRLCYRVL-RHSQQDYRKNQEYIAKNFCVMQSQI----GYDILAEDTITALLHNNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSV---DLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRN---------DMKRKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSP--TEHEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLL-------------PSAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGEIGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNE-------VMNLAHTFLQNFCRGNPQNQVLLHKHLNLFLTPGLLEAE---TMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHV-EYLRFLQTIVKAD--GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGP--LAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYV-----DTEVEMKEIYTSNHIWKLFENF 1454          

HSP 2 Score: 177.178 bits (448), Expect = 3.801e-43
Identity = 143/582 (24.57%), Postives = 259/582 (44.50%), Query Frame = -3
Query: 1025 KAFKFYKKNSVSIELLKGD-YLQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDG---SFDENFNI-----SKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF-------------------------------------------NTEKNLY-------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 2575
            +A K+Y  ++  IE+++ D  ++++ F + N    +  E K  V    +R    +K+ DF   ++ + N++++QKK  NNP   +F+    LW      L+V +NL +   +    DG   +    F++          S+  FF  PV         ++ ++ +  L      G       L       +I +    +  R                G      R+ ++     Y+ A +   + G +   +F++F L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++IIGF F +  F                                           NT    Y       CD+L  C V+V+  GL     VGD+     P   E     F+  V+Y L F+ ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+ +EHNMW Y++F + ++     +YT  + +VA ++ E+  D+FP  RA+ L + + DS  ++I  L + + + ++  K    +    +E + ++R  K+  GFL +
Sbjct: 2137 EALKYYANHTAQIEIVRHDRTMEQIVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFFSKPV--------GIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNR----------------GTFTRGYRAVILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRR--PSKDEP---LFAARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGS 2689          
BLAST of SMED30029683 vs. Ensembl Human
Match: ITPR1 (inositol 1,4,5-trisphosphate receptor type 1 [Source:HGNC Symbol;Acc:HGNC:6180])

HSP 1 Score: 160.614 bits (405), Expect = 3.030e-39
Identity = 95/360 (26.39%), Postives = 171/360 (47.50%), Query Frame = -3
Query: 1025 RSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTE-----------------------------------------------------KNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 1930
            R+ ++  +  Y+   L     G +   +F++  L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++I+G+ FF+  F  E                                                     K   C++L  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+ F + ++   + +YT  + +VA ++KE+  D+FP  RA+ L + D +   +++  L + + + +    +   +    ++ + ++R QK+  G L +
Sbjct:  355 RAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGH 709          

HSP 2 Score: 106.686 bits (265), Expect = 3.052e-22
Identity = 95/327 (29.05%), Postives = 156/327 (47.71%), Query Frame = -3
Query: 8048 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVD 9013
            IGD   LY E  T+G++   ST    ++  +   +     N P    D     F++   NRY   K++  K A     +  DA    L ++   AA+ E   N  E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  +  ++GG  V+LFH E E ++       D   ++ H+ +R   + +A T  TS+ A+  W++E  +     G    W+  FRF+H  T  YLA +
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPETGDLNNPPKKFRD---CLFKLCPMNRYSAQKQFW-KAAKPGANSTTDA---VLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVVRLFHAEQEKFLTC-----DEHRKKQHVFLRTTGRQSA-TSATSSKAL--WEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAE 317          
BLAST of SMED30029683 vs. Ensembl Human
Match: ITPR1 (inositol 1,4,5-trisphosphate receptor type 1 [Source:HGNC Symbol;Acc:HGNC:6180])

HSP 1 Score: 161.77 bits (408), Expect = 1.024e-38
Identity = 95/360 (26.39%), Postives = 171/360 (47.50%), Query Frame = -3
Query: 1025 RSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTE-----------------------------------------------------KNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 1930
            R+ ++  +  Y+   L     G +   +F++  L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++I+G+ FF+  F  E                                                     K   C++L  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+ F + ++   + +YT  + +VA ++KE+  D+FP  RA+ L + D +   +++  L + + + +    +   +    ++ + ++R QK+  G L +
Sbjct: 1182 RAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGH 1536          

HSP 2 Score: 71.2478 bits (173), Expect = 4.097e-11
Identity = 67/265 (25.28%), Postives = 118/265 (44.53%), Query Frame = -3
Query: 4898 QNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPFPKHLKT 5617
            QNQ  + +++++ L   ++E   A+T++ +F+NN  LC +I  R +   V     H +   +++  L  IVK EG    +K+ Q +VM  ++ S       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L +Y+ E    +V    + PF     T
Sbjct:   38 QNQALLHKHINLFLNPGILE---AVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNV-QYIKFLQTIVKAEGK--FIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDEN---SPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYV-----DTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT 288          
BLAST of SMED30029683 vs. Ensembl Celegans
Match: itr-1 (Inositol 1,4,5-trisphosphate receptor itr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y0A1])

HSP 1 Score: 150.599 bits (379), Expect = 1.547e-35
Identity = 89/334 (26.65%), Postives = 163/334 (48.80%), Query Frame = -3
Query: 1076 SHLISSKTFYYFAILGF-SLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR-------------------SGFNTE----------------------KNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEE 1927
            + +++ +  +Y  +  F  + G    P  +   L +I+   + LQ VI++VT+N +S++W  +L ++++Y ++I+GF +FR                   SG  +E                      K   C++LW C +     GL     +GD+  N  P +       F   V Y ++FF+++  I LN+IFG+I+DTF +LR  K   E  +++ CFIC  +   F++    FE H   EHN+W Y+++ + LQ     ++T  + +VA  +K++  D+FP  +AL L   + D+  S++ ++   L  + TL+    S++ E + F E
Sbjct: 2524 AEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSIVWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPAPWED-----MFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEVKQMKDQLLQMMTLMREIISQNEESRAFME 2852          

HSP 2 Score: 115.546 bits (288), Expect = 6.374e-25
Identity = 207/952 (21.74%), Postives = 374/952 (39.29%), Query Frame = -3
Query: 6533 IGDFICLYCE-----ETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIE-DENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIIL----ESIKSPGHF---FHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEP-FVRGGQFVQLFHKEMEAYIVAEGLF-DDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILVKESRDPRTVF------KLHPVIQDSEE-----------VTFESYARIEHVLSGNWLHAL-----------------------KDKEYKRQQF--------------STTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRV-------CMAFREIKEFMLVNGKSV------KARQKLLRNLRVIDLLVKLLNM------------PLYGQPDEAN------FLKVHLECYDILYTYMIGSSRKNALYFA-KYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKV-QINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGY-----DDEKVQFLLAQLDLFNAICYGRNEYCI-----RLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDH-------PERSFV--YEYVGTK---DQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG 9013
            IGD I LY E     E  G+   +ST    ++  I   +D    S     +   F++   NRY   K    +    +  +++ D D   L ++ K AA+ E  +N +E ++     ++YG ++QL  V S+KYI V     +++++N M V L+   ++ + F I P YK  + G+ V   ++I L     S    GH     H S  F L +    +E+N   E + + +   +  FDE++   V+ G  V+LFH + + ++  + +   +  T+ V LR+      N  +   + S+   W+++  + +   G    W++ +RF+H  T MYL+   E + + VK + + R         K  P+++ +             VT ES    +  +   W+                           +KE  R+ +              +   +++++H    +     KV C  +R   + + +  V P+  R  +F       LRN ++  +K   + +KE+          C+ F       L +   +      + RQKLLR   V++ +  LL              PL   P E +      F  +   CY  L  Y   S RKN  + A K+ E+ E    D     L     +  ++ +N K++++  K   + +FVE +R N   ++L+ L  LCVC G      Q  I    L    R +++  +            +  +    W    + L     G      D E + +   QLDL + +C  +    I     R +      L  E     +    LP D+R  +  +++ L V  G+  S + H       PE   V  YE V  +   D ++    +  A K L T+   L       ++E   + +SK+ +     +++ L   L +F +Y 
Sbjct:   39 IGDIISLYTESSSNQEQRGF---LSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTGDSMFDDD---LMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLS-SFNLLDHQSAAEVNCLNEPTEWQVFM-FLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMT-----NRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHLATDMYLSA--EPSQVQVKPAMNGRPPLLSALSQKSRPMLERTNNPMAMYSDGPNGVTNESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEKGWVKVICEKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIK-LIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISDFSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCY-CLLKYSQVSYRKNQEFLAEKFGEIQEQIGFD-----LMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSSKHRDIFMDTK-----------IIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLMNISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTY-----EIVNLAKALAQFNFYS 952          

HSP 3 Score: 54.6842 bits (130), Expect = 1.623e-6
Identity = 73/302 (24.17%), Postives = 136/302 (45.03%), Query Frame = -3
Query: 4976 LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENL-------DMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAA--YILEQPMETREAVLKEEL--------GEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYL 5830
            L   C+    P+ P  MNQ++L +  V  VV+E +SV  D +         K++  + + L++      + Q+++++ +       + +LRV+ +E     TL  +F NN+ L   +    I  IV L  EH  + P FL+LL A+V V      ++  Q  V   I  +       Y+     E  EA++K+E             ++Y I L+ LL+ C  G+N   E  C + + ++ I+ V+   +    +K  +L+ L+  Y+      +++   +  K + +   + NL E+I  L
Sbjct: 1278 LTGMCYRKGDPK-PDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDMM---KLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEE--VGTLVAIFRNNRELASNVPEELIAHIVGLI-EHNSRNPIFLELLQALVCV--YDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMMKDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYI-----DTDAEMKDAYKTEYVDHILNNLLEDIRSL 1565          
BLAST of SMED30029683 vs. Ensembl Celegans
Match: itr-1 (Inositol 1,4,5-trisphosphate receptor itr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y0A1])

HSP 1 Score: 150.599 bits (379), Expect = 1.685e-35
Identity = 89/334 (26.65%), Postives = 163/334 (48.80%), Query Frame = -3
Query: 1076 SHLISSKTFYYFAILGF-SLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR-------------------SGFNTE----------------------KNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEE 1927
            + +++ +  +Y  +  F  + G    P  +   L +I+   + LQ VI++VT+N +S++W  +L ++++Y ++I+GF +FR                   SG  +E                      K   C++LW C +     GL     +GD+  N  P +       F   V Y ++FF+++  I LN+IFG+I+DTF +LR  K   E  +++ CFIC  +   F++    FE H   EHN+W Y+++ + LQ     ++T  + +VA  +K++  D+FP  +AL L   + D+  S++ ++   L  + TL+    S++ E + F E
Sbjct: 2534 AEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSIVWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPAPWED-----MFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEVKQMKDQLLQMMTLMREIISQNEESRAFME 2862          

HSP 2 Score: 127.872 bits (320), Expect = 1.233e-28
Identity = 212/952 (22.27%), Postives = 374/952 (39.29%), Query Frame = -3
Query: 6533 IGDFICLYCE-----ETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIE-DENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIIL----ESIKSPGHF---FHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEP-FVRGGQFVQLFHKEMEAYIVAEGLF-DDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVD-------------------EESNVILVKESRDPRTV---------------------------------FKLHP--VIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRV-------CMAFREIKEFMLVNGKSV------KARQKLLRNLRVIDLLVKLLNM------------PLYGQPDEAN------FLKVHLECYDILYTYMIGSSRKNALYFA-KYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKV-QINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGY-----DDEKVQFLLAQLDLFNAICYGRNEYCI-----RLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDH-------PERSFV--YEYVGTK---DQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG 9013
            IGD I LY E     E  G+   +ST    ++  I   +D    S     +   F++   NRY   K    +    +  +++ D D   L ++ K AA+ E  +N +E ++     ++YG ++QL  V S+KYI V     +++++N M V L+   ++ + F I P YK  + G+ V   ++I L     S    GH     H S  F L +    +E+N   E + + +   +  FDE++   V+ G  V+LFH + + ++  + +   +  T+ V LR+      N  +   + S+   W+++  + +   G    W++ +RF+H  T MYL+ +                    ++N  +   S  P  V                                 F+L P   ++ ++EV   SY R+ H  S  W+HA    E +   +S+  ++       W      KV C  +R   + + +  V P+  R  +F       LRN ++  +K   + +KE+          C+ F       L +   +      + RQKLLR   V++ +  LL              PL   P E +      F  +   CY  L  Y   S RKN  + A K+ E+ E    D     L     +  ++ +N K++++  K   + +FVE +R N   ++L+ L  LCVC G      Q  I    L    R +++  +            +  +    W    + L     G      D E + +   QLDL + +C  +    I     R +      L  E     +    LP D+R  +  +++ L V  G+  S + H       PE   V  YE V  +   D ++    +  A K L T+   L       ++E   + +SK+ +     +++ L   L +F +Y 
Sbjct:   39 IGDIISLYTESSSNQEQRGF---LSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTGDSMFDDD---LMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLS-SFNLLDHQSAAEVNCLNEPTEWQVFM-FLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMT-----NRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHLATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVTNESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEK------GW-----VKVICEKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIK-LIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISDFSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCY-CLLKYSQVSYRKNQEFLAEKFGEIQEQIGFD-----LMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSSKHRDIFMDTK-----------IIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLMNISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTY-----EIVNLAKALAQFNFYS 943          

HSP 3 Score: 54.6842 bits (130), Expect = 1.583e-6
Identity = 73/302 (24.17%), Postives = 136/302 (45.03%), Query Frame = -3
Query: 4976 LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENL-------DMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAA--YILEQPMETREAVLKEEL--------GEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYL 5830
            L   C+    P+ P  MNQ++L +  V  VV+E +SV  D +         K++  + + L++      + Q+++++ +       + +LRV+ +E     TL  +F NN+ L   +    I  IV L  EH  + P FL+LL A+V V      ++  Q  V   I  +       Y+     E  EA++K+E             ++Y I L+ LL+ C  G+N   E  C + + ++ I+ V+   +    +K  +L+ L+  Y+      +++   +  K + +   + NL E+I  L
Sbjct: 1269 LTGMCYRKGDPK-PDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDMM---KLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEE--VGTLVAIFRNNRELASNVPEELIAHIVGLI-EHNSRNPIFLELLQALVCV--YDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMMKDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYI-----DTDAEMKDAYKTEYVDHILNNLLEDIRSL 1556          
BLAST of SMED30029683 vs. Ensembl Celegans
Match: itr-1 (Inositol 1,4,5-trisphosphate receptor itr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y0A1])

HSP 1 Score: 150.599 bits (379), Expect = 1.693e-35
Identity = 89/334 (26.65%), Postives = 163/334 (48.80%), Query Frame = -3
Query: 1076 SHLISSKTFYYFAILGF-SLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR-------------------SGFNTE----------------------KNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEE 1927
            + +++ +  +Y  +  F  + G    P  +   L +I+   + LQ VI++VT+N +S++W  +L ++++Y ++I+GF +FR                   SG  +E                      K   C++LW C +     GL     +GD+  N  P +       F   V Y ++FF+++  I LN+IFG+I+DTF +LR  K   E  +++ CFIC  +   F++    FE H   EHN+W Y+++ + LQ     ++T  + +VA  +K++  D+FP  +AL L   + D+  S++ ++   L  + TL+    S++ E + F E
Sbjct: 2503 AEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSIVWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPAPWED-----MFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEVKQMKDQLLQMMTLMREIISQNEESRAFME 2831          

HSP 2 Score: 127.872 bits (320), Expect = 1.169e-28
Identity = 212/952 (22.27%), Postives = 374/952 (39.29%), Query Frame = -3
Query: 6533 IGDFICLYCE-----ETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIE-DENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIIL----ESIKSPGHF---FHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEP-FVRGGQFVQLFHKEMEAYIVAEGLF-DDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVD-------------------EESNVILVKESRDPRTV---------------------------------FKLHP--VIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRV-------CMAFREIKEFMLVNGKSV------KARQKLLRNLRVIDLLVKLLNM------------PLYGQPDEAN------FLKVHLECYDILYTYMIGSSRKNALYFA-KYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKV-QINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGY-----DDEKVQFLLAQLDLFNAICYGRNEYCI-----RLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDH-------PERSFV--YEYVGTK---DQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG 9013
            IGD I LY E     E  G+   +ST    ++  I   +D    S     +   F++   NRY   K    +    +  +++ D D   L ++ K AA+ E  +N +E ++     ++YG ++QL  V S+KYI V     +++++N M V L+   ++ + F I P YK  + G+ V   ++I L     S    GH     H S  F L +    +E+N   E + + +   +  FDE++   V+ G  V+LFH + + ++  + +   +  T+ V LR+      N  +   + S+   W+++  + +   G    W++ +RF+H  T MYL+ +                    ++N  +   S  P  V                                 F+L P   ++ ++EV   SY R+ H  S  W+HA    E +   +S+  ++       W      KV C  +R   + + +  V P+  R  +F       LRN ++  +K   + +KE+          C+ F       L +   +      + RQKLLR   V++ +  LL              PL   P E +      F  +   CY  L  Y   S RKN  + A K+ E+ E    D     L     +  ++ +N K++++  K   + +FVE +R N   ++L+ L  LCVC G      Q  I    L    R +++  +            +  +    W    + L     G      D E + +   QLDL + +C  +    I     R +      L  E     +    LP D+R  +  +++ L V  G+  S + H       PE   V  YE V  +   D ++    +  A K L T+   L       ++E   + +SK+ +     +++ L   L +F +Y 
Sbjct:   29 IGDIISLYTESSSNQEQRGF---LSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTGDSMFDDD---LMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLS-SFNLLDHQSAAEVNCLNEPTEWQVFM-FLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMT-----NRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHLATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVTNESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEK------GW-----VKVICEKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIK-LIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISDFSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCY-CLLKYSQVSYRKNQEFLAEKFGEIQEQIGFD-----LMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSSKHRDIFMDTK-----------IIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLMNISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTY-----EIVNLAKALAQFNFYS 933          

HSP 3 Score: 54.6842 bits (130), Expect = 1.677e-6
Identity = 73/302 (24.17%), Postives = 136/302 (45.03%), Query Frame = -3
Query: 4976 LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENL-------DMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAA--YILEQPMETREAVLKEEL--------GEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYL 5830
            L   C+    P+ P  MNQ++L +  V  VV+E +SV  D +         K++  + + L++      + Q+++++ +       + +LRV+ +E     TL  +F NN+ L   +    I  IV L  EH  + P FL+LL A+V V      ++  Q  V   I  +       Y+     E  EA++K+E             ++Y I L+ LL+ C  G+N   E  C + + ++ I+ V+   +    +K  +L+ L+  Y+      +++   +  K + +   + NL E+I  L
Sbjct: 1259 LTGMCYRKGDPK-PDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDMM---KLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEE--VGTLVAIFRNNRELASNVPEELIAHIVGLI-EHNSRNPIFLELLQALVCV--YDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMMKDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYI-----DTDAEMKDAYKTEYVDHILNNLLEDIRSL 1546          
BLAST of SMED30029683 vs. Ensembl Celegans
Match: itr-1 (Inositol 1,4,5-trisphosphate receptor itr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y0A1])

HSP 1 Score: 150.599 bits (379), Expect = 1.703e-35
Identity = 89/334 (26.65%), Postives = 163/334 (48.80%), Query Frame = -3
Query: 1076 SHLISSKTFYYFAILGF-SLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR-------------------SGFNTE----------------------KNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEE 1927
            + +++ +  +Y  +  F  + G    P  +   L +I+   + LQ VI++VT+N +S++W  +L ++++Y ++I+GF +FR                   SG  +E                      K   C++LW C +     GL     +GD+  N  P +       F   V Y ++FF+++  I LN+IFG+I+DTF +LR  K   E  +++ CFIC  +   F++    FE H   EHN+W Y+++ + LQ     ++T  + +VA  +K++  D+FP  +AL L   + D+  S++ ++   L  + TL+    S++ E + F E
Sbjct: 2559 AEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSIVWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPAPWED-----MFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEVKQMKDQLLQMMTLMREIISQNEESRAFME 2887          

HSP 2 Score: 127.872 bits (320), Expect = 1.136e-28
Identity = 212/952 (22.27%), Postives = 374/952 (39.29%), Query Frame = -3
Query: 6533 IGDFICLYCE-----ETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIE-DENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIIL----ESIKSPGHF---FHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEP-FVRGGQFVQLFHKEMEAYIVAEGLF-DDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVD-------------------EESNVILVKESRDPRTV---------------------------------FKLHP--VIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRV-------CMAFREIKEFMLVNGKSV------KARQKLLRNLRVIDLLVKLLNM------------PLYGQPDEAN------FLKVHLECYDILYTYMIGSSRKNALYFA-KYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKV-QINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGY-----DDEKVQFLLAQLDLFNAICYGRNEYCI-----RLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDH-------PERSFV--YEYVGTK---DQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG 9013
            IGD I LY E     E  G+   +ST    ++  I   +D    S     +   F++   NRY   K    +    +  +++ D D   L ++ K AA+ E  +N +E ++     ++YG ++QL  V S+KYI V     +++++N M V L+   ++ + F I P YK  + G+ V   ++I L     S    GH     H S  F L +    +E+N   E + + +   +  FDE++   V+ G  V+LFH + + ++  + +   +  T+ V LR+      N  +   + S+   W+++  + +   G    W++ +RF+H  T MYL+ +                    ++N  +   S  P  V                                 F+L P   ++ ++EV   SY R+ H  S  W+HA    E +   +S+  ++       W      KV C  +R   + + +  V P+  R  +F       LRN ++  +K   + +KE+          C+ F       L +   +      + RQKLLR   V++ +  LL              PL   P E +      F  +   CY  L  Y   S RKN  + A K+ E+ E    D     L     +  ++ +N K++++  K   + +FVE +R N   ++L+ L  LCVC G      Q  I    L    R +++  +            +  +    W    + L     G      D E + +   QLDL + +C  +    I     R +      L  E     +    LP D+R  +  +++ L V  G+  S + H       PE   V  YE V  +   D ++    +  A K L T+   L       ++E   + +SK+ +     +++ L   L +F +Y 
Sbjct:   85 IGDIISLYTESSSNQEQRGF---LSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTGDSMFDDD---LMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLS-SFNLLDHQSAAEVNCLNEPTEWQVFM-FLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMT-----NRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHLATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVTNESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEK------GW-----VKVICEKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIK-LIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISDFSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCY-CLLKYSQVSYRKNQEFLAEKFGEIQEQIGFD-----LMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSSKHRDIFMDTK-----------IIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLMNISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTY-----EIVNLAKALAQFNFYS 989          

HSP 3 Score: 54.299 bits (129), Expect = 2.125e-6
Identity = 73/302 (24.17%), Postives = 136/302 (45.03%), Query Frame = -3
Query: 4976 LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENL-------DMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAA--YILEQPMETREAVLKEEL--------GEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYL 5830
            L   C+    P+ P  MNQ++L +  V  VV+E +SV  D +         K++  + + L++      + Q+++++ +       + +LRV+ +E     TL  +F NN+ L   +    I  IV L  EH  + P FL+LL A+V V      ++  Q  V   I  +       Y+     E  EA++K+E             ++Y I L+ LL+ C  G+N   E  C + + ++ I+ V+   +    +K  +L+ L+  Y+      +++   +  K + +   + NL E+I  L
Sbjct: 1315 LTGMCYRKGDPK-PDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDMM---KLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEE--VGTLVAIFRNNRELASNVPEELIAHIVGLI-EHNSRNPIFLELLQALVCV--YDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMMKDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYI-----DTDAEMKDAYKTEYVDHILNNLLEDIRSL 1602          
BLAST of SMED30029683 vs. Ensembl Celegans
Match: itr-1 (Inositol 1,4,5-trisphosphate receptor itr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y0A1])

HSP 1 Score: 150.214 bits (378), Expect = 1.890e-35
Identity = 89/334 (26.65%), Postives = 163/334 (48.80%), Query Frame = -3
Query: 1076 SHLISSKTFYYFAILGF-SLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR-------------------SGFNTE----------------------KNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEE 1927
            + +++ +  +Y  +  F  + G    P  +   L +I+   + LQ VI++VT+N +S++W  +L ++++Y ++I+GF +FR                   SG  +E                      K   C++LW C +     GL     +GD+  N  P +       F   V Y ++FF+++  I LN+IFG+I+DTF +LR  K   E  +++ CFIC  +   F++    FE H   EHN+W Y+++ + LQ     ++T  + +VA  +K++  D+FP  +AL L   + D+  S++ ++   L  + TL+    S++ E + F E
Sbjct: 2513 AEILACRNLHYLLVYLFICILGLLVHPMIYCILLFDIIFTEETLQNVIASVTRNYQSIVWTGLLALILLYFFSILGFLYFRHDFYLEVDPVENDSSATISSGIPSETCPSEGCPGLQPSEKDDNDDEKKVKSCETLWMCILQTGYQGLRNGGGIGDVLRNPAPWED-----MFIWRVAYDMTFFVVLIVIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTGPESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEVKQMKDQLLQMMTLMREIISQNEESRAFME 2841          

HSP 2 Score: 127.872 bits (320), Expect = 1.085e-28
Identity = 212/952 (22.27%), Postives = 374/952 (39.29%), Query Frame = -3
Query: 6533 IGDFICLYCE-----ETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIE-DENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIIL----ESIKSPGHF---FHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEP-FVRGGQFVQLFHKEMEAYIVAEGLF-DDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVD-------------------EESNVILVKESRDPRTV---------------------------------FKLHP--VIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRV-------CMAFREIKEFMLVNGKSV------KARQKLLRNLRVIDLLVKLLNM------------PLYGQPDEAN------FLKVHLECYDILYTYMIGSSRKNALYFA-KYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKV-QINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGY-----DDEKVQFLLAQLDLFNAICYGRNEYCI-----RLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDH-------PERSFV--YEYVGTK---DQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG 9013
            IGD I LY E     E  G+   +ST    ++  I   +D    S     +   F++   NRY   K    +    +  +++ D D   L ++ K AA+ E  +N +E ++     ++YG ++QL  V S+KYI V     +++++N M V L+   ++ + F I P YK  + G+ V   ++I L     S    GH     H S  F L +    +E+N   E + + +   +  FDE++   V+ G  V+LFH + + ++  + +   +  T+ V LR+      N  +   + S+   W+++  + +   G    W++ +RF+H  T MYL+ +                    ++N  +   S  P  V                                 F+L P   ++ ++EV   SY R+ H  S  W+HA    E +   +S+  ++       W      KV C  +R   + + +  V P+  R  +F       LRN ++  +K   + +KE+          C+ F       L +   +      + RQKLLR   V++ +  LL              PL   P E +      F  +   CY  L  Y   S RKN  + A K+ E+ E    D     L     +  ++ +N K++++  K   + +FVE +R N   ++L+ L  LCVC G      Q  I    L    R +++  +            +  +    W    + L     G      D E + +   QLDL + +C  +    I     R +      L  E     +    LP D+R  +  +++ L V  G+  S + H       PE   V  YE V  +   D ++    +  A K L T+   L       ++E   + +SK+ +     +++ L   L +F +Y 
Sbjct:   39 IGDIISLYTESSSNQEQRGF---LSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKRFQTGDSMFDDD---LMNKLKVAADKEREENESEFQKTLGNVIQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGNEGSWFIIEPAYKHYAIGDNVSAGNKISLIPNSVSTTQAGHVKSQLHLS-SFNLLDHQSAAEVNCLNEPTEWQVFM-FLLFDENQQNSVKSGDVVRLFHADQQTFLTLDTIPKQNPPTDVVFLRMT-----NRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKAYRFKHLATDMYLSAEPSQVQVKPAMNGRRASLIYSKTNNPMAMYSDGPNGVTNESTDTTQQNIPSVWVLGPTKSEFPEEDANLLFQLDPSTFMKSNKEVPRRSYVRLLHQSSDKWVHATNATEKQNLHYSSKNEK------GW-----VKVICEKNRVDKETFALLPVNPDEVRDLDFANDACKALRNFIK-LIKIGQVISKESINSTTQLLIDCILFVTNSSDHLADPLKISDFSPSRDRQKLLREQEVLNQVFLLLKAPFLPRQGTTELGPLLSSPSELSDSRNEIFKTMFQLCY-CLLKYSQVSYRKNQEFLAEKFGEIQEQIGFD-----LMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSSKHRDIFMDTK-----------IIDGEIEVGWAPNFRKLVDIAEGAKSNSDDAEHLDYYRHQLDLLSQMCQEQQYLAIDPPPERRLMNISQQLPAELVLQCMSDNRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEAYSDGSRMRIGEGIAHKVLATVETYLMGLRNQSMEERQSVNSSKLTY-----EIVNLAKALAQFNFYS 943          

HSP 3 Score: 54.6842 bits (130), Expect = 1.650e-6
Identity = 73/302 (24.17%), Postives = 136/302 (45.03%), Query Frame = -3
Query: 4976 LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENL-------DMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAA--YILEQPMETREAVLKEEL--------GEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYL 5830
            L   C+    P+ P  MNQ++L +  V  VV+E +SV  D +         K++  + + L++      + Q+++++ +       + +LRV+ +E     TL  +F NN+ L   +    I  IV L  EH  + P FL+LL A+V V      ++  Q  V   I  +       Y+     E  EA++K+E             ++Y I L+ LL+ C  G+N   E  C + + ++ I+ V+   +    +K  +L+ L+  Y+      +++   +  K + +   + NL E+I  L
Sbjct: 1269 LTGMCYRKGDPK-PDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHDMM---KLITLSHEFLRSFCKTNKENQSRLYKFISYEKDAKEGMLRVETIEE--VGTLVAIFRNNRELASNVPEELIAHIVGLI-EHNSRNPIFLELLQALVCV--YDKEIESGQEKVANEICAASDEVRQLYVDNASFEELEAMMKDEKESKGRSSDSRRKLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVTAKQCLVEVKTVYLQLLLHCYI-----DTDAEMKDAYKTEYVDHILNNLLEDIRSL 1556          
BLAST of SMED30029683 vs. Ensembl Fly
Match: Itp-r83A (gene:FBgn0010051 transcript:FBtr0078686)

HSP 1 Score: 157.532 bits (397), Expect = 1.676e-37
Identity = 131/532 (24.62%), Postives = 238/532 (44.74%), Query Frame = -3
Query: 1070 NVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSL---PDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKT----FYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR----------------------------------------------------SGFNTEKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDE----------LLKNVSTLINHQKSEDSERKRFEELL 2443
              +R    +K+ DF D ++ + N++++QKK  + P+  + +    LW+  +    V++N  M+  F  P D +  E   +S + + L      F   +    PR   +++++ +           L F + L     P        ++   LK   +      +   G++G  +   LI   T     Y+   + F   G  + P+F++  L ++V+  + L  VI +VT+NG+S++  A+L ++++YL++IIG+ FF+                                                    +G    K   CDSL  C V+ +  GL     +GD+     P   E  F      VIY L FF ++  I LN+IFG+I+DTF++LR  K   E+ ++ TCFICS N   F++    FE H+ +EHNMW Y++F + ++     ++T  + +V  ++K    ++FP  RA+ L A D D    ++            L+KN+ST ++  K   +E+++ ++ L
Sbjct: 2313 TAERDDQGSKVADFFDKAEEMFNEMKWQKKLRSQPLLFWISSYMSLWSNILFNCVVVIN--MIVAFFYPFDNTVPE---LSSHISLLFWIITIFSLVIVLALPRESGIRTFIGSV---------ILRFIFLLG----PESTLCLLGVVTVTLKSVHI------VSIMGNKG-TLEKQLIKIITDFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRSVTRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFLVSVDFEEQDNAPPPSVPLTLSVPVSGDSCSAPDDLGNCQAAKEVAPPSAGGGEVKERSCDSLVMCIVTTLNQGLRNGGGIGDILRA--PSSKEGLFVAR---VIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTTCFICSLNRSAFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGILEWFPRLRAMSLAAVDADGEQIELRSMQAQLLDTQLLIKNLSTQLHELKDHMTEQRKQKQRL 2814          

HSP 2 Score: 135.191 bits (339), Expect = 7.875e-31
Identity = 170/717 (23.71%), Postives = 284/717 (39.61%), Query Frame = -3
Query: 7118 IGDFICLYCEETDGYVYS-MSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGE-VIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNV----------------------------------------------ILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQFSTT------EDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKV------YPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPL---------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTN-ENY--RYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL 9013
            +GD + LY E   G V   +ST    ++  +   +  +        +    +I   NRY   K++ +        N        L  +   AAE E   N  E ++     ++YG  V+QL  + S+KY+ VN    S  +KN M V L+ + ++ + F I P YK++S G+YV + D++IL  + +     H +  + L +     E+N+    + + I     H +  E  ++GG  V+LFH E E ++       D   +Q H+ +R   + +A T  TS+ A+  W+IE  +     G    W+  +RF+H  T  YLA + E +V                                              + V  S D  +VF L        +  V   SY R++H+ S  W+HA     D +  +   S        ED+ +   I     E+R +D  +D     A    K+        E     + +  IV F+  +  ++ K K L                EF + N   ++ RQKLLR   ++  L K+L  P                   P  + +  +   CY IL        RKN  Y AK+  L + Q+       +     I  L+ +NRK++++ I+  +I  FV  +R N  N+  R+L+ L  LCV N   I   Q  I +  L +  + + +
Sbjct:   14 LGDIVSLYAE---GSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCLIKICPMNRYSAQKQFWKAAKQSASSNT----DPNLLKRLHHAAEIEKKQNETENKKLLGTSIQYGRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYVVVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHILKGGDVVRLFHAEQEKFLTM-----DEYKKQYHVFLRTTGRTSA-TAATSSKAL--WEIEVVQHDSCRGGAGDWNSLYRFKHLATGHYLAAEAEIDVSAGAMSATSASGHDLHLGDCSKDSGLSCSTMNSTINDKPKGKQYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHATSIPIDADDDKPVMSMVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLATVTSKLDNGSISINERRALISLLQDIVYFIAGMENEQNKTKAL----------------EFTIKN--PIRDRQKLLREQYILKQLFKILQGPFQQHTAGDGPFLRLDELSDPKNSPYKNIFRLCYRILRLSQ-QDYRKNQEYIAKHFGLMQKQI----GYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSRFLDYLSDLCVSNRKAIAVTQELICKSVLSDKNKDILI 692          

HSP 3 Score: 65.0846 bits (157), Expect = 1.491e-9
Identity = 93/447 (20.81%), Postives = 183/447 (40.94%), Query Frame = -3
Query: 4916 ILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMA--------KSKWSDE-------------------------QVNRMENIFSELIEFCHLPKAPE---EPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIF--ENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYILEQPMETREAVLK-EELGEDH-VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIW------------QFIGNLGEEIH-YLTQYILESPHELVYYLLTKPF 6076
            +L++L  + YA +   AL +L   +S +Q+  QA  +  +L++      ++++   + +LR           K+K +DE                         +  +++ I   + +FC     P    +P    QR+L +  V  VV+++L    D +  E   +        L           + QNQ+    +LD+ L   ++E++   T+  +F +N  LC ++  + +   V     H +    +L  L  +V+ E     ++R Q +VM+ ++ S       Y+            ++ +L+ E+L +D  ++Y + L++LL+ C  G+N Y E  C  +LS++DI+ ++ HP     +K  ++ +L   Y+      +E    EI     +W            Q I N     +  L  Y+L     L+      PF
Sbjct: 1158 VLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQAFRQVQLLVSDSDVESYKQIKSDLDILRQSVEKSELWVYKAKATDELGATDAGGDAVSLEYNAALSQEQRNEYRKVKEILIRMNKFCVTASGPGSVVKPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDELMKE-----LMCLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAK---TVCAIFKDNLALCNEVTDKVVQHFVHCIEIHGRHVA-YLQFLQTVVRAENQ--FIRRCQDMVMQELINSGEDVLVFYNDKGSFNHFVQMMQQQMLRMEKLSDDSPLKYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDIVTIICHPLCMPEVKEAYVDFLNHCYI-----DTEVEMKEIYASGHMWSLFEKSFLVDINQLITNPAAASNKTLQAYVLNGVTNLLGSFFASPF 1588          
BLAST of SMED30029683 vs. Ensembl Fly
Match: Itp-r83A (gene:FBgn0010051 transcript:FBtr0344265)

HSP 1 Score: 157.532 bits (397), Expect = 1.676e-37
Identity = 131/532 (24.62%), Postives = 238/532 (44.74%), Query Frame = -3
Query: 1070 NVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSL---PDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKT----FYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR----------------------------------------------------SGFNTEKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDE----------LLKNVSTLINHQKSEDSERKRFEELL 2443
              +R    +K+ DF D ++ + N++++QKK  + P+  + +    LW+  +    V++N  M+  F  P D +  E   +S + + L      F   +    PR   +++++ +           L F + L     P        ++   LK   +      +   G++G  +   LI   T     Y+   + F   G  + P+F++  L ++V+  + L  VI +VT+NG+S++  A+L ++++YL++IIG+ FF+                                                    +G    K   CDSL  C V+ +  GL     +GD+     P   E  F      VIY L FF ++  I LN+IFG+I+DTF++LR  K   E+ ++ TCFICS N   F++    FE H+ +EHNMW Y++F + ++     ++T  + +V  ++K    ++FP  RA+ L A D D    ++            L+KN+ST ++  K   +E+++ ++ L
Sbjct: 2313 TAERDDQGSKVADFFDKAEEMFNEMKWQKKLRSQPLLFWISSYMSLWSNILFNCVVVIN--MIVAFFYPFDNTVPE---LSSHISLLFWIITIFSLVIVLALPRESGIRTFIGSV---------ILRFIFLLG----PESTLCLLGVVTVTLKSVHI------VSIMGNKG-TLEKQLIKIITDFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRSVTRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFLVSVDFEEQDNAPPPSVPLTLSVPVSGDSCSAPDDLGNCQAAKEVAPPSAGGGEVKERSCDSLVMCIVTTLNQGLRNGGGIGDILRA--PSSKEGLFVAR---VIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTTCFICSLNRSAFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGILEWFPRLRAMSLAAVDADGEQIELRSMQAQLLDTQLLIKNLSTQLHELKDHMTEQRKQKQRL 2814          

HSP 2 Score: 135.191 bits (339), Expect = 7.875e-31
Identity = 170/717 (23.71%), Postives = 284/717 (39.61%), Query Frame = -3
Query: 7118 IGDFICLYCEETDGYVYS-MSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGE-VIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNV----------------------------------------------ILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQFSTT------EDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKV------YPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPL---------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTN-ENY--RYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL 9013
            +GD + LY E   G V   +ST    ++  +   +  +        +    +I   NRY   K++ +        N        L  +   AAE E   N  E ++     ++YG  V+QL  + S+KY+ VN    S  +KN M V L+ + ++ + F I P YK++S G+YV + D++IL  + +     H +  + L +     E+N+    + + I     H +  E  ++GG  V+LFH E E ++       D   +Q H+ +R   + +A T  TS+ A+  W+IE  +     G    W+  +RF+H  T  YLA + E +V                                              + V  S D  +VF L        +  V   SY R++H+ S  W+HA     D +  +   S        ED+ +   I     E+R +D  +D     A    K+        E     + +  IV F+  +  ++ K K L                EF + N   ++ RQKLLR   ++  L K+L  P                   P  + +  +   CY IL        RKN  Y AK+  L + Q+       +     I  L+ +NRK++++ I+  +I  FV  +R N  N+  R+L+ L  LCV N   I   Q  I +  L +  + + +
Sbjct:   14 LGDIVSLYAE---GSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCLIKICPMNRYSAQKQFWKAAKQSASSNT----DPNLLKRLHHAAEIEKKQNETENKKLLGTSIQYGRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYVVVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHILKGGDVVRLFHAEQEKFLTM-----DEYKKQYHVFLRTTGRTSA-TAATSSKAL--WEIEVVQHDSCRGGAGDWNSLYRFKHLATGHYLAAEAEIDVSAGAMSATSASGHDLHLGDCSKDSGLSCSTMNSTINDKPKGKQYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHATSIPIDADDDKPVMSMVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLATVTSKLDNGSISINERRALISLLQDIVYFIAGMENEQNKTKAL----------------EFTIKN--PIRDRQKLLREQYILKQLFKILQGPFQQHTAGDGPFLRLDELSDPKNSPYKNIFRLCYRILRLSQ-QDYRKNQEYIAKHFGLMQKQI----GYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSRFLDYLSDLCVSNRKAIAVTQELICKSVLSDKNKDILI 692          

HSP 3 Score: 65.0846 bits (157), Expect = 1.491e-9
Identity = 93/447 (20.81%), Postives = 183/447 (40.94%), Query Frame = -3
Query: 4916 ILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMA--------KSKWSDE-------------------------QVNRMENIFSELIEFCHLPKAPE---EPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIF--ENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYILEQPMETREAVLK-EELGEDH-VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIW------------QFIGNLGEEIH-YLTQYILESPHELVYYLLTKPF 6076
            +L++L  + YA +   AL +L   +S +Q+  QA  +  +L++      ++++   + +LR           K+K +DE                         +  +++ I   + +FC     P    +P    QR+L +  V  VV+++L    D +  E   +        L           + QNQ+    +LD+ L   ++E++   T+  +F +N  LC ++  + +   V     H +    +L  L  +V+ E     ++R Q +VM+ ++ S       Y+            ++ +L+ E+L +D  ++Y + L++LL+ C  G+N Y E  C  +LS++DI+ ++ HP     +K  ++ +L   Y+      +E    EI     +W            Q I N     +  L  Y+L     L+      PF
Sbjct: 1158 VLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQAFRQVQLLVSDSDVESYKQIKSDLDILRQSVEKSELWVYKAKATDELGATDAGGDAVSLEYNAALSQEQRNEYRKVKEILIRMNKFCVTASGPGSVVKPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDELMKE-----LMCLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAK---TVCAIFKDNLALCNEVTDKVVQHFVHCIEIHGRHVA-YLQFLQTVVRAENQ--FIRRCQDMVMQELINSGEDVLVFYNDKGSFNHFVQMMQQQMLRMEKLSDDSPLKYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDIVTIICHPLCMPEVKEAYVDFLNHCYI-----DTEVEMKEIYASGHMWSLFEKSFLVDINQLITNPAAASNKTLQAYVLNGVTNLLGSFFASPF 1588          
BLAST of SMED30029683 vs. Ensembl Fly
Match: Itp-r83A (gene:FBgn0010051 transcript:FBtr0078687)

HSP 1 Score: 157.532 bits (397), Expect = 1.677e-37
Identity = 131/532 (24.62%), Postives = 238/532 (44.74%), Query Frame = -3
Query: 1070 NVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSL---PDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKT----FYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR----------------------------------------------------SGFNTEKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDE----------LLKNVSTLINHQKSEDSERKRFEELL 2443
              +R    +K+ DF D ++ + N++++QKK  + P+  + +    LW+  +    V++N  M+  F  P D +  E   +S + + L      F   +    PR   +++++ +           L F + L     P        ++   LK   +      +   G++G  +   LI   T     Y+   + F   G  + P+F++  L ++V+  + L  VI +VT+NG+S++  A+L ++++YL++IIG+ FF+                                                    +G    K   CDSL  C V+ +  GL     +GD+     P   E  F      VIY L FF ++  I LN+IFG+I+DTF++LR  K   E+ ++ TCFICS N   F++    FE H+ +EHNMW Y++F + ++     ++T  + +V  ++K    ++FP  RA+ L A D D    ++            L+KN+ST ++  K   +E+++ ++ L
Sbjct: 2322 TAERDDQGSKVADFFDKAEEMFNEMKWQKKLRSQPLLFWISSYMSLWSNILFNCVVVIN--MIVAFFYPFDNTVPE---LSSHISLLFWIITIFSLVIVLALPRESGIRTFIGSV---------ILRFIFLLG----PESTLCLLGVVTVTLKSVHI------VSIMGNKG-TLEKQLIKIITDFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRSVTRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFLVSVDFEEQDNAPPPSVPLTLSVPVSGDSCSAPDDLGNCQAAKEVAPPSAGGGEVKERSCDSLVMCIVTTLNQGLRNGGGIGDILRA--PSSKEGLFVAR---VIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTTCFICSLNRSAFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGILEWFPRLRAMSLAAVDADGEQIELRSMQAQLLDTQLLIKNLSTQLHELKDHMTEQRKQKQRL 2823          

HSP 2 Score: 135.576 bits (340), Expect = 6.444e-31
Identity = 170/717 (23.71%), Postives = 284/717 (39.61%), Query Frame = -3
Query: 7118 IGDFICLYCEETDGYVYS-MSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGE-VIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNV----------------------------------------------ILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQFSTT------EDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKV------YPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPL---------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTN-ENY--RYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL 9013
            +GD + LY E   G V   +ST    ++  +   +  +        +    +I   NRY   K++ +        N        L  +   AAE E   N  E ++     ++YG  V+QL  + S+KY+ VN    S  +KN M V L+ + ++ + F I P YK++S G+YV + D++IL  + +     H +  + L +     E+N+    + + I     H +  E  ++GG  V+LFH E E ++       D   +Q H+ +R   + +A T  TS+ A+  W+IE  +     G    W+  +RF+H  T  YLA + E +V                                              + V  S D  +VF L        +  V   SY R++H+ S  W+HA     D +  +   S        ED+ +   I     E+R +D  +D     A    K+        E     + +  IV F+  +  ++ K K L                EF + N   ++ RQKLLR   ++  L K+L  P                   P  + +  +   CY IL        RKN  Y AK+  L + Q+       +     I  L+ +NRK++++ I+  +I  FV  +R N  N+  R+L+ L  LCV N   I   Q  I +  L +  + + +
Sbjct:   14 LGDIVSLYAE---GSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCLIKICPMNRYSAQKQFWKAAKQSASSNT----DPNLLKRLHHAAEIEKKQNETENKKLLGTSIQYGRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYVVVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHILKGGDVVRLFHAEQEKFLTM-----DEYKKQYHVFLRTTGRTSA-TAATSSKAL--WEIEVVQHDSCRGGAGDWNSLYRFKHLATGHYLAAEAEIDVSAGAMSATSASGHDLHLGDCSKDSGLSCSTMNSTINDKPKGKQYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHATSIPIDADDDKPVMSMVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLATVTSKLDNGSISINERRALISLLQDIVYFIAGMENEQNKTKAL----------------EFTIKN--PIRDRQKLLREQYILKQLFKILQGPFQQHTAGDGPFLRLDELSDPKNSPYKNIFRLCYRILRLSQ-QDYRKNQEYIAKHFGLMQKQI----GYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSRFLDYLSDLCVSNRKAIAVTQELICKSVLSDKNKDILI 692          

HSP 3 Score: 65.0846 bits (157), Expect = 1.407e-9
Identity = 93/447 (20.81%), Postives = 183/447 (40.94%), Query Frame = -3
Query: 4916 ILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMA--------KSKWSDE-------------------------QVNRMENIFSELIEFCHLPKAPE---EPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIF--ENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYILEQPMETREAVLK-EELGEDH-VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIW------------QFIGNLGEEIH-YLTQYILESPHELVYYLLTKPF 6076
            +L++L  + YA +   AL +L   +S +Q+  QA  +  +L++      ++++   + +LR           K+K +DE                         +  +++ I   + +FC     P    +P    QR+L +  V  VV+++L    D +  E   +        L           + QNQ+    +LD+ L   ++E++   T+  +F +N  LC ++  + +   V     H +    +L  L  +V+ E     ++R Q +VM+ ++ S       Y+            ++ +L+ E+L +D  ++Y + L++LL+ C  G+N Y E  C  +LS++DI+ ++ HP     +K  ++ +L   Y+      +E    EI     +W            Q I N     +  L  Y+L     L+      PF
Sbjct: 1167 VLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQAFRQVQLLVSDSDVESYKQIKSDLDILRQSVEKSELWVYKAKATDELGATDAGGDAVSLEYNAALSQEQRNEYRKVKEILIRMNKFCVTASGPGSVVKPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDELMKE-----LMCLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAK---TVCAIFKDNLALCNEVTDKVVQHFVHCIEIHGRHVA-YLQFLQTVVRAENQ--FIRRCQDMVMQELINSGEDVLVFYNDKGSFNHFVQMMQQQMLRMEKLSDDSPLKYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDIVTIICHPLCMPEVKEAYVDFLNHCYI-----DTEVEMKEIYASGHMWSLFEKSFLVDINQLITNPAAASNKTLQAYVLNGVTNLLGSFFASPF 1597          
BLAST of SMED30029683 vs. Ensembl Fly
Match: RyR (gene:FBgn0011286 transcript:FBtr0088639)

HSP 1 Score: 115.931 bits (289), Expect = 7.569e-25
Identity = 75/249 (30.12%), Postives = 130/249 (52.21%), Query Frame = -3
Query: 1172 TFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWH----CFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDED 1906
            + +YF+   FS+ G  ++ +FFA HL+++    + L+ ++ +VT NGK L+   +L  +++Y+Y +I F FFR  +  E++   D   H    CFV  +  G+           D +   +    ++     FF +I  + L II G+I+D F ELRD   + + +M   CFIC      F+    GF+ HV  EHN+ +Y+FF +HL +    +YT  + +V  + +++ +DFFP+    C   + ED
Sbjct: 4863 SLWYFS---FSVMGN-FNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIIL-LAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGD--CFRKQYED 5104          
BLAST of SMED30029683 vs. Ensembl Fly
Match: RyR (gene:FBgn0011286 transcript:FBtr0304568)

HSP 1 Score: 115.546 bits (288), Expect = 7.762e-25
Identity = 75/249 (30.12%), Postives = 130/249 (52.21%), Query Frame = -3
Query: 1172 TFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWH----CFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDED 1906
            + +YF+   FS+ G  ++ +FFA HL+++    + L+ ++ +VT NGK L+   +L  +++Y+Y +I F FFR  +  E++   D   H    CFV  +  G+           D +   +    ++     FF +I  + L II G+I+D F ELRD   + + +M   CFIC      F+    GF+ HV  EHN+ +Y+FF +HL +    +YT  + +V  + +++ +DFFP+    C   + ED
Sbjct: 4867 SLWYFS---FSVMGN-FNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIIL-LAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGD--CFRKQYED 5108          
BLAST of SMED30029683 vs. Ensembl Zebrafish
Match: itpr3 (inositol 1,4,5-trisphosphate receptor, type 3 [Source:ZFIN;Acc:ZDB-GENE-070605-1])

HSP 1 Score: 224.172 bits (570), Expect = 1.143e-57
Identity = 339/1521 (22.29%), Postives = 631/1521 (41.49%), Query Frame = -3
Query: 4997 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLR-KFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVD------EESNVILVKESR--------------------DPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALK---DKEYKR------QQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDR---LKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYD---ILYTYMIG-----------SSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL-TERGQNIHEQPNILYVS--TDCMKSWI------------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITK--DLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSV---------VDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE--NTYMIA----SKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID-----GSRDLPFPPERQGKELSKEKKKIVQKY----------------QQGDRYLQSKET-----SAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--W---------------------------------------SDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSY----------SSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNL 9013
            IGD + LY E T +G++   ST    ++  +         N P    D     F++   NRY   K++ + K A  E + + D     L  + + AA  E   N AE ++     V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ +   I P +K+++ G+ V + D++IL  + + G   HAS  + L +     E+N     + + I       D  +  ++GG  V+LFH E E ++       D    ++H+ +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA +      E SN I V  SR                    D  ++F+L P  +Q ++  V   SY R  H+ +  W+ +     D + +R          T ED+ +   +     E+R +D  +D     +  ++K    +  P +    I      LLED    + ++  + + A  V M             K  + RQKL+R   ++  +  ++  P   + D+   L +  E  D   +LY YM+              RKN  Y AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N V I   Q  I +  L    + + + TER      Q    Y+    D  + W+            ++ +  Q    G  +D+  + +   QL LF  +C+ R    I +I+K  D+  +S     L +  E LP D+RA +C +++   VD      V          + P    + +Y    D ++    +++A                AF++E  N  +I     +  E N L  +V+ L   L+ FG+Y    ++  L   L+G+ID      S +  F  +  GK + +    + Q                  + GD  + SK++       +++ K   LE+LQ IL+   + RL+  ++ FK+            P   A A +     + +  +++  Q +  ++   MF   +  + +++D         +LI+L  + Y  +   AL++L   +S +Q+      +  +L++T     ++ + + + LLR M +    W                                       S+E    ++ I   L + C      ++     QR+L +     V++++L +  D       + T+ +       L        +++NQ  + ++L++ L  +L+E+E   T++++F NN  LC +I    +H  +   A  Q +  ++L+ L  I+K E  G  +K+ Q ++M  +  +           +S   ++E   ++RE V      +  ++Y ISL+ELL+ CAEG+N Y E  C ++L +E+++ V+ H +    +K  ++ ++   Y+      +E    EI     IW+   N 
Sbjct:   11 IGDIVSLYAEGTVNGFI---STLGLVDDRCVVEPASGDLENPPKKFRD---CLFKVYPMNRYSAQKQFWKAKQAKHEKDKIGDM---VLLQKLQHAANLEQKQNDAENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWKLRANGDNVVVGDKVILNPVNA-GQPLHAS-SYELPDHSGCKEINSVNSNTSWKISLFMMFSDHKDEVLKGGDVVRLFHAEQEKFLTC-----DEYKSKLHVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNSLYRFKHLATGNYLAAEENPGYKENSNDIEVDSSRIKRSLGERIKYKLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRFRHLCTNTWIQSTNIPIDIDEERPIRLMLGTCPTKEDKEAFAIVSVPVMEIRDLDFANDASLMLSTVVEKFKYGFLSPNDRRYAI-----KLLEDVVFFVVDQLNNGQPALEVSM------------NKPNRERQKLMREQNILKQIFGIIKAPFKERGDDPPLLTLE-ELSDQKYLLYQYMLRLCYRVLRHSQEDYRKNQEYIAKQFGMMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNNVAIPVTQELICKCVLNAKNQDILMKTERRAAKESQHTSEYLEEFGDEDEVWLIWSEKENENHEKSIRQLAQEARQGNVHDENVLTYYRYQLKLFARMCFDRQYLAIDVISKQLDIELIS-----LCMMDETLPFDLRASFCRLMLHAHVDRDPQELVTPIKFARLWTEIPTSISIKDYDSHLDYSRDNKKNKFAN-------------TMAFMEEYLNNVLIDDLPFANEEKNKLTYEVVSLARHLIYFGFYS-FFELLRLTRTLLGIIDCTPSNASINPLFNDDGSGKNVRRSIHGMGQMMSTMVLNRKPSLFSAPGRTGDSQVGSKDSIDTQDITVMDTKLKILEILQFILSVRLDYRLSFLLSVFKK------EFVDVYPMEDADATH-----HTEHEASINLQHIG-EQAEAMFGIGKGNSILEVDDEGGRMFLRVLIHLIMHDYPPLVSGALQLLFKHFSQRQEVLHTFKQVQLLISTQDVDNYKHIKRDLDLLRTMVEKSELWVIKKSSSGGDGKKDKKDKKEPEAVSPEEEADSKKQTTEKSNESYQNVKEILERLNKMCSSGVFKKQ-----QRLLKNMGAHKVMLDLLQISYDR------NDTKMLEIIKYTHLFLQKFCTGNLENQALLHKHLNLFLTPRLLEAE---TMQQIFSNNFQLCSEISESVLHHFIHCLAT-QGRHIQYLNFLHTIIKAE--GKYVKKCQDMIMTELTSAGDDVVVLYTDDTSFNTMVELMTQSREGVKD----DSPLRYHISLVELLAACAEGKNVYTEIKCTSLLPLEEMVKVITHEDCITEVKIAYVNFVNHCYV-----DTEVEMKEIYTSNHIWKLFENF 1433          

HSP 2 Score: 151.369 bits (381), Expect = 1.307e-35
Identity = 93/339 (27.43%), Postives = 170/339 (50.15%), Query Frame = -3
Query: 1031 FYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF-------------------------------------------NTEKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFL 1903
             Y+ A +  S  G +   +F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F R+ F                                           NTE+   CD+L  C ++V+  GL     VGD+     P  +E     F   V+Y L F+ ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W+Y++F + +++    DYT  + +VA ++K +  D+FP  +A+ L   D D   +++  L   +S+ +       S+    +E + ++R +++  GF+
Sbjct: 2278 LYHVAYVLTSSLGLFVHEFFYSILLFDLIYREETLFNVIKSVTRNGRSILLTAVLAIILVYLFSIVGFLFLRNDFIMEVDHLASPAPGDTESFMSSCSSDGIDCTEETGLLAPAEDEDNTER--ACDTLLMCIITVLNHGLRNGGGVGDVLRK--PSKNEP---LFPARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKLEHNIWNYLYFIVLIREKNKTDYTGPESYVALMIKNKNLDWFPRMQAMSLVVTDGDGEQNEMRNLQDRLSSTMKVVTQLTSQLTELKEQMTEQRKRRQRMGFV 2609          
BLAST of SMED30029683 vs. Ensembl Zebrafish
Match: itpr1b (inositol 1,4,5-trisphosphate receptor, type 1b [Source:ZFIN;Acc:ZDB-GENE-070604-2])

HSP 1 Score: 220.705 bits (561), Expect = 1.303e-56
Identity = 339/1515 (22.38%), Postives = 618/1515 (40.79%), Query Frame = -3
Query: 4916 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVDEES------------------NVILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFML---VNGKSV---------KARQKLLRNLRVIDLLVKLLNMPLYGQPD-------------EANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCV-------------CNGV------GIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEK--VQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTY--MIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDG---SRDLPFPPERQG-----KELSKEKKKIVQKYQQGDRYLQ------------------SKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRM-MAKSK-WS---------------DEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPF 9013
            IGD   LY E  T+G++   ST    ++  +   +     N P    D Q   F++   NRY   K++  K A     +  D     L ++   AA+ E   N +E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  E  ++GG  V+LFH E E ++       D   ++ H+ +R   + +A T  TS+ A+  W+IE  +     G    W+  FRF+H  T  YLA + +S                  +++ V +  D  ++F+L P      +  V   SY R+ H+ +  W+H+  +   K       E+E+ +         + ++     +   +A+ I  V P   R  +F       L ++   +L++  +   E   V     ++  F++    NG+ V         + RQKL+R   ++  + KLL  P     D              A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV             CN V       I+     +  R+ +E   G   +E  +   E+  + + +++      ++ +  Q    G  D++  + +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C +++ + VD      V+         + P +  + +Y      N  T+ D+   +     F    D++  +L +     +  S  E N L  +V+ L   L+ FG+Y +  D+  L   L+ ++D    S   P     +G     K +    + + Q   +G  +L                    KE   +++ K   +E+LQ ILN   + R++  +  FK             P+S+     +     E  P           +L +    T          +L++L  + Y  +   AL +L   +S +Q+   A  +  +L+T+     ++++   +  LR  + KS+ W                  + +  + I   L + C      +E     QR+L +     VV+E+L +       EK  + +++++ A + L+         Q  + +++++ L   ++E   AIT++ +F+NN  LC ++  R +   V     H +   ++L  L  IVK E     +K+ Q +VM  ++ S       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L  Y+ E+   +V    + PF
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPESGDLNNPPKKFRDCQ---FRLCPMNRYSAQKQFW-KAAKPGGNSTTDT---VLLNKLHHAADLEKKQNESENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWSDNKEAILKGGDVVRLFHAEQEKFLTC-----DEHRKKQHVFLRTTGRQSA-TSATSSKAL--WEIEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAELDSEHEALRARLRTPNEKVMYSLVSVPDGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNNPIDK-------EEEKPV---------MLRIGTSAVKEDKEAFAIVPVPPAEVRDLDFANDASKVLASI-AGKLEKGTITQNERRFVTKLLEDLVFFVVDIPNNGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELNDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFRFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICNAVLNPANADILIETKLVLSRFEVESGEGPMESEIDE---EEVWLFWKNSNKEVKSKSIRELAQDAKEGQKDDQDVISYYRYQLNLFARMCLDRQYLAIEKISGQLDV---DLILRCMSDEDLPYDLRASFCRLMLHMHVDRDPQEQVMPVKYARLWSEIPSKIAIDDY-----DNDGTSRDEIKER-----FALTMDFVENYLRDVVLQNVPFSDKEKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLAILDCVHVSTIYPINKMEKGDDNVMKSIHGVGELMTQVVLRGGGFLPTTPTTPPDGDVVKTQTEPEKEDILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDETPAPNADGPNSIPNIPVKSHVSTENTPL----------DLDDHGGRT-------FLRVLLHLTMHDYPPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKSDLDQLRSNVEKSELWVYKRQGDEGMDGGDGLPAESDHKKKILLRLSKLC-----VQEGKKQQQRLLRNMGAHSVVLELLQIP-----YEKDVRMQEIMKLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILE---AITMQHIFMNNFQLCSEMNERVVQHFVHCIETHGRHV-QYLKFLQTIVKAE--NKFIKKCQDIVMAELVNSGEDVLVFYNDRASFQTLVQMMRSERDRMDE---NSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHKDCIPEVKIAYINFLNHCYV-----DTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTTLESYVTETVMSIVTTFFSSPF 1425          

HSP 2 Score: 178.718 bits (452), Expect = 6.605e-44
Identity = 134/560 (23.93%), Postives = 256/560 (45.71%), Query Frame = -3
Query: 1061 KAFKFYKKNSVSIELLKGD-YLQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNI---SKYNNSLPDFFRNPVPDWKPRF--ENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF--------------NT-----------------------------EKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQK 2575
            +A +FY K++  IE+++ D  ++++ F + N    + +E K  V +  +R    +KI DF   S+ + N++ +QKK    PI  + +     W+     L+V++NL++   +     G+ + + +    +    SL      P P          +   +F+ GL   +   FLL  + + +     ++ +    +  R                G      ++ ++  +  Y+   L     G +   +F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+G+  F+  F              NT                             +K   CDSL  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+FF + ++   + ++T  + +VA ++++   D+FP  RA+ L + D +   ++I  L + + + +    +  S+    +E +R+K
Sbjct: 2048 EALEFYAKHTAQIEIVRLDRTMEQIVFPVPNICEFLTQESKLRVYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPILYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLEGGGTLEPHLSALLWAAMLVSLAIVIVLPQPHGIRALIASTILRLIFSVGLEPTL---FLLGAFNVGN-----KVIFLMSFVGNR----------------GTFTRGYKAMIMDVEFLYHLLYLIICSLGVFVHVFFYSLLLFDLIYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIIFKDDFILTVDRISNKTLGENTSKMGEFLAGAVCRKEENSVGVQSSALVIEDKERTCDSLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEFTGPESYVAEMIRDHNLDWFPRMRAMSLVSSDAEGEQNEIRSLQEKLESTMKLISNLSSQLTELKEQVREK 2578          
BLAST of SMED30029683 vs. Ensembl Zebrafish
Match: itpr1b (inositol 1,4,5-trisphosphate receptor, type 1b [Source:ZFIN;Acc:ZDB-GENE-070604-2])

HSP 1 Score: 217.624 bits (553), Expect = 1.177e-55
Identity = 346/1545 (22.39%), Postives = 629/1545 (40.71%), Query Frame = -3
Query: 4916 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVDEES------------------NVILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFML---VNGKSV---------KARQKLLRNLRVIDLLVKLLNMPLYGQPD-------------EANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCV-------------CNGV------GIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEK--VQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTY--MIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDG---SRDLPFPPERQG---------KELSKEKKKIVQKYQQGDRYLQ------------------SKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFK-ECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLR------------------------MMAKSKWSDEQ---VNRMEN------IFSELIEFCHLPKAP--EEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPF 9013
            IGD   LY E  T+G++   ST    ++  +   +     N P    D Q   F++   NRY   K++  K A     +  D     L ++   AA+ E   N +E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  E  ++GG  V+LFH E E ++       D   ++ H+ +R   + +A T  TS+ A+  W+IE  +     G    W+  FRF+H  T  YLA + +S                  +++ V +  D  ++F+L P      +  V   SY R+ H+ +  W+H+  +   K       E+E+ +         + ++     +   +A+ I  V P   R  +F       L ++   +L++  +   E   V     ++  F++    NG+ V         + RQKL+R   ++  + KLL  P     D              A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV             CN V       I+     +  R+ +E   G   +E  +   E+  + + +++      ++ +  Q    G  D++  + +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C +++ + VD      V+         + P +  + +Y      N  T+ D+   +     F    D++  +L +     +  S  E N L  +V+ L   L+ FG+Y +  D+  L   L+ ++D    S   P     +G         K +    + + Q   +G  +L                    KE   +++ K   +E+LQ ILN   + R++  +  FK E + N        P+S+       F   E++   +              E  T + +D         +L++L  + Y  +   AL +L   +S +Q+   A  +  +L+T+     ++++   +  LR                        + A+   SD++    N  +N      I   L + C + + P  ++     QR+L +     VV+E+L +  +     +  +  K+  + LQ   A      + QNQ  + +++++ L   ++E   AIT++ +F+NN  LC ++  R +   V     H +   ++L  L  IVK E     +K+ Q +VM  ++ S       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L  Y+ E+   +V    + PF
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPESGDLNNPPKKFRDCQ---FRLCPMNRYSAQKQFW-KAAKPGGNSTTDT---VLLNKLHHAADLEKKQNESENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWSDNKEAILKGGDVVRLFHAEQEKFLTC-----DEHRKKQHVFLRTTGRQSA-TSATSSKAL--WEIEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAELDSEHEALRARLRTPNEKVMYSLVSVPDGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNNPIDK-------EEEKPV---------MLRIGTSAVKEDKEAFAIVPVPPAEVRDLDFANDASKVLASI-AGKLEKGTITQNERRFVTKLLEDLVFFVVDIPNNGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELNDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFRFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICNAVLNPANADILIETKLVLSRFEVESGEGPMESEIDE---EEVWLFWKNSNKEVKSKSIRELAQDAKEGQKDDQDVISYYRYQLNLFARMCLDRQYLAIEKISGQLDV---DLILRCMSDEDLPYDLRASFCRLMLHMHVDRDPQEQVMPVKYARLWSEIPSKIAIDDY-----DNDGTSRDEIKER-----FALTMDFVENYLRDVVLQNVPFSDKEKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLAILDCVHVSTIYPINKMEKGDESKSSNVMKSIHGVGELMTQVVLRGGGFLPTTPTTPPDGDVVKTQTEPEKEDILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDEN-------GPNSIPNIPALDFENIEEQAEGIFGGS----------EENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKSDLDQLRSNVEKSELWVYKRQGDEGMDGGDGLPAEDSGSDKKKTDGNGSDNYRDVKEILLRLSKLC-VQEGPSGKKSKKQQQRLLRNMGAHSVVLELLQIPYEKGEDVRMQEIMKLAHEFLQNFCAG-----NQQNQALLHKHINLFLNPGILE---AITMQHIFMNNFQLCSEMNERVVQHFVHCIETHGRHV-QYLKFLQTIVKAE--NKFIKKCQDIVMAELVNSGEDVLVFYNDRASFQTLVQMMRSERDRMDE---NSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHKDCIPEVKIAYINFLNHCYV-----DTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTTLESYVTETVMSIVTTFFSSPF 1459          

HSP 2 Score: 184.496 bits (467), Expect = 1.471e-45
Identity = 136/569 (23.90%), Postives = 262/569 (46.05%), Query Frame = -3
Query: 1025 KAFKFYKKNSVSIELLKGD-YLQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNI---SKYNNSLPDFFRNPVPDWKPRF--ENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF--------------NT--------------------------EKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 2575
            +A +FY K++  IE+++ D  ++++ F + N    + +E K  V +  +R    +KI DF   S+ + N++ +QKK    PI  + +     W+     L+V++NL++   +     G+ + + +    +    SL      P P          +   +F+ GL   +   FLL  + + +     ++ +    +  R                G      ++ ++  +  Y+   L     G +   +F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+G+  F+  F              N+                          +K   CDSL  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+FF + ++   + ++T  + +VA ++++   D+FP  RA+ L + D +   ++I  L + + + +    +  S+    +E + ++R QK+  G L +
Sbjct: 2087 EALEFYAKHTAQIEIVRLDRTMEQIVFPVPNICEFLTQESKLRVYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPILYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLEGGGTLEPHLSALLWAAMLVSLAIVIVLPQPHGIRALIASTILRLIFSVGLEPTL---FLLGAFNVGN-----KVIFLMSFVGNR----------------GTFTRGYKAMIMDVEFLYHLLYLIICSLGVFVHVFFYSLLLFDLIYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIIFKDDFILTVDRISNKTLGENSRCMGEFLAGAVCRKEENFQSSALVIEDKERTCDSLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEFTGPESYVAEMIRDHNLDWFPRMRAMSLVSSDAEGEQNEIRSLQEKLESTMKLISNLSSQLTELKEQMTEQRKQKQRIGLLGH 2626          
BLAST of SMED30029683 vs. Ensembl Zebrafish
Match: itpr1a (inositol 1,4,5-trisphosphate receptor, type 1a [Source:ZFIN;Acc:ZDB-GENE-070604-3])

HSP 1 Score: 217.238 bits (552), Expect = 1.710e-55
Identity = 352/1554 (22.65%), Postives = 627/1554 (40.35%), Query Frame = -3
Query: 4916 IGDFICLYCEETDGYVYSMSTSSFFNNLAIYHKQDRNQP--SHIPDP----QMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVDEES------------------NVILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFM------------LVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPD-------------EANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCV-------------CNGVGIVDNQTYIAQRWLLEDR---RGVYLTERGQNIHEQPNILYV----STDCMKSWIALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE---NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSR-DLPF--PPERQGKELSKEKKKI-------VQKYQQGDRYLQS------------------KETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFK-----ECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMA--------KSKWSDEQVNRME------------------------------NIFSELIEFCHLPK-APEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYILEQPMETREAVLKEELGEDH-VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFI-----------GNLGEEIH---YLTQYILESPHELVYYLLTKPF 9013
            IGD   LY E         STS F + L +   +   QP    + +P    +   F++   NRY   K++  K A     +  D     L ++   AA+ E   N +E ++     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  E  ++GG  V+LFH E E ++       D   ++ ++ +R   + +A T  TS+ A+  W++E  +     G    W+  FRF+H  T  YLA + +S                   ++ V +  D  ++F+L P      +  V   SY R+ H+ +  W+H+        Q     E++  M  I   G    K D        +A+ I  V P   R  +F       L ++   +L++  +   E   V     ++  F+            +   K  + RQKL+R   ++  + KLL  P     D              A F  +   CY +L  Y     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV             CN V    N   + +  L+  R    G  L E  +   E    +++    S   +KS  ++ +  Q    G+  D E + +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C M++ + VD      V          + P +  + +Y      N  T+SD+   +     F    +++  +L +    ++  + K E N L  +V+ L   L+ FG+Y +  D+  L   L+ ++D      PF    +R+  + S   + I        Q   +G  +L +                  K+   +++ K   +E+LQ ILN   + R++  +  FK        ++E  L  ++P+S+  AL   F   E++   +              E  T + +D         +L++L  + Y  +   AL +L   +S +Q+  QA  +  +L+T+     ++++   +  LR +         K + SD  ++  E                               I   L + C L   + ++     QR+L +     VV+E+L +       EK    +      L           + QNQ  + +++++ L   ++E   A+T++ +F+NN  LC +I  R +   V     H  ++  +L  L  IVK E     +K+ Q +VM  ++ +       Y+  A    Q +     + +E L E   ++Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+              N  +  H    L +Y+ E+   +V    + PF
Sbjct:   11 IGDVCSLYAEG--------STSGFISTLGLVDDRCVVQPDAGDLNNPPKKFRDCLFRLCPMNRYSAQKQFW-KAAKPGGTSTTDT---VLLNKLHHAADLEKKQNDSENKKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDAAGNEGSWFYIQPFYKLRSIGDNVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCTTSWKIVLFMKWSDNQEIVLKGGDVVRLFHAEQEKFLTC-----DEHRKKQYVFLRTTGRQSA-TSATSSKAL--WEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEMDSEHEVIRARARNPQDKVMYTLVSVPDGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHS------TNQPIDKEEEKPVMLRI---GTSPLKED-------KEAFAIVPVSPAEVRDLDFANDASKVLASIAA-KLEKGTITQNERRSVTKLLEDLVYFVVDIPSSAQDVLEITVNKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELADQRHAPFRHICRLCYRVL-RYSQQDYRKNQEYIAKQFRFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICNAVLDPANADILIETKLVLSRFEVAGTVLGEGAEEEEEDEEEVWLFWKDSGGEVKSK-SIRELAQDAKDGHTEDQEVINYYRYQLNLFARMCLDRQYLAINKISAQLDV---DLILRCMSDEDLPFDLRASFCRMMLHMHVDRDPQEQVTPVKYARLWSEIPSQISIDDY-----DNDGTSSDEVKER-----FSQTMEFVENYLRDVVCQSFPFSDK-EKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLAILDCVHISTPFHIKLDREPGKGSNVMRSIHGVGELMTQVVLRGGGFLPASSHNPPDRDEVKAQSEPQKQDILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKTEFDESNSQSEPSLSPESPASVQGAL--DFEHIEEQAEGIFGGS----------EENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSRALHLLFRHFSQRQEVLQAFKQVQLLVTSQDVENYKQIKSDLDQLRSIVEKSELWVYKRQGSDSGLDAGEVTPEAHHKVRIRSNKPKVESTSSSNYRVVKEILLRLSKLCVLEGISGKKNKKQQQRLLRNMGAHSVVLELLQIP-----YEKGEDVQMQEIMTLAHQFLQNFCAGNQQNQALLHKHINLFLNPGILE---AVTMQHIFMNNFQLCSEINERVVQHFVHCIETH-GRSVHYLKFLQTIVKAE--NKFIKKCQDIVMAELVTAGEDVLVFYNDRASF--QSLVQMMRLERERLDESSALRYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKMAYVNFLNHCYV-----DTEVEMKEIYTSNHMWKLFDDFLVDVCRVCNNTSDRKHADTVLERYVTETIMSIVTTFFSSPF 1474          

HSP 2 Score: 192.586 bits (488), Expect = 4.977e-48
Identity = 145/600 (24.17%), Postives = 270/600 (45.00%), Query Frame = -3
Query: 1013 LIITPN-QQKAFKFYKKNSVSIELLKGD-YLQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYN-------NSLPDFFRNPVPDWKPRF--ENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKN-------------------------------------LYC-----------------DSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSL 2599
            +++ P  + +A ++Y K++  IE+++ D  ++++ F + N  + +  E K  V +  +R    +KI DF   +  + N++R+QKK    P+  + +     W+     L+V++NL  L  F  P DG  +     S           SL     +P P+         +    F+ GL H +    LL  + + +     +I +    +  R                G      R  ++  +  ++   L   + G +   +F++  L ++V+  + L  VI +VT+NG+S++  A+LG++++YL++I+G+ FF+  F  E N                                     ++C                 DSLW C ++V+  GL     VGD+     P   E+    F+  V+Y L FF L+  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W Y+FF + ++   + +YT  + +VA ++KE   D+FP  RA+ L + D +   +++  L + + + +    +  ++    +E + ++R  K+  G L N   L
Sbjct: 2154 ILLKPGGEDQALEYYTKHTSQIEIVRQDRTMEQIVFPVPNICSFLTNESKLRVYYGTERDEQGSKINDFFLHADDLFNEMRWQKKLRAQPVLYWCSRNMSFWSNVSFNLAVLINL--LVAFFYPLDGVSESQLEPSLSLLLWVCLLGSLGFVLMSPRPNAVRVLVISTVLQLGFSVGLQHMLT---LLGAFNVCN-----KIVFMLSFVGNR----------------GSFTRGYRVMVMDREFLFHLLYLLICILGLFGHVFFYSLLLFDLVNREETLLNVIKSVTRNGRSIVLTAVLGLILVYLFSIVGYMFFKDDFILEVNRISNGTLAKAQTSDLLAVRRLFTIIINSCILILKCHKIHCLNPTDCVCFIDDVERACDSLWMCMITVLSHGLRSGGGVGDVLRK--PSKEER---LFAARVVYDLLFFFLVIIIVLNLIFGVIIDTFADLRSEKQRKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNLWHYLFFIVLVRVKDSTEYTGPESYVAQMIKEHNLDWFPRMRAMSLVSSDGEGEQNELRSLQEKLESTMRLVSNLTNQLTELKEQMTEQRKHKQRLGLLGNPAHL 2722          
BLAST of SMED30029683 vs. Ensembl Zebrafish
Match: itpr1b (inositol 1,4,5-trisphosphate receptor, type 1b [Source:ZFIN;Acc:ZDB-GENE-070604-2])

HSP 1 Score: 216.468 bits (550), Expect = 2.369e-55
Identity = 341/1531 (22.27%), Postives = 619/1531 (40.43%), Query Frame = -3
Query: 4916 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN-------------------------VILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFML---VNGKSV---------KARQKLLRNLRVIDLLVKLLNMPLYGQPD-------------EANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCV-------------CNGV------GIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEK--VQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTY--MIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDG---SRDLPFPPERQG-----KELSKEKKKIVQKYQQGDRYLQ------------------SKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRM-MAKSK-W-------------------SDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPF 9013
            IGD   LY E  T+G++   ST    ++  +   +     N P    D Q   F++   NRY   K++  K A     +  D     L ++   AA+ E   N +E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  E  ++GG  V+LFH E E ++       D   ++ H+ +R   + +A T  TS+ A+  W+IE  +     G    W+  FRF+H  T  YLA +   +                         ++ V +  D  ++F+L P      +  V   SY R+ H+ +  W+H+  +   K       E+E+ +         + ++     +   +A+ I  V P   R  +F       L ++   +L++  +   E   V     ++  F++    NG+ V         + RQKL+R   ++  + KLL  P     D              A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV             CN V       I+     +  R+ +E   G   +E  +   E+  + + +++      ++ +  Q    G  D++  + +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C +++ + VD      V+         + P +  + +Y      N  T+ D+   +     F    D++  +L +     +  S  E N L  +V+ L   L+ FG+Y +  D+  L   L+ ++D    S   P     +G     K +    + + Q   +G  +L                    KE   +++ K   +E+LQ ILN   + R++  +  FK             P+  A    +G N     P            ++      T + +D         +L++L  + Y  +   AL +L   +S +Q+   A  +  +L+T+     ++++   +  LR  + KS+ W                   SD +   +  I   L + C      +E     QR+L +     VV+E+L +       EK  + +++++ A + L+         Q  + +++++ L   ++E   AIT++ +F+NN  LC ++  R +   V     H +   ++L  L  IVK E     +K+ Q +VM  ++ S       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L  Y+ E+   +V    + PF
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPESGDLNNPPKKFRDCQ---FRLCPMNRYSAQKQFW-KAAKPGGNSTTDT---VLLNKLHHAADLEKKQNESENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWSDNKEAILKGGDVVRLFHAEQEKFLTC-----DEHRKKQHVFLRTTGRQSA-TSATSSKAL--WEIEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVNPDYEEESQESRSSVTRLRTPNEKVMYSLVSVPDGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNNPIDK-------EEEKPV---------MLRIGTSAVKEDKEAFAIVPVPPAEVRDLDFANDASKVLASI-AGKLEKGTITQNERRFVTKLLEDLVFFVVDIPNNGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELNDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFRFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICNAVLNPANADILIETKLVLSRFEVESGEGPMESEIDE---EEVWLFWKNSNKEVKSKSIRELAQDAKEGQKDDQDVISYYRYQLNLFARMCLDRQYLAIEKISGQLDV---DLILRCMSDEDLPYDLRASFCRLMLHMHVDRDPQEQVMPVKYARLWSEIPSKIAIDDY-----DNDGTSRDEIKER-----FALTMDFVENYLRDVVLQNVPFSDKEKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLAILDCVHVSTIYPINKMEKGDDNVMKSIHGVGELMTQVVLRGGGFLPTTPTTPPDGDVVKTQTEPEKEDILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNTQTDTAPAPNA----DGPNSIPNIP------------VKSHVSTNTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKSDLDQLRSNVEKSELWVYKRQGDEGMDGGDGLPAESDHKKKVL--ILLRLSKLC-----VQEGKKQQQRLLRNMGAHSVVLELLQIP-----YEKDVRMQEIMKLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILE---AITMQHIFMNNFQLCSEMNERVVQHFVHCIETHGRHV-QYLKFLQTIVKAE--NKFIKKCQDIVMAELVNSGEDVLVFYNDRASFQTLVQMMRSERDRMDE---NSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHKDCIPEVKIAYINFLNHCYV-----DTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTTLESYVTETVMSIVTTFFSSPF 1440          

HSP 2 Score: 182.956 bits (463), Expect = 4.088e-45
Identity = 134/551 (24.32%), Postives = 256/551 (46.46%), Query Frame = -3
Query: 1061 KAFKFYKKNSVSIELLKGD-YLQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNI---SKYNNSLPDFFRNPVPDWKPRF--ENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF--------------NT--------------------EKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQK 2575
            +A +FY K++  IE+++ D  ++++ F + N    + +E K  V +  +R    +KI DF   S+ + N++ +QKK    PI  + +     W+     L+V++NL++   +     G+ + + +    +    SL      P P          +   +F+ GL   +   FLL  + + +     ++ +    +  R                G      ++ ++  +  Y+   L     G +   +F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+G+  F+  F              NT                    +K   CDSL  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+FF + ++   + ++T  + +VA ++++   D+FP  RA+ L + D +   ++I  L + + + +    +  S+    +E +R+K
Sbjct: 2052 EALEFYAKHTAQIEIVRLDRTMEQIVFPVPNICEFLTQESKLRVYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPILYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLEGGGTLEPHLSALLWAAMLVSLAIVIVLPQPHGIRALIASTILRLIFSVGLEPTL---FLLGAFNVGN-----KVIFLMSFVGNR----------------GTFTRGYKAMIMDVEFLYHLLYLIICSLGVFVHVFFYSLLLFDLIYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIIFKDDFILTVDRISNKTLGENTTTGNKKNCNCVTSSSALVIEDKERTCDSLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEFTGPESYVAEMIRDHNLDWFPRMRAMSLVSSDAEGEQNEIRSLQEKLESTMKLISNLSSQLTELKEQVREK 2573          
BLAST of SMED30029683 vs. Ensembl Xenopus
Match: rasgrp1 (RAS guanyl releasing protein 1 [Source:Xenbase;Acc:XB-GENE-489811])

HSP 1 Score: 241.891 bits (616), Expect = 7.827e-63
Identity = 341/1490 (22.89%), Postives = 624/1490 (41.88%), Query Frame = -3
Query: 4997 IGDFICLYCEETD-GYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLR-KFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVD-EESNVIL-------------VKESRDPRTVFKLHPV-IQDSEE-VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLV----NGKSV---------KARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVH--------------LECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNI-----------HEQPNILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSV---------VDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYY-------------GDVDDV---RSLLDKLIGLIDGS---------------RDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELRE-MFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSDEQVNR---------------------MENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNL 9013
            IGD + LY E T  G++   ST    ++  +         N P    D     F++   NRY   K+Y + K A  + E + D     L  + + AA  E   N  E ++   + V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P +K++S G+ V + D++ L  + + G   HAS  + L +     E+N     + + I     + D  E  ++GG  V+LFH E E ++       D    ++H+ +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA +  E ++++             V    D  ++F+L P  +Q ++  V   S+ R+ H+ +  W+          Q  +   D      IR   G          +   +A+ I  V     R  +F       L N +E RL E F+ ++   R  +   E   F +V    NG++V         + RQKL+R   ++  +  +L  P   +  +   L++                 CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L      + +   G+ +            E  ++ Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I+K LS    +  FL +  E+LP ++RA +C +++ + VD      V          + P    + +Y    D N   + D    K   +    + D++   + E+  M  S  + N L  +V+ L   L+ FG+Y             G +D V   +S+L + I   DG+                 +    ++ G   S+    +V       R     E   ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + N +      ++  N      +++   +  I EL E MF +T+ +++D         +LI L    Y  +   +L++L   +S +Q+      +  +L++T     ++ +  ++  LR M +    W D++ N                      ++ I   L + C+    PE+     QR+L + +   V++++L V  + + T    + +++L+   Q L+      P+ Q  + ++L + L   L E+E   T++ +F+NN  LC +I    +   +   A H +   ++LD L  I+K E  G  +K+ Q ++M  +  +           +S A +LE     REA+  EE     ++Y ISL++LL+ CAEG+N Y E  C ++L +ED++ V+ H +    +K  ++ ++   Y+      +E    EI     IW    N 
Sbjct:   10 IGDIVSLYAEGTVCGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFRVCPMNRYSAQKQYWKAKQAKQDKEKISDV---LLLQKLQHAANLEQKQNETENKKVHGEVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDVTGNEGSWFFIQPFWKLRSNGDNVVVGDKVNLNPVNA-GQPLHAS-NYELTDNPGCKEVNSLNSNTSWKINLFMQYRDYMEDVLKGGDVVRLFHAEQEKFLTC-----DEYKSRLHVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNSLYRFKHLATGHYLAAEVREGSLVMQGPEKMIKFRLVAVPHGNDIASLFELDPTTLQKTDSLVPRNSFVRLRHLCTNTWI----------QSTNVPIDVDEERPIRLMLG------TCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLANFVE-RLNEGFI-SQNDRRFAIKLLEDLVFFVVDVSNNGQNVLDIMITKPNRERQKLMREQNILKQIFGILKAPFKEKGTDGPLLRLEELSDQKNSPYQYMFRLCYRVL-RHSQEDYRKNQEHIAKQFGVMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVNLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIKTEGEGVLSILEGGGKMSPEYMSLEYCDEEVWLTWTDKNNDSHEKSIRQLSQEARAGNAHDENVLTYYRYQLKLFARMCLDRQYLAIHEISKQLSV---DLIFLCMADEMLPYEIRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPMAITIKDY----DSNLNDSRDNKKNK-FTSTMEFVEDYLNNVVSES--MPFSHEDKNKLTFEVVSLARHLIYFGFYSFSELLRLTRTLLGIIDCVQNPQSILLQAIYSEDGTGKNVRRSIHGVGQMVSTMVLNRKQTGYSSSQSLSSVVNHETPIKRKNVDMENIIVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDNAADGTAPAFDSTN------ASLNLDR--IGELAEAMFGSTSMLEVDDEGGRMFLRVLIQLTMNDYPSLISGSLQLLFKHFSQRQEVLHTFKQVQLLISTQDVDNYKVIKSELDRLRTMVEKSELWVDKKGNTGIIGSTDGKPVMEKSSENYQIVKGILETLNKMCN---GPEQVRKKQQRLLKNMDAHKVMLDLLQVPYEKEDT----KMKEILKYTHQFLQKFCATNPENQALLHKHLSLFLTPGLQEAE---TMQHIFLNNYQLCSEIHEAVLQHFIHCLATHGRHV-QYLDFLHTIIKAE--GKYIKKCQDMIMTELTNAGDDVVVFYNDKASFASMLEMMATAREAI--EE--NSPLKYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVRVVTHEDCITEVKISYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENF 1416          

HSP 2 Score: 144.05 bits (362), Expect = 3.763e-33
Identity = 132/518 (25.48%), Postives = 239/518 (46.14%), Query Frame = -3
Query: 1052 IREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF-------------------------NTEKNLY----------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEELLRQKRWQ 2476
            + EE K  V    ++    +K+ DF D S  + N++ +Q+K  + P+  +F+    LW      L+V +NL+ +  F    +G  D           +   F   V      F  +  +   +G    ++   L   Y+L   P+       +IL    L  N++      +  +G      ++ ++  +  Y+ A +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +  F                          T+K L           CD+L  C ++V+  GL     VGD+     P   E     F   ++Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I  L   L +   L++H   + SE K   E  R ++WQ
Sbjct: 2084 LTEETKHRVFTTTEQDDQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGTISFNLAVFINLI-IAFFYPYVEGILDSPL--------ISLLFWGMVC-----FSVMSLFTKRYGFRPLIVALILRSVYYLGIGPT------LYILGALNLT-NKIVFVVSFVGNRGTFIRGYKAMVMDVEFLYHVAYILTSVLGLFIHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFIMEVDRLPKGKRDLFPAVRLGSLTPPTKKKLLLWEEGDVERACDTLLMCIITVLNHGLRNGGGVGDILRK--PSKDET---LFPARIVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKEEHNIWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLGSTMRLVSHLTMQLSELK---EQQRSQQWQ 2572          
BLAST of SMED30029683 vs. Ensembl Xenopus
Match: rasgrp1 (RAS guanyl releasing protein 1 [Source:Xenbase;Acc:XB-GENE-489811])

HSP 1 Score: 237.654 bits (605), Expect = 1.231e-61
Identity = 356/1560 (22.82%), Postives = 645/1560 (41.35%), Query Frame = -3
Query: 4880 IGDFICLYCEETD-GYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLR-KFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLA--VDEESNVILVKESR---------------------DPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLV----NGKSV---------KARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVH--------------LECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWL----------LEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSV---------VDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYY-------------GDVDDV---RSLLDKLIGLIDGS---------------RDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELRE-MFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSDEQVNR--------------------------------MENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI---------HYLTQYILESPHELVYYLLTKPFPKH---LKTHLTCSI 9013
            IGD + LY E T  G++   ST    ++  +         N P    D     F++   NRY   K+Y + K A  + E + D     L  + + AA  E   N  E ++   + V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P +K++S G+ V + D++ L  + + G   HAS  + L +     E+N     + + I     + D  E  ++GG  V+LFH E E ++       D    ++H+ +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA  V E S V+ V +S                      D  ++F+L P  +Q ++  V   S+ R+ H+ +  W+          Q  +   D      IR   G          +   +A+ I  V     R  +F       L N +E RL E F+ ++   R  +   E   F +V    NG++V         + RQKL+R   ++  +  +L  P   +  +   L++                 CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L           E    + + E G +   + ++ Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I+K LS    +  FL +  E+LP ++RA +C +++ + VD      V          + P    + +Y    D N   + D    K   +    + D++   + E+  M  S  + N L  +V+ L   L+ FG+Y             G +D V   +S+L + I   DG+                 +    ++ G   S+    +V       R     E   ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + N +      ++  N      +++   +  I EL E MF +T+ +++D         +LI L    Y  +   +L++L   +S +Q+      +  +L++T     ++ +  ++  LR M +    W D++ N                                 ++ I   L + C+    PE+     QR+L + +   V++++L V  + + T    + +++L+   Q L+      P+ Q  + ++L + L   L E+E   T++ +F+NN  LC +I    +   +   A H +   ++LD L  I+K E  G  +K+ Q ++M  +  +           +S A +LE     REA+  EE     ++Y ISL++LL+ CAEG+N Y E  C ++L +ED++ V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++           L +Y+L    E +      PF ++   L+TH T  +
Sbjct:   10 IGDIVSLYAEGTVCGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFRVCPMNRYSAQKQYWKAKQAKQDKEKISDV---LLLQKLQHAANLEQKQNETENKKVHGEVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDVTGNEGSWFFIQPFWKLRSNGDNVVVGDKVNLNPVNA-GQPLHAS-NYELTDNPGCKEVNSLNSNTSWKINLFMQYRDYMEDVLKGGDVVRLFHAEQEKFLTC-----DEYKSRLHVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNSLYRFKHLATGHYLAAEVREGSLVMQVDKSHYFRKNAGEKIKFRLVAVPHGNDIASLFELDPTTLQKTDSLVPRNSFVRLRHLCTNTWI----------QSTNVPIDVDEERPIRLMLG------TCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLANFVE-RLNEGFI-SQNDRRFAIKLLEDLVFFVVDVSNNGQNVLDIMITKPNRERQKLMREQNILKQIFGILKAPFKEKGTDGPLLRLEELSDQKNSPYQYMFRLCYRVL-RHSQEDYRKNQEHIAKQFGVMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVNLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIKTEGEGVLSILEGGGSRRGERDLEYCDEEVWLTWTDKNNDSHEKSIRQLSQEARAGNAHDENVLTYYRYQLKLFARMCLDRQYLAIHEISKQLSV---DLIFLCMADEMLPYEIRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPMAITIKDY----DSNLNDSRDNKKNK-FTSTMEFVEDYLNNVVSES--MPFSHEDKNKLTFEVVSLARHLIYFGFYSFSELLRLTRTLLGIIDCVQNPQSILLQAIYSEDGTGKNVRRSIHGVGQMVSTMVLNRKQTGYSSSQSLSSVVNHETPIKRKNVDMENIIVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDNAADGTAPAFDSTN------ASLNLDR--IGELAEAMFGSTSMLEVDDEGGRMFLRVLIQLTMNDYPSLISGSLQLLFKHFSQRQEVLHTFKQVQLLISTQDVDNYKVIKSELDRLRTMVEKSELWVDKKGNTGIIGSTDGNKKDKKEDNSGKPVMEKSSENYQIVKGILETLNKMCN---GPEQVRKKQQRLLKNMDAHKVMLDLLQVPYEKEDT----KMKEILKYTHQFLQKFCATNPENQALLHKHLSLFLTPGLQEAE---TMQHIFLNNYQLCSEIHEAVLQHFIHCLATHGRHV-QYLDFLHTIIKAE--GKYIKKCQDMIMTELTNAGDDVVVFYNDKASFASMLEMMATAREAI--EE--NSPLKYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVRVVTHEDCITEVKISYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFILDMARVKKRIVDSTLEKYVLTVVLETIRSFFNSPFSENSTSLQTHQTIVV 1486          

HSP 2 Score: 140.584 bits (353), Expect = 3.960e-32
Identity = 132/532 (24.81%), Postives = 247/532 (46.43%), Query Frame = -3
Query: 1088 SVSIELLKGDY-LQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF-------------------------NTEKNLY----------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERK 2548
            +  IE+++ D  ++++ F + +    + EE K  V    ++    +K+ DF D S  + N++ +Q+K  + P+  +F+    LW      L+V +NL++   F  P    + E  +I K                  R   +  +   +G    ++   L   Y+L   P+       +IL    L  N++      +  +G      ++ ++  +  Y+ A +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +  F                          T+K L           CD+L  C ++V+  GL     VGD+     P   E     F   ++Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I  L   L +   L++H   + SE K
Sbjct: 2081 TAQIEIVRMDRSMEQIVFSVPSICKFLTEETKHRVFTTTEQDDQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGTISFNLAVFINLII--AFFYP----YVEGTSIGK------------------RLFIMSLFTKRYGFRPLIVALILRSVYYLGIGPT------LYILGALNLT-NKIVFVVSFVGNRGTFIRGYKAMVMDVEFLYHVAYILTSVLGLFIHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFIMEVDRLPKGKRDLFPAVRLGSLTPPTKKKLLLWEEGDVERACDTLLMCIITVLNHGLRNGGGVGDILRK--PSKDET---LFPARIVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKEEHNIWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLGSTMRLVSHLTMQLSELK 2576          
BLAST of SMED30029683 vs. Ensembl Xenopus
Match: rasgrp1 (RAS guanyl releasing protein 1 [Source:Xenbase;Acc:XB-GENE-489811])

HSP 1 Score: 236.498 bits (602), Expect = 3.250e-61
Identity = 354/1562 (22.66%), Postives = 644/1562 (41.23%), Query Frame = -3
Query: 4880 IGDFICLYCEETD-GYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLR-KFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLA--VDEESNVILVKESR---------------------DPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLV----NGKSV---------KARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVH--------------LECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNI----------HEQPNILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSV---------VDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYY-------------GDVDDV---RSLLDKLIGLIDGS---------------RDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELRE-MFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSDEQVNR----------------------------------MENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI---------HYLTQYILESPHELVYYLLTKPFPKH---LKTHLTCSI 9013
            IGD + LY E T  G++   ST    ++  +         N P    D     F++   NRY   K+Y + K A  + E + D     L  + + AA  E   N  E ++   + V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P +K++S G+ V + D++ L  + + G   HAS  + L +     E+N     + + I     + D  E  ++GG  V+LFH E E ++       D    ++H+ +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA  V E S V+ V +S                      D  ++F+L P  +Q ++  V   S+ R+ H+ +  W+          Q  +   D      IR   G          +   +A+ I  V     R  +F       L N +E RL E F+ ++   R  +   E   F +V    NG++V         + RQKL+R   ++  +  +L  P   +  +   L++                 CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L      + +   G+ +            + ++ Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I+K LS    +  FL +  E+LP ++RA +C +++ + VD      V          + P    + +Y    D N   + D    K   +    + D++   + E+  M  S  + N L  +V+ L   L+ FG+Y             G +D V   +S+L + I   DG+                 +    ++ G   S+    +V       R     E   ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + N +      ++  N      +++   +  I EL E MF +T+ +++D         +LI L    Y  +   +L++L   +S +Q+      +  +L++T     ++ +  ++  LR M +    W D++ N                                   ++ I   L + C+    PE+     QR+L + +   V++++L V  + + T    + +++L+   Q L+      P+ Q  + ++L + L   L E+E   T++ +F+NN  LC +I    +   +   A H +   ++LD L  I+K E  G  +K+ Q ++M  +  +           +S A +LE     REA+  EE     ++Y ISL++LL+ CAEG+N Y E  C ++L +ED++ V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++           L +Y+L    E +      PF ++   L+TH T  +
Sbjct:   10 IGDIVSLYAEGTVCGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFRVCPMNRYSAQKQYWKAKQAKQDKEKISDV---LLLQKLQHAANLEQKQNETENKKVHGEVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDVTGNEGSWFFIQPFWKLRSNGDNVVVGDKVNLNPVNA-GQPLHAS-NYELTDNPGCKEVNSLNSNTSWKINLFMQYRDYMEDVLKGGDVVRLFHAEQEKFLTC-----DEYKSRLHVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNSLYRFKHLATGHYLAAEVREGSLVMQVDKSHYFRKNAGEKIKFRLVAVPHGNDIASLFELDPTTLQKTDSLVPRNSFVRLRHLCTNTWI----------QSTNVPIDVDEERPIRLMLG------TCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLANFVE-RLNEGFI-SQNDRRFAIKLLEDLVFFVVDVSNNGQNVLDIMITKPNRERQKLMREQNILKQIFGILKAPFKEKGTDGPLLRLEELSDQKNSPYQYMFRLCYRVL-RHSQEDYRKNQEHIAKQFGVMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVNLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIKTEGEGVLSILEGGGSRRGERDLEYCDEEVWLTWTDKNNDSHEKSIRQLSQEARAGNAHDENVLTYYRYQLKLFARMCLDRQYLAIHEISKQLSV---DLIFLCMADEMLPYEIRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPMAITIKDY----DSNLNDSRDNKKNK-FTSTMEFVEDYLNNVVSES--MPFSHEDKNKLTFEVVSLARHLIYFGFYSFSELLRLTRTLLGIIDCVQNPQSILLQAIYSEDGTGKNVRRSIHGVGQMVSTMVLNRKQTGYSSSQSLSSVVNHETPIKRKNVDMENIIVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDNAADGTAPAFDSTN------ASLNLDR--IGELAEAMFGSTSMLEVDDEGGRMFLRVLIQLTMNDYPSLISGSLQLLFKHFSQRQEVLHTFKQVQLLISTQDVDNYKVIKSELDRLRTMVEKSELWVDKKGNTGIIGSTDGNKKDKKENQDNSGKPVMEKSSENYQIVKGILETLNKMCN---GPEQVRKKQQRLLKNMDAHKVMLDLLQVPYEKEDT----KMKEILKYTHQFLQKFCATNPENQALLHKHLSLFLTPGLQEAE---TMQHIFLNNYQLCSEIHEAVLQHFIHCLATHGRHV-QYLDFLHTIIKAE--GKYIKKCQDMIMTELTNAGDDVVVFYNDKASFASMLEMMATAREAI--EE--NSPLKYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVRVVTHEDCITEVKISYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFILDMARVKKRIVDSTLEKYVLTVVLETIRSFFNSPFSENSTSLQTHQTIVV 1488          

HSP 2 Score: 132.88 bits (333), Expect = 9.180e-30
Identity = 131/548 (23.91%), Postives = 247/548 (45.07%), Query Frame = -3
Query: 1088 SVSIELLKGDY-LQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSG------------------------------------FNTEKNLY---------------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERK 2548
            +  IE+++ D  ++++ F + +    + EE K  V    ++    +K+ DF D S  + N++ +Q+K  + P+  +F+    LW      L+V +NL++   F  P    + E  +I K                  R   +  +   +G    ++   L   Y+L   P+       +IL    L  N++      +  +G      ++ ++  +  Y+ A +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +                                      FN+  + Y               CD+L  C ++V+  GL     VGD+     P   E     F   ++Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I  L   L +   L++H   + SE K
Sbjct: 2106 TAQIEIVRMDRSMEQIVFSVPSICKFLTEETKHRVFTTTEQDDQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGTISFNLAVFINLII--AFFYP----YVEGTSIGK------------------RLFIMSLFTKRYGFRPLIVALILRSVYYLGIGPT------LYILGALNLT-NKIVFVVSFVGNRGTFIRGYKAMVMDVEFLYHVAYILTSVLGLFIHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFIMEVDRLPKGNFIAPCMDCMDFLLDRRLHWLVFFFFNSPYSSYTYIVLLDEEGDVERACDTLLMCIITVLNHGLRNGGGVGDILRK--PSKDET---LFPARIVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKEEHNIWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLGSTMRLVSHLTMQLSELK 2617          
BLAST of SMED30029683 vs. Ensembl Xenopus
Match: rasgrp1 (RAS guanyl releasing protein 1 [Source:Xenbase;Acc:XB-GENE-489811])

HSP 1 Score: 234.958 bits (598), Expect = 9.668e-61
Identity = 352/1554 (22.65%), Postives = 640/1554 (41.18%), Query Frame = -3
Query: 4889 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLR-KFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVD-EESNVILVKESR------------------DPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLV----NGKSV---------KARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVH--------------LECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQP---NILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSV---------VDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYY-------------GDVDDV---RSLLDKLIGLIDGS---------------RDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSDEQVNR-------------------------------------MENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI-------------HYLTQYILESPHELVYYLLTKPFPKH---LKTHLT 9013
            IGD + LY E T  G++   ST    ++  +         N P    D     F++   NRY   K+Y + K A  + E + D     L  + + AA  E   N  E ++   + V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P +K++S G+ V + D++ L  + + G   HAS  + L +     E+N     + + I     + D  E  ++GG  V+LFH E E ++       D    ++H+ +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA +  E ++++ + SR                  D  ++F+L P  +Q ++  V   S+ R+ H+ +  W+          Q  +   D      IR   G          +   +A+ I  V     R  +F       L N +E RL E F+ ++   R  +   E   F +V    NG++V         + RQKL+R   ++  +  +L  P   +  +   L++                 CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I  + +L+ +    L +    I   P   N+ Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I+K LS    +  FL +  E+LP ++RA +C +++ + VD      V          + P    + +Y    D N   + D    K   +    + D++   + E+  M  S  + N L  +V+ L   L+ FG+Y             G +D V   +S+L + I   DG+                 +    ++ G   S+    +V       R     E   ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + N +       +G  P  + P       L+ + L      T+ +++D         +LI L    Y  +   +L++L   +S +Q+      +  +L++T     ++ +  ++  LR M +    W D++ N                                      ++ I   L + C+    PE+     QR+L + +   V++++L V  + + T    + +++L+   Q L+      P+ Q  + ++L + L   L E+E   T++ +F+NN  LC +I    +   +   A H +   ++LD L  I+K E  G  +K+ Q ++M  +  +           +S A +LE     REA+  EE     ++Y ISL++LL+ CAEG+N Y E  C ++L +ED++ V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++               L +Y+L    E +      PF ++   L+TH T
Sbjct:   10 IGDIVSLYAEGTVCGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFRVCPMNRYSAQKQYWKAKQAKQDKEKISDV---LLLQKLQHAANLEQKQNETENKKVHGEVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDVTGNEGSWFFIQPFWKLRSNGDNVVVGDKVNLNPVNA-GQPLHAS-NYELTDNPGCKEVNSLNSNTSWKINLFMQYRDYMEDVLKGGDVVRLFHAEQEKFLTC-----DEYKSRLHVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNSLYRFKHLATGHYLAAEVREGSLVITRPSRKNAGEKIKFRLVAVPHGNDIASLFELDPTTLQKTDSLVPRNSFVRLRHLCTNTWI----------QSTNVPIDVDEERPIRLMLG------TCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLANFVE-RLNEGFI-SQNDRRFAIKLLEDLVFFVVDVSNNGQNVLDIMITKPNRERQKLMREQNILKQIFGILKAPFKEKGTDGPLLRLEELSDQKNSPYQYMFRLCYRVL-RHSQEDYRKNQEHIAKQFGVMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVNLVRKNREPRFLDYLSDLCVSNHIAIPVTQELIC-KCVLDPKNSDILIKTDLQITCPPRMSNLQYCDEEVWLTWTDKNNDSHEKSIRQLSQEARAGNAHDENVLTYYRYQLKLFARMCLDRQYLAIHEISKQLSV---DLIFLCMADEMLPYEIRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPMAITIKDY----DSNLNDSRDNKKNK-FTSTMEFVEDYLNNVVSES--MPFSHEDKNKLTFEVVSLARHLIYFGFYSFSELLRLTRTLLGIIDCVQNPQSILLQAIYSEDGTGKNVRRSIHGVGQMVSTMVLNRKQTGYSSSQSLSSVVNHETPIKRKNVDMENIIVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDNAA-------DG-TPLLRSP-------LVPQPLGNEQRGTSMLEVDDEGGRMFLRVLIQLTMNDYPSLISGSLQLLFKHFSQRQEVLHTFKQVQLLISTQDVDNYKVIKSELDRLRTMVEKSELWVDKKGNTGIIGSTDGNKKDKKEHVENQDNSGKPVMEKSSENYQIVKGILETLNKMCN---GPEQVRKKQQRLLKNMDAHKVMLDLLQVPYEKEDT----KMKEILKYTHQFLQKFCATNPENQALLHKHLSLFLTPGLQEAE---TMQHIFLNNYQLCSEIHEAVLQHFIHCLATHGRHV-QYLDFLHTIIKAE--GKYIKKCQDMIMTELTNAGDDVVVFYNDKASFASMLEMMATAREAI--EE--NSPLKYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVRVVTHEDCITEVKISYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFILDMARVCNKREKRIVDSTLEKYVLTVVLETIRSFFNSPFSENSTSLQTHQT 1472          

HSP 2 Score: 140.198 bits (352), Expect = 4.803e-32
Identity = 131/535 (24.49%), Postives = 247/535 (46.17%), Query Frame = -3
Query: 1073 SVSIELLKGDY-LQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLY---------------------------------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERKRFEEL 2548
            +  IE+++ D  ++++ F + +    + EE K  V    ++    +K+ DF D S  + N++ +Q+K  + P+  +F+    LW      L+V +NL+ +  F    +G  D           +   F   V      F  +  +   +G    ++   L   Y+L   P+       +IL    L  N++      +  +G      ++ ++  +  Y+ A +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +  F  E +                                   CD+L  C ++V+  GL     VGD+     P   E     F   ++Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I  L   L +   L++H   + SE K   +L
Sbjct: 2071 TAQIEIVRMDRSMEQIVFSVPSICKFLTEETKHRVFTTTEQDDQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGTISFNLAVFINLI-IAFFYPYVEGILDSPL--------ISLLFWGMVC-----FSVMSLFTKRYGFRPLIVALILRSVYYLGIGPT------LYILGALNLT-NKIVFVVSFVGNRGTFIRGYKAMVMDVEFLYHVAYILTSVLGLFIHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFIMEVDRLPKGNPMAPNNFAEFCEKDQTDCTVDEEGDVERACDTLLMCIITVLNHGLRNGGGVGDILRK--PSKDET---LFPARIVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKEEHNIWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLGSTMRLVSHLTMQLSELKEQNDL 2579          
BLAST of SMED30029683 vs. Ensembl Xenopus
Match: rasgrp1 (RAS guanyl releasing protein 1 [Source:Xenbase;Acc:XB-GENE-489811])

HSP 1 Score: 234.572 bits (597), Expect = 1.374e-60
Identity = 356/1552 (22.94%), Postives = 640/1552 (41.24%), Query Frame = -3
Query: 4880 IGDFICLYCEETD-GYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLR-KFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLA--VDEESNVILVKESR---------------------DPRTVFKLHPV-IQDSEE-VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLV----NGKSV---------KARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVH--------------LECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQP----NILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSV---------VDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYY-------------GDVDDV---RSLLDKLIGLIDGS---------------RDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKE--------CERNEGLLKKKNPSSL--ACALYEGFNPYEKKPSAVRKQKLMIK---ELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSDEQVNR-----------------------MENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI---------HYLTQYILESPHELVYYLLTKPFPKH---LKTHLTCSI 9013
            IGD + LY E T  G++   ST    ++  +         N P    D     F++   NRY   K+Y + K A  + E + D     L  + + AA  E   N  E ++   + V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P +K++S G+ V + D++ L  + + G   HAS  + L +     E+N     + + I     + D  E  ++GG  V+LFH E E ++       D    ++H+ +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA  V E S V+ V +S                      D  ++F+L P  +Q ++  V   S+ R+ H+ +  W+          Q  +   D      IR   G          +   +A+ I  V     R  +F       L N +E RL E F+ ++   R  +   E   F +V    NG++V         + RQKL+R   ++  +  +L  P   +  +   L++                 CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L      + +    + + E      ++ Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I+K LS    +  FL +  E+LP ++RA +C +++ + VD      V          + P    + +Y    D N   + D    K   +    + D++   + E+  M  S  + N L  +V+ L   L+ FG+Y             G +D V   +S+L + I   DG+                 +    ++ G   S+    +V       R     E   ++  K   LE+LQ ILN   + R++  ++ FK+         + N+G   KK P +L  A +L+     +       RK   M++   E   MF             +LI L    Y  +   +L++L   +S +Q+      +  +L++T     ++ +  ++  LR M +    W D++ N                        ++ I   L + C+    PE+     QR+L + +   V++++L V  + + T    + +++L+   Q L+      P+ Q  + ++L + L   L E+E   T++ +F+NN  LC +I    +   +   A H +   ++LD L  I+K E  G  +K+ Q ++M  +  +           +S A +LE     REA+  EE     ++Y ISL++LL+ CAEG+N Y E  C ++L +ED++ V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++           L +Y+L    E +      PF ++   L+TH T  +
Sbjct:   10 IGDIVSLYAEGTVCGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFRVCPMNRYSAQKQYWKAKQAKQDKEKISDV---LLLQKLQHAANLEQKQNETENKKVHGEVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDVTGNEGSWFFIQPFWKLRSNGDNVVVGDKVNLNPVNA-GQPLHAS-NYELTDNPGCKEVNSLNSNTSWKINLFMQYRDYMEDVLKGGDVVRLFHAEQEKFLTC-----DEYKSRLHVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNSLYRFKHLATGHYLAAEVREGSLVMQVDKSHYFRKNAGEKIKFRLVAVPHGNDIASLFELDPTTLQKTDSLVPRNSFVRLRHLCTNTWI----------QSTNVPIDVDEERPIRLMLG------TCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLANFVE-RLNEGFI-SQNDRRFAIKLLEDLVFFVVDVSNNGQNVLDIMITKPNRERQKLMREQNILKQIFGILKAPFKEKGTDGPLLRLEELSDQKNSPYQYMFRLCYRVL-RHSQEDYRKNQEHIAKQFGVMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVNLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIKTELRPLKEMSPEYMSLEYCDEEVWLTWTDKNNDSHEKSIRQLSQEARAGNAHDENVLTYYRYQLKLFARMCLDRQYLAIHEISKQLSV---DLIFLCMADEMLPYEIRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPMAITIKDY----DSNLNDSRDNKKNK-FTSTMEFVEDYLNNVVSES--MPFSHEDKNKLTFEVVSLARHLIYFGFYSFSELLRLTRTLLGIIDCVQNPQSILLQAIYSEDGTGKNVRRSIHGVGQMVSTMVLNRKQTGYSSSQSLSSVVNHETPIKRKNVDMENIIVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVGETLKSNKG-GSKKGPLTLPAATSLFRSIFVF-----LCRKSTSMLEVDDEGGRMF-----------LRVLIQLTMNDYPSLISGSLQLLFKHFSQRQEVLHTFKQVQLLISTQDVDNYKVIKSELDRLRTMVEKSELWVDKKGNTGIIGSTDGNKKDKKEKSSENYQIVKGILETLNKMCN---GPEQVRKKQQRLLKNMDAHKVMLDLLQVPYEKEDT----KMKEILKYTHQFLQKFCATNPENQALLHKHLSLFLTPGLQEAE---TMQHIFLNNYQLCSEIHEAVLQHFIHCLATHGRHV-QYLDFLHTIIKAE--GKYIKKCQDMIMTELTNAGDDVVVFYNDKASFASMLEMMATAREAI--EE--NSPLKYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVRVVTHEDCITEVKISYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFILDMARVKKRIVDSTLEKYVLTVVLETIRSFFNSPFSENSTSLQTHQTIVV 1470          

HSP 2 Score: 132.494 bits (332), Expect = 1.140e-29
Identity = 131/549 (23.86%), Postives = 248/549 (45.17%), Query Frame = -3
Query: 1088 NSVSIELLKGDY-LQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSG------------------------------------FNTEKNLY---------------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDEL---LKNVSTLINHQKSEDSERK 2551
            ++  IE+++ D  ++++ F + +    + EE K  V    ++    +K+ DF D S  + N++ +Q+K  + P+  +F+    LW      L+V +NL++   F  P    + E  +I K                  R   +  +   +G    ++   L   Y+L   P+       +IL    L  N++      +  +G      ++ ++  +  Y+ A +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +                                      FN+  + Y               CD+L  C ++V+  GL     VGD+     P   E     F   ++Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I  L   L +   L++H   + SE K
Sbjct: 2087 HTAQIEIVRMDRSMEQIVFSVPSICKFLTEETKHRVFTTTEQDDQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGTISFNLAVFINLII--AFFYP----YVEGTSIGK------------------RLFIMSLFTKRYGFRPLIVALILRSVYYLGIGPT------LYILGALNLT-NKIVFVVSFVGNRGTFIRGYKAMVMDVEFLYHVAYILTSVLGLFIHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFIMEVDRLPKGNFIAPCMDCMDFLLDRRLHWLVFFFFNSPYSSYTYIVLLDEEGDVERACDTLLMCIITVLNHGLRNGGGVGDILRK--PSKDET---LFPARIVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKEEHNIWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLGSTMRLVSHLTMQLSELK 2599          
BLAST of SMED30029683 vs. Ensembl Mouse
Match: Itpr3 (inositol 1,4,5-triphosphate receptor 3 [Source:MGI Symbol;Acc:MGI:96624])

HSP 1 Score: 227.639 bits (579), Expect = 1.253e-58
Identity = 345/1573 (21.93%), Postives = 651/1573 (41.39%), Query Frame = -3
Query: 4880 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIED-ENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN-------------------------------VILVKESRDPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALK---DKEYKR------QQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLE----------------CYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL-------TERGQNIHEQPNILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKD-----LVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID---------------GSRDLPFPPERQGKELS----KEKKKI---------VQKYQQGDRY-LQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSD-------------------------------------EQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDH--VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHY-------------LTQYILESPHELVYYLLTKPFPKH---LKTHLTCSI 9013
            IGD + LY E + +G++   ST    ++  +         N P    D     F++   NRY   K+Y +     +D E + D     L  + + AA+ E   N  E ++     V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ +   I P +K++S G+ V + D++IL  + + G   HAS  + L +     E+N     + + I       D  E  ++GG  V+LFH E E ++       D    ++ + +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA +E  +                               ++ V    D  ++F+L P  +Q ++  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A  ++K+   +    +       F+  LLED +   F  +     V    + + + M+   K  + RQKL+R   ++  +  +L  P   +  E     V LE                CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L      + +        E  Q+ HE  +I Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I+K L     E  FL +  E+LP D+RA +C +++ + VD  +   +V   + + ++  + T    K   S+  A++D       +    + D++   + E      +  E N+L  +V+ L + L+ FG+Y    ++  L   L+G+ID               G +++    +  G  +S      K+ +         V   +Q DR   +  E + ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + + +       +G  P     +A      + ++   MF   + ++ +++D         +L++L  + Y  +   AL++L   +S +Q+      +  +L++      ++ +  ++  LR M +    W D                                     E    ++ I   L + C +    E+     QR+L + +   V++++L +   ++D+++ E    T + L+K            P  Q  + ++L + L   L+E+E   T++ +F+NN  LC +I    +   V L A H +   ++LD L  ++K E  G  +K+ Q ++M  +  +           +S A++L+     R+ V      EDH  + Y ISL++LL+ CAEG+N Y E  C ++L +ED++ V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++               L +Y+L    + +    + PF ++   L+TH T  +
Sbjct:   10 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADV---VLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNA-GQPLHAS-NYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTC-----DEYRGKLQVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDVSDPKAAGLGAQGRTGRRNAGEKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNAPIDVEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQND-----RRFVIQLLEDLV---FFVSD----VPNNGQNVLDIMVT--KPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPL--VRLEELSDQKNAPYQYMFRLCYRVL-RHSQEDYRKNQEHIAKQFGMMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNRIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMAQS-HEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISKQLGV---ELLFLCMADEMLPFDLRASFCHLMLHVHVD-RDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDYLNNVVSEAVPF--ANDEKNILTFEVVSLAHNLIYFGFYS-FSELLRLTRTLLGIIDCIQAPAAMLQAYEEPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGASSLPAGVGVPEQLDRSKFEDNEHTVVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDSGA-------DGTAPAFDSSTATMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLLHLTMHDYPSLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSVKGEEVEAGATKDKKERPSDEEGFLQPHGEKSSENYQIVKGILERLNKMCGV---GEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKSDNKMLEILRYTHQFLQKFCAGN-------PGNQALLHKHLQLFLTPGLLEAE---TMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHV-QYLDFLHTVIKAE--GKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGV------EDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVTVVTHEDCITEVKMAYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFTLDMALVCNKREKRLSDPTLEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVV 1499          

HSP 2 Score: 151.754 bits (382), Expect = 1.208e-35
Identity = 192/876 (21.92%), Postives = 372/876 (42.47%), Query Frame = -3
Query: 1007 VLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYAN-----------INKDTIDLVSQVFSTINEFVAG----NQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQ--MIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARL--------YDLDP--NLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDY-LQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFA---FGLVHNVLCGFLLFTYFLADHPSPPRI------QYYFILIKRRLK-QNELDPADEDIIQQ---GDEGCKMRSH---LISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAII------------------------------GFAFFRSGFNTEK----------------------NLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKI---DELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEK 3319
            +L+ L  +C+  +  LQ +LR Q +N  ++NLV E +QFL+++  +           IN+D + LV Q   T+ E+  G    NQ   VT   N I      IL   + P C      +++LK N   L+++++E  +              D E   R++                +RP+   +       I   ++ ++E ++ +    EVG + Y +  +L        + L P   + +++   + S     + +  +           ++    +Y+ ++  IE+++ D  ++++ F +      + EE K  +    ++    +K+ DF D S  + N++ +Q++  + P+  +F+    LW                        GS   +FN++ + N +  FF        P  E   + +       L+  +L  F +   F   +   P I        Y++ I   L     L+  ++ +      G+ G  +R +   ++  +  Y+   +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+                              G A F    + +K                         CD+L  C V+VM  GL     VGD+     P   E     F   V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I    E L +   L++H  S+ +E K   E + ++R +++  GF+  +  + +
Sbjct: 1872 ILRFLQLLCENHNRDLQNFLRCQ-NNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDIS-PLCKYRMDLVLQLKDNASKLLLALMESRH--------------DSENAERILI--------------SLRPQELVD------VIKKAYLQEEERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVRRIQEEEAEGISSMLSLNNKQLSQMLKSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPAICQFLTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLW------------------------GSI--SFNLAVFINIIIAFFY-------PYVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPGNHSRASPLGMPHGAATFMGTCSGDKMDCVSEVSVPEILEEDEEPDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRK--PSKDES---LFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVSHLTSQLNELK---EQMTEQRKRRQRLGFVDVQNCMSR 2670          
BLAST of SMED30029683 vs. Ensembl Mouse
Match: Itpr2 (inositol 1,4,5-triphosphate receptor 2 [Source:MGI Symbol;Acc:MGI:99418])

HSP 1 Score: 222.631 bits (566), Expect = 4.462e-57
Identity = 362/1579 (22.93%), Postives = 639/1579 (40.47%), Query Frame = -3
Query: 4895 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAV----------DEESNV----------------------ILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQF------STTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLK--------------VHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIH-EQP---NILYVSTDCMKSWI------------ALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE--NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG---------------DV--DDVRSLLDKLIGLIDGSRDLPFPPERQGKELSK--------------EKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKE--CERNEGLLKKKNPSSLACALYEGFNPYEKKPSA-VRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--W------------------SDEQVNRMENIFSE------------------------LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSS--------AAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH--------------YLTQYILESPHELVYYLLTKPFPKH---LKTH 9013
            IGD + LY E + +G++   ST    ++  + H +     N P    D     F++   NRY   K+Y  K    +  N  +A    L  + + AAE E   N +E R+   + V+Y  VIQL  + S+KY+ VN    +  +KN M VSL+   ++ + F I P +K++SEG+ + + D+++L  + + G   HAS    LDN     E+N     + + I          E  ++GG  V+LFH E E ++      DD   +Q H+ +R   + +A T  TS+ A+  W+IE        G    W+  FRF+H  T  YLA           +E  NV                      + V    D  ++F+L        +  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A T++K+        +       F+  LLED +   F  A     V    +++ + ++   K  + RQKL+R   ++  +  +L  P   +  E + L+              V   CY +L  +     RKN  Y AK   + ++Q+       +     I  L+ +NRK++++ I+  +I  FV  LR N   R+L+ L  LCV N   I   Q  I +  L      + +  +  ++  E P   +IL    D  + W+            A+    Q    G   D E + +   QL+LF  +C  R    I  I+  LS    +     +  E LP D+RA +C +++ + VD     SVV         + P +  ++EY    D ++          D+   F    +++  +L E  N        E N L  +V+ L   L+ FG+Y                D+    + S  ++L    DGS ++       G+ +++              + + IV   +Q     Q  E   +++ K   +E+LQ IL+   + R++  ++ +K+   + N+      +PS+          P    PSA V     +  +   MF   +  T V++D         +LI+L  + YA +   AL++L   +S + +  QA  +  +L++      ++++   +  LR+  +    W                    E+ N   N+ S                         LI    L    ++    +QR+L +     VV+++L +   +TD ++ E       V+  A   L+      P  Q  + ++L++ L   L+E+E   T++ +F+NN +LC +I  R +   V     H +   E+L  L  IVK +  G  +K+ Q +VM  ++             A++ +   M   E    +E G   + Y I+L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ ++   Y+      +E    EI     IW+   N   ++               +L + + ES   +V      PF  +   L+TH
Sbjct:   11 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVHPEAGDLANPPKKFRD---CLFKVCPMNRYSAQKQYW-KAKQAKQGNHTEA---ALLKKLQHAAELEQKQNESENRKLLGEIVKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKVVLMPVNA-GQPLHASNVELLDN-PGCKEVNAVNCNTSWKITLFMKFSSYREDVLKGGDVVRLFHAEQEKFLTC----DDYEKKQ-HIFLRTTLRQSA-TSATSSKAL--WEIEVVHHDPCRGGAGQWNSLFRFKHLATGNYLAAELNPDYRDAQNEGKNVKDGEIPTPKKKRQAGEKIMYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTTIPIDTEEERPVMLKIGTCQTKEDKEAFAIVCVPLSEVRDLDFANDANKVLATTVKKL-----ENGSITQNERRFVTKLLEDLI---FFVAD----VTNNGQDVLDVVIT--KPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQRYAPYKYVLRLCYRVL-RHSQQDYRKNQEYIAKNFCVMQSQI----GYDILAEDTITALLHNNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNSTAIPVTQELICKFMLSPGNADILIQTKLVSMQVENPMESSILPDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAREGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSV---DLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRN---------DMKRKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYFERLSKFQDGSNNVMRTIHGVGEMMTQMVLSRGSIFPVSVPDAQPIVHPSKQASPGEQ--EDVTVMDTKLKVIEILQFILSVRLDYRISYMLSIYKKEFGDNND----NGDPSASG-------TPDTLLPSALVPDIDEIAAQAETMFAGRKEKTPVQLDDEGGRTFLRVLIHLIMHDYAPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSGSYENGDVGEGQAKGGEEANEESNLLSPVQDGAKTPQIDSNKGNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPYEKTDEKMNE-------VMDLAHTFLQNFCRGNPQNQVLLHKHLNLFLTPGLLEAE---TMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHV-EYLRFLQTIVKAD--GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLNMMCSERARGDESGP--LAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYV-----DTEVEMKEIYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLERCVTESVMNIVSGFFNSPFSDNSTSLQTH 1505          

HSP 2 Score: 176.792 bits (447), Expect = 2.767e-43
Identity = 142/582 (24.40%), Postives = 259/582 (44.50%), Query Frame = -3
Query: 1025 KAFKFYKKNSVSIELLKGD-YLQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDG---SFDENFNI-----SKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR------------------------------------------------SGFNTEKNL--YCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 2575
            +A K+Y  ++  IE+++ D  ++++ F + N    +  E K  V    +R    +K+ DF   ++ + N++++QKK  NNP   +F+    LW      L+V +NL +   +    DG   +    F++          S+  FF  PV         ++ ++ +  L      G       L       +I +    +  R                G      R+ ++     Y+ A +   + G +   +F++F L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++IIGF F +                                                +G   E  +   CD+L  C V+V+  GL     VGD+     P   E     F+  V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+ +EHNMW Y++F + ++     +YT  + +VA ++ E+  D+FP  RA+ L + + DS  ++I  L + + + ++  K    +    +E + ++R  K+  GFL +
Sbjct: 2137 EALKYYANHTAQIEIVRHDRTMEQIVFPVPNICEFLTRESKYRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPMFSVLLWVAVAICTSMLFFFSKPV--------GIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNR----------------GTFTRGYRAVILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGNHGVPTMTLSSMMETCQKENCSPTIPSSNTAGEEGEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRR--PSKDEP---LFAARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMITEKNLDWFPRMRAMSLVSNEGDSEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGS 2689          
BLAST of SMED30029683 vs. Ensembl Mouse
Match: Itpr1 (inositol 1,4,5-trisphosphate receptor 1 [Source:MGI Symbol;Acc:MGI:96623])

HSP 1 Score: 212.231 bits (539), Expect = 6.013e-54
Identity = 350/1579 (22.17%), Postives = 623/1579 (39.46%), Query Frame = -3
Query: 4898 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN---------------------------------VILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFM------------LVNGKSVKARQKLLRNLRVIDLLVKLLNMPL-------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTER-------GQNIHEQPNILYVSTDCMKSWI------------ALHKFLQVDYPGYDDEK--VQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPER-----SFVYEYVGTKDQNKTTTS----DQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDG---SRDLPFPPERQGKE---------LSKEKKKIVQKYQQGDRYL-----------------QSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNE----------GLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMA--------KSKWSDEQVNR------------------------------MENIFSELIEFCHLPKAP-EEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPFPKHLKT 9013
            IGD   LY E  T+G++   ST    ++  +   +     N P    D     F++   NRY   K++  K A     +  DA    L ++   AA+ E   N  E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  +  ++GG  V+LFH E E ++       D   ++ H+ +R   + +A T  TS+ A+  W++E  +     G    W+  FRF+H  T  YLA + + +                                 ++ V E  D  ++F+L P      +  V   SY R+ H+ +  W+H+     DKE         E++  M  I   G    K D        +A+ I  V P   R  +F       L ++   +L++  +   E   V     ++  F+            +V  K  + RQKL+R   ++  + KLL  P               G    A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV     I   Q  I +  L      + +  +        + +    N L    D  + W+            ++ +  Q    G  +++  + +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C +++ + VD      V   P +     S +   +   D + + TS     +  A+ +  +   LRD +        +  + K E N L  +V+ L   L+ FG+Y +  D+  L   L+ ++D    +   P     +G+E         +    + + Q   +G  +L                   KE   +++ K   +E+LQ ILN   + R++  +  FK  E +E          G   ++ PS++  AL   F   E++   +              E  T + +D         +L++L  + Y  +   AL++L   +S +Q+  QA  +  +L+T+     ++++ + +  LR +         K +  DE ++                               ++ I   L + C    A   +     QR+L +     VV+E+L +       EK   T+      L           + QNQ  + +++++ L   ++E   A+T++ +F+NN  LC +I  R +   V     H +   +++  L  IVK E  G  +K+ Q +VM  ++ S       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L +Y+ E    +V    + PF     T
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPEAGDLNNPPKKFRD---CLFKLCPMNRYSAQKQFW-KAAKPGANSTTDA---VLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVVRLFHAEQEKFLTC-----DEHRKKQHVFLRTTGRQSA-TSATSSKAL--WEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKE---------EEKPVMLKI---GTSPLKED-------KEAFAIVPVSPAEVRDLDFANDASKVLGSI-AGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFGFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAKEGQKEDRDILSYYRYQLNLFARMCLDRQYLAINEISGQLDV---DLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQEQVT--PVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVC-----QRFPFSDK-EKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLAILDCVHVTTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKR-EFDESNSQSSETSSGNSSQEGPSNVPGAL--DFEHIEEQAEGIFGGS----------EENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDEPMDGASGENEHKKTEEGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQQQRLLRNMGAHAVVLELLQIP-----YEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILE---AVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNV-QYIKFLQTIVKAE--GKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDE---NSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYV-----DTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT 1500          

HSP 2 Score: 160.614 bits (405), Expect = 2.442e-38
Identity = 93/360 (25.83%), Postives = 171/360 (47.50%), Query Frame = -3
Query: 1025 RSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF-----------------------------------------------------NTEKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 1930
            R+ ++  +  Y+   L     G +   +F++  L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++I+G+ FF+  F                                                       +K   C++L  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+ F + ++   + +YT  + +VA +++E+  D+FP  RA+ L + D +   +++  L + + + +    +   +    ++ + ++R QK+  G L +
Sbjct: 2383 RAMVLDVEFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLANDFLYSDVCRVETGENCTSPAPKEELLPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIRERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGH 2737          
BLAST of SMED30029683 vs. Ensembl Mouse
Match: Itpr1 (inositol 1,4,5-trisphosphate receptor 1 [Source:MGI Symbol;Acc:MGI:96623])

HSP 1 Score: 211.46 bits (537), Expect = 1.004e-53
Identity = 350/1579 (22.17%), Postives = 623/1579 (39.46%), Query Frame = -3
Query: 4898 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN---------------------------------VILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFM------------LVNGKSVKARQKLLRNLRVIDLLVKLLNMPL-------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTER-------GQNIHEQPNILYVSTDCMKSWI------------ALHKFLQVDYPGYDDEK--VQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPER-----SFVYEYVGTKDQNKTTTS----DQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDG---SRDLPFPPERQGKE---------LSKEKKKIVQKYQQGDRYL-----------------QSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNE----------GLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMA--------KSKWSDEQVNR------------------------------MENIFSELIEFCHLPKAP-EEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPFPKHLKT 9013
            IGD   LY E  T+G++   ST    ++  +   +     N P    D     F++   NRY   K++  K A     +  DA    L ++   AA+ E   N  E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  +  ++GG  V+LFH E E ++       D   ++ H+ +R   + +A T  TS+ A+  W++E  +     G    W+  FRF+H  T  YLA + + +                                 ++ V E  D  ++F+L P      +  V   SY R+ H+ +  W+H+     DKE         E++  M  I   G    K D        +A+ I  V P   R  +F       L ++   +L++  +   E   V     ++  F+            +V  K  + RQKL+R   ++  + KLL  P               G    A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV     I   Q  I +  L      + +  +        + +    N L    D  + W+            ++ +  Q    G  +++  + +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C +++ + VD      V   P +     S +   +   D + + TS     +  A+ +  +   LRD +        +  + K E N L  +V+ L   L+ FG+Y +  D+  L   L+ ++D    +   P     +G+E         +    + + Q   +G  +L                   KE   +++ K   +E+LQ ILN   + R++  +  FK  E +E          G   ++ PS++  AL   F   E++   +              E  T + +D         +L++L  + Y  +   AL++L   +S +Q+  QA  +  +L+T+     ++++ + +  LR +         K +  DE ++                               ++ I   L + C    A   +     QR+L +     VV+E+L +       EK   T+      L           + QNQ  + +++++ L   ++E   A+T++ +F+NN  LC +I  R +   V     H +   +++  L  IVK E  G  +K+ Q +VM  ++ S       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L +Y+ E    +V    + PF     T
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPEAGDLNNPPKKFRD---CLFKLCPMNRYSAQKQFW-KAAKPGANSTTDA---VLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVVRLFHAEQEKFLTC-----DEHRKKQHVFLRTTGRQSA-TSATSSKAL--WEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKE---------EEKPVMLKI---GTSPLKED-------KEAFAIVPVSPAEVRDLDFANDASKVLGSI-AGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFGFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAKEGQKEDRDILSYYRYQLNLFARMCLDRQYLAINEISGQLDV---DLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQEQVT--PVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVC-----QRFPFSDK-EKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLAILDCVHVTTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKR-EFDESNSQSSETSSGNSSQEGPSNVPGAL--DFEHIEEQAEGIFGGS----------EENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDEPMDGASGENEHKKTEEGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQQQRLLRNMGAHAVVLELLQIP-----YEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILE---AVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNV-QYIKFLQTIVKAE--GKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDE---NSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYV-----DTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT 1500          

HSP 2 Score: 160.614 bits (405), Expect = 2.568e-38
Identity = 93/360 (25.83%), Postives = 171/360 (47.50%), Query Frame = -3
Query: 1025 RSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF-----------------------------------------------------NTEKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 1930
            R+ ++  +  Y+   L     G +   +F++  L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++I+G+ FF+  F                                                       +K   C++L  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+ F + ++   + +YT  + +VA +++E+  D+FP  RA+ L + D +   +++  L + + + +    +   +    ++ + ++R QK+  G L +
Sbjct: 2382 RAMVLDVEFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLANDFLYSDVCRVETGENCTSPAPKEELLPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIRERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGH 2736          
BLAST of SMED30029683 vs. Ensembl Mouse
Match: Itpr2 (inositol 1,4,5-triphosphate receptor 2 [Source:MGI Symbol;Acc:MGI:99418])

HSP 1 Score: 202.216 bits (513), Expect = 6.072e-51
Identity = 355/1579 (22.48%), Postives = 625/1579 (39.58%), Query Frame = -3
Query: 4895 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAV----------DEESNV----------------------ILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQF------STTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLK--------------VHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIH-EQP---NILYVSTDCMKSWI------------ALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE--NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG---------------DV--DDVRSLLDKLIGLIDGSRDLPFPPERQGKELSK--------------EKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKE--CERNEGLLKKKNPSSLACALYEGFNPYEKKPSA-VRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--W------------------SDEQVNRMENIFSE------------------------LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSS--------AAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH--------------YLTQYILESPHELVYYLLTKPFPKH---LKTH 9013
            IGD + LY E + +G++   ST    ++  + H +     N P    D     F++   NRY   K+Y  K    +  N  +A    L  + + AAE E   N +E R+   + V+Y  VIQL  + S+KY+ VN    +  +KN M VSL+   ++ + F I P +K++SEG+ V   +                               N   + + F    SY      E  ++GG  V+LFH E E ++      DD   +Q H+ +R   + +A T  TS+ A+  W+IE        G    W+  FRF+H  T  YLA           +E  NV                      + V    D  ++F+L        +  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A T++K+        +       F+  LLED +   F  A     V    +++ + ++   K  + RQKL+R   ++  +  +L  P   +  E + L+              V   CY +L  +     RKN  Y AK   + ++Q+       +     I  L+ +NRK++++ I+  +I  FV  LR N   R+L+ L  LCV N   I   Q  I +  L      + +  +  ++  E P   +IL    D  + W+            A+    Q    G   D E + +   QL+LF  +C  R    I  I+  LS    +     +  E LP D+RA +C +++ + VD     SVV         + P +  ++EY    D ++          D+   F    +++  +L E  N        E N L  +V+ L   L+ FG+Y                D+    + S  ++L    DGS ++       G+ +++              + + IV   +Q     Q  E   +++ K   +E+LQ IL+   + R++  ++ +K+   + N+      +PS+          P    PSA V     +  +   MF   +  T V++D         +LI+L  + YA +   AL++L   +S + +  QA  +  +L++      ++++   +  LR+  +    W                    E+ N   N+ S                         LI    L    ++    +QR+L +     VV+++L +   +TD ++ E       V+  A   L+      P  Q  + ++L++ L   L+E+E   T++ +F+NN +LC +I  R +   V     H +   E+L  L  IVK +  G  +K+ Q +VM  ++             A++ +   M   E    +E G   + Y I+L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ ++   Y+      +E    EI     IW+   N   ++               +L + + ES   +V      PF  +   L+TH
Sbjct:   11 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVHPEAGDLANPPKKFRD---CLFKVCPMNRYSAQKQYW-KAKQAKQGNHTEA---ALLKKLQHAAELEQKQNESENRKLLGEIVKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNVNAVN------------------------------CNTSWKITLFMKFSSYR-----EDVLKGGDVVRLFHAEQEKFLTC----DDYEKKQ-HIFLRTTLRQSA-TSATSSKAL--WEIEVVHHDPCRGGAGQWNSLFRFKHLATGNYLAAELNPDYRDAQNEGKNVKDGEIPTPKKKRQAGEKIMYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTTIPIDTEEERPVMLKIGTCQTKEDKEAFAIVCVPLSEVRDLDFANDANKVLATTVKKL-----ENGSITQNERRFVTKLLEDLI---FFVAD----VTNNGQDVLDVVIT--KPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQRYAPYKYVLRLCYRVL-RHSQQDYRKNQEYIAKNFCVMQSQI----GYDILAEDTITALLHNNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNSTAIPVTQELICKFMLSPGNADILIQTKLVSMQVENPMESSILPDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAREGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSV---DLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRN---------DMKRKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYFERLSKFQDGSNNVMRTIHGVGEMMTQMVLSRGSIFPVSVPDAQPIVHPSKQASPGEQ--EDVTVMDTKLKVIEILQFILSVRLDYRISYMLSIYKKEFGDNND----NGDPSASG-------TPDTLLPSALVPDIDEIAAQAETMFAGRKEKTPVQLDDEGGRTFLRVLIHLIMHDYAPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSGSYENGDVGEGQAKGGEEANEESNLLSPVQDGAKTPQIDSNKGNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPYEKTDEKMNE-------VMDLAHTFLQNFCRGNPQNQVLLHKHLNLFLTPGLLEAE---TMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHV-EYLRFLQTIVKAD--GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLNMMCSERARGDESGP--LAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYV-----DTEVEMKEIYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLERCVTESVMNIVSGFFNSPFSDNSTSLQTH 1472          

HSP 2 Score: 176.407 bits (446), Expect = 4.557e-43
Identity = 146/592 (24.66%), Postives = 265/592 (44.76%), Query Frame = -3
Query: 1025 KAFKFYKKNSVSIELLKGD-YLQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGL-VHNVLCGFLLFTYFLADHPSPPRIQYYFI-LIKRRLKQNELDP-----ADEDIIQQ--------GDEGCKMRSH---LISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR------------------------------------------------SGFNTEKNL--YCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 2575
            +A K+Y  ++  IE+++ D  ++++ F + N    +  E K  V    +R    +K+ DF   ++ + N++++QKK  NNP   +F+    LW      L+V +NL +   +    DG                              E   S MF+  L V   +C  +LF +       P  I+ + + ++ R +    L P        ++  +        G+ G   R +   ++     Y+ A +   + G +   +F++F L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++IIGF F +                                                +G   E  +   CD+L  C V+V+  GL     VGD+     P   E     F+  V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+ +EHNMW Y++F + ++     +YT  + +VA ++ E+  D+FP  RA+ L + + DS  ++I  L + + + ++  K    +    +E + ++R  K+  GFL +
Sbjct: 2104 EALKYYANHTAQIEIVRHDRTMEQIVFPVPNICEFLTRESKYRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDGD-----------------------------EGTLSPMFSVLLWVAVAICTSMLFFF-----SKPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGNHGVPTMTLSSMMETCQKENCSPTIPSSNTAGEEGEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRR--PSKDEP---LFAARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMITEKNLDWFPRMRAMSLVSNEGDSEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGS 2656          
BLAST of SMED30029683 vs. UniProt/SwissProt
Match: sp|P70227|ITPR3_MOUSE (Inositol 1,4,5-trisphosphate receptor type 3 OS=Mus musculus OX=10090 GN=Itpr3 PE=1 SV=3)

HSP 1 Score: 227.639 bits (579), Expect = 8.767e-58
Identity = 345/1573 (21.93%), Postives = 651/1573 (41.39%), Query Frame = -3
Query: 4880 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIED-ENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN-------------------------------VILVKESRDPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALK---DKEYKR------QQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLE----------------CYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL-------TERGQNIHEQPNILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKD-----LVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID---------------GSRDLPFPPERQGKELS----KEKKKI---------VQKYQQGDRY-LQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSD-------------------------------------EQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDH--VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHY-------------LTQYILESPHELVYYLLTKPFPKH---LKTHLTCSI 9013
            IGD + LY E + +G++   ST    ++  +         N P    D     F++   NRY   K+Y +     +D E + D     L  + + AA+ E   N  E ++     V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ +   I P +K++S G+ V + D++IL  + + G   HAS  + L +     E+N     + + I       D  E  ++GG  V+LFH E E ++       D    ++ + +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA +E  +                               ++ V    D  ++F+L P  +Q ++  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A  ++K+   +    +       F+  LLED +   F  +     V    + + + M+   K  + RQKL+R   ++  +  +L  P   +  E     V LE                CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L      + +        E  Q+ HE  +I Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I+K L     E  FL +  E+LP D+RA +C +++ + VD  +   +V   + + ++  + T    K   S+  A++D       +    + D++   + E      +  E N+L  +V+ L + L+ FG+Y    ++  L   L+G+ID               G +++    +  G  +S      K+ +         V   +Q DR   +  E + ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + + +       +G  P     +A      + ++   MF   + ++ +++D         +L++L  + Y  +   AL++L   +S +Q+      +  +L++      ++ +  ++  LR M +    W D                                     E    ++ I   L + C +    E+     QR+L + +   V++++L +   ++D+++ E    T + L+K            P  Q  + ++L + L   L+E+E   T++ +F+NN  LC +I    +   V L A H +   ++LD L  ++K E  G  +K+ Q ++M  +  +           +S A++L+     R+ V      EDH  + Y ISL++LL+ CAEG+N Y E  C ++L +ED++ V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++               L +Y+L    + +    + PF ++   L+TH T  +
Sbjct:   10 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADV---VLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNA-GQPLHAS-NYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTC-----DEYRGKLQVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDVSDPKAAGLGAQGRTGRRNAGEKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNAPIDVEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQND-----RRFVIQLLEDLV---FFVSD----VPNNGQNVLDIMVT--KPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPL--VRLEELSDQKNAPYQYMFRLCYRVL-RHSQEDYRKNQEHIAKQFGMMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNRIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMAQS-HEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISKQLGV---ELLFLCMADEMLPFDLRASFCHLMLHVHVD-RDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDYLNNVVSEAVPF--ANDEKNILTFEVVSLAHNLIYFGFYS-FSELLRLTRTLLGIIDCIQAPAAMLQAYEEPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGASSLPAGVGVPEQLDRSKFEDNEHTVVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDSGA-------DGTAPAFDSSTATMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLLHLTMHDYPSLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSVKGEEVEAGATKDKKERPSDEEGFLQPHGEKSSENYQIVKGILERLNKMCGV---GEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKSDNKMLEILRYTHQFLQKFCAGN-------PGNQALLHKHLQLFLTPGLLEAE---TMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHV-QYLDFLHTVIKAE--GKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGV------EDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVTVVTHEDCITEVKMAYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFTLDMALVCNKREKRLSDPTLEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVV 1499          

HSP 2 Score: 128.257 bits (321), Expect = 1.082e-27
Identity = 132/566 (23.32%), Postives = 246/566 (43.46%), Query Frame = -3
Query: 1007 IREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHN---VLCGFLLFTYFLADHPSPPRI------QYYFILIKRRLK-QNELDPADEDIIQQ---GDEGCKMRSH---LISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAII------------------------------GFAFFRSGFNTEK----------------------NLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKI---DELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEK 2476
            + EE K  +    ++    +K+ DF D S  + N++ +Q++  + P+  +F+    LW                        GS   +FN++ + N +  FF        P  E   + +    L+     +L  F +   F   +   P I        Y++ I   L     L+  ++ +      G+ G  +R +   ++  +  Y+   +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+                              G A F    + +K                         CD+L  C V+VM  GL     VGD+     P   E     F   V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I    E L +   L++H  S+ +E K   E + ++R +++  GF+  +  + +
Sbjct: 2146 LTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLW------------------------GSI--SFNLAVFINIIIAFFY-------PYVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPGNHSRASPLGMPHGAATFMGTCSGDKMDCVSEVSVPEILEEDEEPDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRK--PSKDES---LFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVSHLTSQLNELK---EQMTEQRKRRQRLGFVDVQNCMSR 2670          
BLAST of SMED30029683 vs. UniProt/SwissProt
Match: sp|Q63269|ITPR3_RAT (Inositol 1,4,5-trisphosphate receptor type 3 OS=Rattus norvegicus OX=10116 GN=Itpr3 PE=1 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.794e-56
Identity = 343/1570 (21.85%), Postives = 650/1570 (41.40%), Query Frame = -3
Query: 4889 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQDR---NQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIED-ENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN-------------------------------VILVKESRDPRTVFKLHP-VIQDSEE-VTFESYARIEHVLSGNWLHALK---DKEYKR------QQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLE----------------CYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL-------TERGQNIHEQPNILYVSTDCMKSWI---------ALHKFLQVDYPG--YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKD-----LVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID---------------GSRDLPFPPERQGKELS----KEKKKI---------VQKYQQGDRY-LQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSD-------------------------------------EQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS----------YSSAAYILEQPMETREAVLKEELGEDH--VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHY-------------LTQYILESPHELVYYLLTKPFPKH---LKTHLT 9013
            IGD + LY E + +G++   ST    ++  +         N P    D     F++   NRY   K+Y +     +D E + D     L  + + AA+ E   N  E ++     V+YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ +   I P +K++S G+ V + D++IL  + + G   HAS  + L + +   E+N     + + I       D  E  ++GG  V+LFH E E ++       D    ++ + +R   + +A +  +SN+    W++E        G    W+  +RF+H  T  YLA +E  +                               ++ V    D  ++F+L P  +Q ++  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A  ++K+   +    +       F+  LLED +   F  +     V    + + + M+   K  + RQKL+R+  ++  +  +L  P   +  E     V LE                CY +L  +     RKN  + AK   + ++Q+       +     I  L+ +NRK++++ I+K ++  FV  +R N   R+L+ L  LCV N + I   Q  I +  L      + +        E  Q+ HE  +I Y   +   +W          ++ +  Q    G  +D+  + +   QL LF  +C  R    I  I+K L     E  FL +  E+LP D+RA +C +++ + VD  +   +V   + + ++  + T    K   S+  A++D       +    + D++   + E      +  E N+L  +V+ L + L+ FG+Y    ++  L   L+G+ID               G +++    +  G  +S      K+ +         V   +Q DR   +  E + ++  K   LE+LQ ILN   + R++  ++ FK+ E  E    + + +       +G  P     +A      + ++   MF   + ++ +++D         +L++L  + Y  +   AL++L   +S +Q+      +  +L++      ++ +  ++  LR M +    W D                                     E    ++ I   L + C +    E+     QR+L + +   V++++L +   + D+++ E    T + L+K            P  Q  + ++L + L   L+E+E   T++ +F+NN  LC +I    +   V     H +   ++LD L  ++K E  G  +K+ Q ++M  +  +           +S A++L+     R+ V      EDH  + Y ISL++LL+ CAEG+N Y E  C ++L +ED+++V+ H +    +K  ++ ++   Y+      +E    EI     IW    N   ++               L +Y+L    + +    + PF ++   L+TH T
Sbjct:   10 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVEPAAGDLDNPPKKFRD---CLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADV---VLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNA-GQPLHAS-NYELSDNVGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTC-----DEYRGKLQVFLRTTLRQSATSATSSNA---LWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDVSDPKAAGPGAQSRTGRRNAGEKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNAPIDVEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQND-----RRFVIQLLEDLV---FFVSD----VPNNGQNVLDIMVT--KPNRERQKLMRDENILKQIFGILKAPFRDKGGEGPL--VRLEELSDQKNAPYQYMFRLCYRVL-RHSQEDYRKNQEHIAKQFGMMQSQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNRIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMAQS-HEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISKQLGV---ELLFLCMADEMLPFDLRASFCHLMLHVHVD-RDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDYLNNVVGEAVPF--ANDEKNILTFEVVSLAHNLIYFGFYS-FSELLRLTRTLLGIIDCIQAPAAVLQAYEEPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGASSLPTGVGVPEQLDRSKFEDNEHTVVMETKLKILEILQFILNVRLDYRISYLLSVFKK-EFVEVFPMQDSGA-------DGTAPAFDSSTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLLHLTMHDYPPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSVKGEEGEAGASKDKKERPSDEEGFLQPHGEKSSENYQIVKGILERLNKMCGV---GEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKNDNKMMEILRYTHQFLQKFCAGN-------PGNQALLHKHLQLFLTPGLLEAE---TMQHIFLNNYQLCSEISEPVLQHFVHCWPTHGRHV-QYLDFLHTVIKAE--GKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGV------EDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYV-----DTEVEMKEIYTSNHIWTLFENFTLDMALVCNKREKRLSDPTLEKYVLTVVLDTISAFFSSPFSENSTSLQTHQT 1496          

HSP 2 Score: 127.102 bits (318), Expect = 2.171e-27
Identity = 131/566 (23.14%), Postives = 246/566 (43.46%), Query Frame = -3
Query: 1007 IREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHN---VLCGFLLFTYFLADHPSPPRI------QYYFILIKRRLK-QNELDPADEDIIQQ---GDEGCKMRSH---LISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAII------------------------------GFAFFRSGFNTEK----------------------NLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKI---DELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEK 2476
            + EE K  +    ++    +K+ DF D S  + N++ +Q++  + P+  +F+    LW                        GS   +FN++ + N +  FF        P  E   + +    L+     +L  F +   F   +   P I        Y++ I   L     L+  ++ +      G+ G  +R +   ++  +  Y+   +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+                              G A F    + +K                         CD+L  C V+VM  GL     VGD+     P   E     F   V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW+Y++F + ++     DYT  + +VA ++K +  D+FP  RA+ L + + +   ++I    E L +   L++H  ++ +E K   E + ++R +++  GF+  +  + +
Sbjct: 2146 LTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLW------------------------GSI--SFNLAVFINIIIAFFY-------PYVEGASTGVLGSPLISLLFWILICFSIAALFTKHYSVRPLIVALVLRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPGNHSRASTLGMPHGAATFMGTCSGDKMDCVSEVSVPEILEEDEELDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRK--PSKDES---LFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVSHLTAQLNELK---EQMTEQRKRRQRLGFVDVQNCMSR 2670          
BLAST of SMED30029683 vs. UniProt/SwissProt
Match: sp|Q9Z329|ITPR2_MOUSE (Inositol 1,4,5-trisphosphate receptor type 2 OS=Mus musculus OX=10090 GN=Itpr2 PE=1 SV=4)

HSP 1 Score: 222.631 bits (566), Expect = 3.121e-56
Identity = 362/1579 (22.93%), Postives = 639/1579 (40.47%), Query Frame = -3
Query: 4895 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAV----------DEESNV----------------------ILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQF------STTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLK--------------VHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIH-EQP---NILYVSTDCMKSWI------------ALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE--NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG---------------DV--DDVRSLLDKLIGLIDGSRDLPFPPERQGKELSK--------------EKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKE--CERNEGLLKKKNPSSLACALYEGFNPYEKKPSA-VRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--W------------------SDEQVNRMENIFSE------------------------LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSS--------AAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH--------------YLTQYILESPHELVYYLLTKPFPKH---LKTH 9013
            IGD + LY E + +G++   ST    ++  + H +     N P    D     F++   NRY   K+Y  K    +  N  +A    L  + + AAE E   N +E R+   + V+Y  VIQL  + S+KY+ VN    +  +KN M VSL+   ++ + F I P +K++SEG+ + + D+++L  + + G   HAS    LDN     E+N     + + I          E  ++GG  V+LFH E E ++      DD   +Q H+ +R   + +A T  TS+ A+  W+IE        G    W+  FRF+H  T  YLA           +E  NV                      + V    D  ++F+L        +  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A T++K+        +       F+  LLED +   F  A     V    +++ + ++   K  + RQKL+R   ++  +  +L  P   +  E + L+              V   CY +L  +     RKN  Y AK   + ++Q+       +     I  L+ +NRK++++ I+  +I  FV  LR N   R+L+ L  LCV N   I   Q  I +  L      + +  +  ++  E P   +IL    D  + W+            A+    Q    G   D E + +   QL+LF  +C  R    I  I+  LS    +     +  E LP D+RA +C +++ + VD     SVV         + P +  ++EY    D ++          D+   F    +++  +L E  N        E N L  +V+ L   L+ FG+Y                D+    + S  ++L    DGS ++       G+ +++              + + IV   +Q     Q  E   +++ K   +E+LQ IL+   + R++  ++ +K+   + N+      +PS+          P    PSA V     +  +   MF   +  T V++D         +LI+L  + YA +   AL++L   +S + +  QA  +  +L++      ++++   +  LR+  +    W                    E+ N   N+ S                         LI    L    ++    +QR+L +     VV+++L +   +TD ++ E       V+  A   L+      P  Q  + ++L++ L   L+E+E   T++ +F+NN +LC +I  R +   V     H +   E+L  L  IVK +  G  +K+ Q +VM  ++             A++ +   M   E    +E G   + Y I+L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ ++   Y+      +E    EI     IW+   N   ++               +L + + ES   +V      PF  +   L+TH
Sbjct:   11 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVHPEAGDLANPPKKFRD---CLFKVCPMNRYSAQKQYW-KAKQAKQGNHTEA---ALLKKLQHAAELEQKQNESENRKLLGEIVKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKVVLMPVNA-GQPLHASNVELLDN-PGCKEVNAVNCNTSWKITLFMKFSSYREDVLKGGDVVRLFHAEQEKFLTC----DDYEKKQ-HIFLRTTLRQSA-TSATSSKAL--WEIEVVHHDPCRGGAGQWNSLFRFKHLATGNYLAAELNPDYRDAQNEGKNVKDGEIPTPKKKRQAGEKIMYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTTIPIDTEEERPVMLKIGTCQTKEDKEAFAIVCVPLSEVRDLDFANDANKVLATTVKKL-----ENGSITQNERRFVTKLLEDLI---FFVAD----VTNNGQDVLDVVIT--KPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQRYAPYKYVLRLCYRVL-RHSQQDYRKNQEYIAKNFCVMQSQI----GYDILAEDTITALLHNNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNSTAIPVTQELICKFMLSPGNADILIQTKLVSMQVENPMESSILPDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAREGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSV---DLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRN---------DMKRKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYFERLSKFQDGSNNVMRTIHGVGEMMTQMVLSRGSIFPVSVPDAQPIVHPSKQASPGEQ--EDVTVMDTKLKVIEILQFILSVRLDYRISYMLSIYKKEFGDNND----NGDPSASG-------TPDTLLPSALVPDIDEIAAQAETMFAGRKEKTPVQLDDEGGRTFLRVLIHLIMHDYAPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSGSYENGDVGEGQAKGGEEANEESNLLSPVQDGAKTPQIDSNKGNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPYEKTDEKMNE-------VMDLAHTFLQNFCRGNPQNQVLLHKHLNLFLTPGLLEAE---TMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHV-EYLRFLQTIVKAD--GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLNMMCSERARGDESGP--LAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYV-----DTEVEMKEIYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLERCVTESVMNIVSGFFNSPFSDNSTSLQTH 1505          

HSP 2 Score: 168.318 bits (425), Expect = 9.139e-40
Identity = 133/536 (24.81%), Postives = 235/536 (43.84%), Query Frame = -3
Query: 1025 NVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDG---SFDENFNI-----SKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTE----KNLY----------------------------------------------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 2443
              +R    +K+ DF   ++ + N++++QKK  NNP   +F+    LW      L+V +NL +   +    DG   +    F++          S+  FF  PV         ++ ++ +  L      G       L       +I +    +  R                G      R+ ++     Y+ A +   + G +   +F++F L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++IIGF F +  F  E    KN                                                CD+L  C V+V+  GL     VGD+     P   E     F+  V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+ +EHNMW Y++F + ++     +YT  + +VA ++ E+  D+FP  RA+ L + + DS  ++I  L + + + ++  K    +    +E + ++R  K+  GFL +
Sbjct: 2183 TTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPMFSVLLWVAVAICTSMLFFFSKPV--------GIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNR----------------GTFTRGYRAVILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGNHGVPTMTLSSMMETCQKENCSPTIPSSNTAGEEGEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRR--PSKDEP---LFAARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMITEKNLDWFPRMRAMSLVSNEGDSEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGS 2689          
BLAST of SMED30029683 vs. UniProt/SwissProt
Match: sp|P29995|ITPR2_RAT (Inositol 1,4,5-trisphosphate receptor type 2 OS=Rattus norvegicus OX=10116 GN=Itpr2 PE=1 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 4.154e-56
Identity = 360/1578 (22.81%), Postives = 638/1578 (40.43%), Query Frame = -3
Query: 4895 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN--------------------------------VILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQF------STTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLK--------------VHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIH-EQP---NILYVSTDCMKSWI------------ALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV---------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE--NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYG---------------DV--DDVRSLLDKLIGLIDGSRDLPFPPERQGKELSK--------------EKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKF-KECERNEGLLKKKNPSSLACALYEGFNPYEKKPSA-VRKQKLMIKELREMF---ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--W------------------SDEQVNRMENIFSE------------------------LIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSV---ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSS--------AAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH--------------YLTQYILESPHELVYYLLTKPFPKH---LKTH 9013
            IGD + LY E + +G++   ST    ++  + H +     N P    D     F++   NRY   K+Y  K    +  N  +A    L  + + AAE E   N +E R+   + V+Y +VIQL  + S+KY+ VN    +  +KN M VSL+   ++ + F I P +K++SEG+ + + D+++L  + + G   HAS    LDN     E+N     + + I          E  ++GG  V+LFH E E ++      DD   +Q H+ +R   + +A T  TS+ A+  W+IE        G    W+  FRF+H  T  YLA +   +                                ++ V    D  ++F+L        +  V   SY R+ H+ +  W+ +     D E +R          T ED+ +   +     E+R +D  +D     A T++K+        +       F+  LLED +   F  A     V    +++ + ++   K  + RQKL+R   ++  +  +L  P   +  E + L+              V   CY +L  +     RKN  Y AK   + ++Q+       +     I  L+ +NRK++++ I+  +I  FV  LR N   R+L+ L  LCV N   I   Q  I +  L      + +  +  ++  E P   +IL    D  + W+            A+    Q    G   D E + +   QL+LF  +C  R    I  I+  LS    +     +  E LP D+RA +C +++ + VD     SVV         + P +  ++EY    D ++          D+   F    +++  +L E  N        E N L  +V+ L   L+ FG+Y                D+    + S  ++L    DGS ++       G+ +++              + +  V   +Q     Q  E   +++ K   +E+LQ IL+   + R++  ++ + KE   N+G     +PS+          P    PSA V     +  +   MF   +  T V++D         +LI+L  + YA +   AL++L   +S + +  QA  +  +L++      ++++   +  LR+  +    W                    E+ N   N+ S                         LI    L    ++    +QR+L +     VV+++L +   +TD ++ E       V+  A   L+      P  Q  + ++L++ L   L+E+E   T++ +F+NN +LC +I  R +   V     H +   E+L  L  IVK +  G  +K+ Q +VM  ++             A++ +   M   E    +E G   + Y I+L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ ++   Y+      +E    EI     IW+   N   ++               +L + + ES   +V      PF  +   L+TH
Sbjct:   11 IGDIVSLYAEGSVNGFI---STLGLVDDRCVVHPEAGDLTNPPKKFRD---CLFKVCPMNRYSAQKQYW-KAKQAKQGNHTEA---ALLKKLQHAAELEQKQNESENRKLLGEIVKYSKVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKVVLMPVNA-GQPLHASNVELLDN-PGCKEVNAVNCNTSWKITLFMKFSSYREDVLKGGDVVRLFHAEQEKFLTC----DDYEKKQ-HIFLRTTLRQSA-TSATSSKAL--WEIEVVHHDPCRGGAGQWNSLFRFKHLATGNYLAAELNPDYRDAQNEGKTVRDGELPTSKKKHQAGEKIMYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTEEERPVMLKIGTCQTKEDKEAFAIVCVPLSEVRDLDFANDANKVLATTVKKL-----ENGSITQNERRFVTKLLEDLI---FFVAD----VTNNGQDVLDVVIT--KPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQRYAPYKYVLRLCYRVL-RHSQQDYRKNQEYIAKNFCVMQSQI----GYDILAEDTITALLHNNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNSTAIPVTQELICKFMLSPGNADILIQTKLVSMQVENPMESSILPDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAREGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSV---DLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRN---------DMKRKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYFERLSKFQDGSNNVMRTIHGVGEMMTQMVLSRGSIFPVSWPDAQPSVHPSKQASPGEQ--EDVTVMDTKLKVIEILQFILSVRLDYRISYMLSIYKKEFGENDG---NGDPSASG-------TPETLLPSALVPDIDEIAAQAETMFAGRKEKTPVQLDDEGGRTFLRVLIHLIMHDYAPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSGSYENGDMGEGQAKGGEEANEESNLLSPVQDGAKTPQIDSNKGNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPYEKTDEKMNE-------VMDLAHTFLQNFCRGNPQNQVLLHKHLNLFLTPGLLEAE---TMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHV-EYLRFLQTIVKAD--GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLNMMCSERARGDESGP--LAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYV-----DTEVEMKEIYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLERCVTESVMNIVSGFFNSPFSDNSTSLQTH 1505          

HSP 2 Score: 167.162 bits (422), Expect = 1.835e-39
Identity = 134/538 (24.91%), Postives = 235/538 (43.68%), Query Frame = -3
Query: 1025 NVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYN----------NSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTE----KNLY----------------------------------------------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 2443
              +R    +K+ DF   ++ + N++++QKK  NNP   +F+    LW      L+V +NL +   +    DG  DE      ++           S+  FF  PV         ++ ++ +  L      G       L       +I +    +  R                G      R+ ++     Y+ A +   + G +   +F++F L ++V+  + L  VI +VT+NG+S+I  A+L ++++YL++IIGF F +  F  E    KN                                                CD+L  C V+V+  GL     VGD+     P   E     F+  V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+ +EHNMW Y++F + ++     +YT  + +VA ++ E+  D+FP  RA+ L + + DS  ++I  L + + + ++  K    +    +E + ++R  K+  GFL +
Sbjct: 2183 TTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDG--DEGTLSPLFSALLWVAVAICTSMLFFFSKPV--------GIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNR----------------GTFTRGYRAVILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGNDGVPTMTLTSMLGTCPKENCSPTIPSSNAAGEGGEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRR--PSKDEP---LFAARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEKILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMITEKNLDWFPRMRAMSLVSNEGDSEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGS 2689          
BLAST of SMED30029683 vs. UniProt/SwissProt
Match: sp|Q9TU34|ITPR1_BOVIN (Inositol 1,4,5-trisphosphate receptor type 1 OS=Bos taurus OX=9913 GN=ITPR1 PE=1 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.408e-55
Identity = 349/1576 (22.14%), Postives = 623/1576 (39.53%), Query Frame = -3
Query: 4898 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN---------------------------------VILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFM------------LVNGKSVKARQKLLRNLRVIDLLVKLLNMPL-------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTER-------GQNIHEQPNILYVSTDCMKSWI------------ALHKFLQVDYPGYDDEK--VQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPER-----SFVYEYVGTKDQNKTTTS----DQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDG---SRDLPFPPERQGKE---------LSKEKKKIVQKYQQGDRYL-----------------QSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKE---------CERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMA--------KSKWSDEQVNR------------------------------MENIFSELIEFCHLPKAP-EEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPFPKHLKT 9013
            IGD   LY E  T+G++   ST    ++  +   +     N P    D     F++   NRY   K++  K A     +  DA    L ++   AA+ E   N  E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  +  ++GG  V+LFH E E ++       D   ++ H+ +R   + +A T  TS+ A+  W++E  +     G    W+  FRF+H  T  YLA + + +                                 ++ V E  D  ++F+L P      +  V   SY R+ H+ +  W+H+     DKE         E++  M  I   G    K D        +A+ I  V P   R  +F       L ++   +L++  +   E   V     ++  F+            +V  K  + RQKL+R   ++  + KLL  P               G    A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV     I   Q  I +  L      + +  +        + +    N L    D  + W+            ++ +  Q    G  +++  + +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C +++ + VD      V   P +     S +   +   D + + TS     +  A+ +  +   LRD +        +  + K E N L  +V+ L   L+ FG+Y +  D+  L   L+ ++D    +   P     +G+E         +    + + Q   +G  +L                   KE   +++ K   +E+LQ ILN   + R++  +  FK           E + G   ++ PS++  AL   F   E++   +              E TT + +D         +L++L  + Y  +   AL++L   +S +Q+  QA  +  +L+T+     ++++ + +  LR +         K +  DE ++                               ++ I   L + C    A   +     QR+L +     VV+E+L +  +    E     E +      L    A  +P+ Q  + +++++ L   ++E   A+T++ +F+NN  LC +I  R +   V     H +   +++  L  IVK E  G  +K+ Q +VM  ++ S       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+       E    EI     +W+   N   +I                L +Y+ E    +V    + PF     T
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPETGDLNNPPKKFRD---CLFKLCPMNRYSAQKQFW-KAAKPGANSTTDA---VLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVVRLFHAEQEKFLTC-----DEHRKKQHVFLRTTGRQSA-TSATSSKAL--WEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKE---------EEKPVMLKI---GTSPVKED-------KEAFAIVPVSPAEVRDLDFANDASKVLGSI-AGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFGFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWVFWRDSNKEVRSKSVRELAQDAKEGQKEDRDVLGYYRYQLNLFARMCLDRQYLAINEISGQLDV---DLILRCMSDENLPSDLRASFCRLMLHMHVDRDPQEQVT--PVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVC-----QRFPFSDK-EKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLAILDCVHVTTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPTATAPEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEGPSNVPGAL--DFEHIEEQAEGIFGGS----------EETTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDEAMDGASGENEHKKTEEGNNKSQQHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEK--AEDTMMQEIMRLAHEFLQNFCAGNHPN-QALLHKHINLFLNPGILE---AVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNV-QYIKFLQTIVKAE--GKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDE---NSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYV-----DPEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT 1500          

HSP 2 Score: 158.303 bits (399), Expect = 8.379e-37
Identity = 95/359 (26.46%), Postives = 171/359 (47.63%), Query Frame = -3
Query: 1028 RSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFR------------------------------------SGFNT-----------------EKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLS 1930
            R+ ++  +  Y+   L     G +   +F++  L ++V+  + L  VI +VT+NG+S+I +A+L ++++YL++I+G+ FF+                                    +G N                  +K   C++L  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+ F + ++   + +YT  + +VA ++KE+  D+FP  RA+ L + D +   +++  L + + + +    +        ++ +  +R QK+  G L 
Sbjct: 2343 RAMVLDVEFLYHLLXLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILMAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETSLPEASESLASEFLYSDVCRVETGENCSSPAPKEELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGLLSELKDQMTDQRKQKQRMGLLG 2696          
BLAST of SMED30029683 vs. TrEMBL
Match: A0A267G7Y3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011719g6 PE=4 SV=1)

HSP 1 Score: 2948.69 bits (7643), Expect = 0.000e+0
Identity = 1499/2760 (54.31%), Postives = 1985/2760 (71.92%), Query Frame = -3
Query: 1046 CIGDFICLYCEETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVL-------------------------------DADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLD-----NFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEES---NVILVKESRDPRTVFKLHPVIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQ---FLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKD-QNKTTTSDQY----------------AAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQ-GKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQ-VKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQ-PMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILK---EKKIWQFIGNLGEEIHYLTQYIL-ESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSE-DNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHIS----ATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQ----KVIKKEKNING------------KVKHTPKATFRQ-------------SDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNS-LPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQ-NELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNL-YCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKR 9016
            CIGD+I LYCE+TDG+V+S ++ + FN L +YH   R++P +IPDPQ++ FQ+ IQNRYKL+KKY +  A+                                      D D R   +QA+ AA AENVDN+AEQRRN  K+VRYGE++QLK VF+ KY+HVNT  TSQ DKNNM++SL+ +N K AQF+ILPRYKVKSEGE+VQ+ DQI LESIKSPGH+FH+S  F +       F+  SELNLGVEQ+GFTI+KS+    + E + RGGQFVQLFHKE+EAY+VAEGLFD  VTE VHLRIREIDQLN RTL +S SA+TYWQ+E E +++ G+ LTWDQQFRFRH TTR YL V + S   +V L +++ DP TVFK+HPV+QDS E+ FESYARIEHV++G WLHA+KDK Y+R++F   EDE+SM A+RWDGGELR++ C  DRRYDDAYTIQKV  E+   FNF+AG+VP L++L++ R   + L +KE +R+C A RE++ FMLVNG+  KARQKLLRNLRVIDLLV LL  PL    DE N  KV  E YDIL+TYM+G+SRKNALYFAKYIE F+TQM+DKSE++LKV +++VEL++DNRKIVDRIS  QI  FVE LR NE++ YLELLKVLCVCNGV I +NQ +IAQ+WLLED RGVY+T RGQNI  +PN  YVS D   SW+ L  F+Q D   YD E V+   FL  QLDLF A+C+GRNE CIRLITKDLSYL+WEE +L L SE LP + RAKYCE+IIGLFV+VGNNYSVV+ P+  F+YEY+GTKD   +T++ +QY                AAKDLVTIFP +RDWIA FLD+N  M+AS++ +N+LIEQVL+LL++LVKFGYYG+V D+  LL  L  L+DG  D+PFPP+R   +E SKE+KK V +++Q +R+ +S ET AIV AK+AAL+VL +++ F+ NARLA F+ KFK+ E +E   ++K+   L  ALY+ F+P++ + SA++ QK M KELR MFE +++ V    +T+ILI+LAHY+Y  M QL+L++LN L+S K   F  A  SLVL+T DSC VHREV KQVPLL+MM +SKW+ +Q  ++E I SEL E CHLPKA EEPHPMNQR++ S NV+GVV +ILS ETD QLTEKY +T  VLRKA++L+KA+ ++Y DVQNQ+F NLD +LRV+LVE +LA+ LKEVFVNNQ LCLKILPRQI +IV L AE+Q++APEFL+LL AIVKVEG GLALKRNQTLVMKYIMQ+YS   Y+LEQ   + R  VL    G  H QYLISL++LL+TCAEGENRYIESLCQTI+SVE+IL +LN P + NHLK+PFL+Y+ +AY+K   +++E+ + +I++   +K +W+++ +L  E   LT++I  ++  + VY++  +PFPK L+ H  C +C+ LV++D  +PLKLN ENA++R++ED+FR HAS+HY+FD+V+ FL  ++ + +  + + D +SE+D++D LT S + LC+ L+  + +P  L  M+AC++ ++ KS+   TIMEPVVE IGKG K+ DT++QMK GN+EYY QE+ +N KLKT A N SL++ G NTV+AQLK SS+R+YT + G++ LPL +EFQ+H++CFI   ++K E +Y++A LL+N L I+      + +    A        R + E+L IR LQ+LRA IHNEERKLPEDW+ R SEFR+K+GLKNI +IQNTLNSF      LPHLA+ S  +AKEVLSL  +MLFNAN  +Q+S+L YFL TKEEVFF+AVRNRLQ+S ANIKE+RLL++QQ +R+ +A+ QA +L  TMTLG +A+++I+      +++ A + L+      Q     + KK+  + G                +  A  RQ             +DG   G N     + D +     EAE+                            ISMKDDGY+ LVLK+LARICDGQH GLQ YLREQPDN+KSFNLVAEV QF+NV Y+NIN +TI+L+ Q+F+T+NEF AGNQENR  VYDNKIIDYIN+ILR  ++ +C + Q+  L+Q I NLV+S+IEEN+P+A  I  EVKDTLDKEA+YRVMTE YE  + +S   +G                + + + KDE K+LK  + +VGFS+Y I+ARLYD+DP +GKKD                    + L I+ +Q KAFKF+KKNS++IE++K   LQK+HFR+RNKN++REEVKE +KWNVDR+S S KIRDFMDW+K+ILNDI YQKK ++NP+    T  WL+WN++ T+++VI+NL+ML   +AP  G+   + +IS   ++ +PD F N    WK  + +L  W+ AF  + + L   +L  +F+A+HP PP +      +  RL+Q  + D  +E+ +++     K+   L S  TFYY   +G + AG +YSPYFFAFHL+NIV+NNQ+L+GVI AVT NG SL+WV++LG+ ++YLYA+IGFA FR  F  + +L +C +L+ CFV+++RFGL+GDLFENL+P  S ++F  +  + ++ ++FF+LI+TIGLNIIFGIIVDTFS+LRD KW AE+DMR+ CFICSRN+YDFEHHGQGF++HV  EHNMW+YIFFFIHL+DT  NDYTSLD+ V  +LKE++F+FFPLNRALCL+AKDEDSTDSKIDELL NV  L+ HQK E++ER+R+ EL RQK+WQ++
Sbjct:   28 CIGDYIGLYCEDTDGHVFSQNSCAAFNGLFVYHSCHRDRPVNIPDPQVLLFQVCIQNRYKLDKKYRKAVASNRQAAASAASQQQPQQQQTTETSPLTQPEQPEQQIAENDFDLRLHIEQARNAASAENVDNMAEQRRNLGKRVRYGEIVQLKHVFTGKYVHVNTNHTSQHDKNNMLLSLHEYNSKNAQFRILPRYKVKSEGEHVQLLDQISLESIKSPGHYFHSSKGFKIGPESRPTFV--SELNLGVEQTGFTIIKSHGFSGDHEAYARGGQFVQLFHKELEAYVVAEGLFDQDVTEDVHLRIREIDQLNPRTLHSSTSAVTYWQVEPESTVLDGEVLTWDQQFRFRHATTRKYLCVKQASEAYSVTLTEDATDPHTVFKMHPVLQDSPELKFESYARIEHVITGCWLHAIKDKSYQRKEFLNMEDEKSMRALRWDGGELREITCCFDRRYDDAYTIQKVDSEHVMNFNFVAGVVPTLQDLIDARQIGRPLTSKETFRICHALRELRNFMLVNGEPCKARQKLLRNLRVIDLLVTLLKFPLKAVQDEHNLTKVFSEAYDILHTYMMGNSRKNALYFAKYIEFFQTQMVDKSELALKVTKMLVELMKDNRKIVDRISNAQIEVFVELLRKNEHHSYLELLKVLCVCNGVAITENQNFIAQKWLLEDTRGVYMTNRGQNIDRKPNETYVSYDQQHSWLPLVDFVQPD--EYDTEAVERCLFLHTQLDLFIALCHGRNEDCIRLITKDLSYLTWEEAYLGLSSESLPHEFRAKYCEIIIGLFVNVGNNYSVVESPQLCFIYEYIGTKDFTYQTSSPEQYKQGRKVGEPSRLEQQRAAKDLVTIFPVIRDWIAEFLDQNRMMVASQVANNILIEQVLKLLHYLVKFGYYGEVHDLARLLPALRNLLDGQNDIPFPPDRMPAREFSKERKKAVLRFKQTERFRRSPETQAIVRAKHAALQVLDLVMTFQENARLASFIKKFKDSEISEVATRRKHIHPLVPALYDSFDPFDTRKSALQVQKRMKKELRIMFEESSRHVDNIALTSILIDLAHYEYDPMVQLSLQLLNKLHSAKSSMFNLAVNSLVLITPDSCRVHREVGKQVPLLKMMIRSKWTSDQAVKIETILSELRELCHLPKAEEEPHPMNQRLMLSHNVLGVVFDILSTETDVQLTEKYHETVGVLRKAVRLMKALTIRYEDVQNQVFNNLDSMLRVRLVEPDLALALKEVFVNNQELCLKILPRQISRIVGLVAENQERAPEFLELLSAIVKVEGPGLALKRNQTLVMKYIMQNYSKVGYVLEQCTTKDRMEVLNGNRGASHCQYLISLVDLLATCAEGENRYIESLCQTIISVEEILCILNDPNVENHLKKPFLRYMFYAYMKTSGSTAENRSPDIIQDRYQKLVWEYVRHLTLEFDGLTRWIRNDAARDTVYFMSMRPFPKILRLHDACPLCSTLVAEDETQPLKLNLENAVVRMREDDFRGHASLHYVFDAVLPFLQAFANKFYQTEEDKDTQSERDMFDRLTLSAIGLCSELAAIVVEPRILTQMVACLSALVRKSSHRPTIMEPVVENIGKGTKLQDTVSQMKSGNKEYYEQEIILNSKLKTLAVNMSLLWGGQNTVRAQLKYSSDREYTVIGGEESLPLDEEFQDHVRCFISAGSRKPEGRYRLAGLLVNGLRITAVSSTASASHAAAAAADPGAGGRGDTERLAIRILQILRAFIHNEERKLPEDWEVRMSEFRVKRGLKNIAEIQNTLNSFDLMKHALPHLASTSGLVAKEVLSLLGIMLFNANEKVQQSMLKYFLNTKEEVFFFAVRNRLQVSTANIKEKRLLISQQKARQMDARSQADDLKATMTLGVKALQQIQQYHVEMKIEQANSDLTRRVSLTQMQSASITKKKSGVGGVASGSNGGSNGGSNGGSTSAAGRQVAFANGIKGGKDAADGLMKGSNGTDRMDGDQSSAHHLEAEK----------------------------ISMKDDGYVGLVLKVLARICDGQHKGLQNYLREQPDNIKSFNLVAEVSQFINVAYSNINSETIELLVQLFTTVNEFCAGNQENRAAVYDNKIIDYINFILRTSDFENCELDQIASLRQAIANLVVSLIEENSPEAAVIGREVKDTLDKEALYRVMTECYEYCQRDSSGKEG---------------WLRRLLKKDENKELKDAIFDVGFSFYTIIARLYDIDPAMGKKDSD---------------PYGRELRISDSQMKAFKFFKKNSMTIEIVKDSNLQKIHFRVRNKNVLREEVKEKLKWNVDRNSSSTKIRDFMDWTKAILNDIHYQKKVLSNPLTIALTRLWLIWNHSATLVAVIINLIMLIGLEAPPGGANTPSLDISADESAPVPDAFFNTTGQWKADYPSLPDWLMAFAYILDALSIIILLAFFVANHPRPPDLAR----LAWRLRQLRQKDQEEENELRESGGQDKLSVRLFSIATFYYIVFVGCAFAGTFYSPYFFAFHLLNIVNNNQMLRGVIQAVTTNGLSLVWVSVLGIAIMYLYAVIGFAKFRIAFRPDDSLMFCGTLYQCFVTILRFGLIGDLFENLVPPSSHRNFDEYVWMALFSITFFVLISTIGLNIIFGIIVDTFSQLRDKKWMAETDMRNCCFICSRNNYDFEHHGQGFDHHVRTEHNMWAYIFFFIHLEDTATNDYTSLDLHVHKMLKEERFEFFPLNRALCLSAKDEDSTDSKIDELLSNVKDLVQHQKEEEAERRRWVELNRQKKWQQK 2721          
BLAST of SMED30029683 vs. TrEMBL
Match: A0A267E835 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032795g1 PE=4 SV=1)

HSP 1 Score: 2914.41 bits (7554), Expect = 0.000e+0
Identity = 1471/2603 (56.51%), Postives = 1937/2603 (74.41%), Query Frame = -3
Query: 1046 DTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN---VILVKESRDPRTVFKLHPVIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDD-EKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQ-NKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPER--QGK-ELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQ-VKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQ-PMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEK---KIWQFIGNLGEEIHYLTQYIL-ESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSE-DNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNN-SKTR---QKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTV---AKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRL---KQNELDPADEDIIQQGDEGC-KMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKR 8776
            + +Q  +QA+ AA AENVDN+AEQ+RNQ K+VRYGE+IQLK VF+ K++HVNT QTSQ DKNNM++SL+  N K AQF+ILPRYKVKSEGEYVQ+ DQ   ESIKSPGHFFHAS  F ++   + SELNLGV+Q+GFTI+KS++H+ E E F RGGQFVQLFHKE+EAY+VAEGLFDD VTE VHLRIRE+DQLNARTLR S SAITYWQ+E EK++++GD LTWDQQFRFRH TTR YL + +E +   V L+ ++ DP TVFKLHPV+Q++ E+ FESYARIEHV++G+WLHA+KDK Y+R++F   EDE+SM A+RWDGGELR+V C  DRRYDDAYTI+KV     + FNF+AG+VPFL+NL+  R   K L  KE + +C A +E+++FM+VNG+  K +QKLLRNLRVIDLLV LL  PL G  DE N  +V    YDIL+TYM+G+SRKNALYFAKYIE F+TQM+DKS+++LKV +++VEL++DNRKIVDRISK QI+ FV+ LR NE+Y YLELLKVLCVCNGV I DNQ+YIAQ+WLLED RG+YL+ERGQNI  +PN  YVSTD MK+W  L  F+Q D    +  E+  FL  QLDLF A+C+GRNE CIRLITKDLSYL+WEE +L L S+ LP   RAKYCE++IGLFV+VGNNYSVV+ P+ SF+YEYVGTKD     T  DQYAAKDL+T+FP +RDWI  FLD+N +M+A++I +NMLIEQVLRLL++LVKFGYYGDV D+  LL  L  L++G  D+PF P++  QG+ + +K+ KKIVQ+++Q DRY +S +T AIVNAK+AAL VL +++ F+ NARLA F++KFK+CE +E + KK+    +  ALY  F+ ++ K SA +KQ  + KELR MF+ +++ +  D +T ILI+LA+Y+Y  M +L+L++LN LYS K   FQ A  SLVL T DSC VHREV+KQVPLLRM A+SKW+ EQ  +M+ I  EL E CHLPKA EEPHPMNQR++ S N++ V+ +IL+ ETD+QL+E Y +T  VLRKA++LLKA+ L+YPDVQ Q+F +LD LLRV+LVES+LA+ LKEVF NNQ LCL++LP+QI +IV L AEHQ++APEFL+LL AIVKVEG GLALKRNQTLVMKYIMQ+YS  AYILEQ  ++ R  VL    G DH QYL+S I+LL+TCAEGENRYIESLCQTILSV++IL +LN P++ NHLK+PFL+Y+ FAY+K    + E+ + +I+ +    +IW ++ +LG E+  L  +I  ++  + VY++  KPFPK ++ H TC +C+ LVS+D  KPLKLN ENA+++++ED++R H+S+HY+FD+V  FL  ++++ ++ D + D ++E++++D +T   V  C  L+  + +P  L  M++C++ ++ +S+ P +IMEPVVE IGKG K+ DT++QMK GN+EYY QE+ +N KLK+ A N SL++ GHNTV+AQLK++SNR+YTT+ GD+ LPL +EFQ+H++C I   ++K E +YK+  LL+N L I ATT+   ++ TT    K R EQE+L +R LQ+LRA +HNEERKLP DW+ RT+EFR+KKGL+NI DIQ TLNSF+     LPHLA+ S  +AKEVLSL  MMLFNAN  +Q+S+L+YFL TKEEVFFYAVRNRLQ+S ANIKERRLL++QQ +R+ EA+ QA+NL  TMTLG +A+++I+      +++ A N L+   S T+   Q ++ K +  +G    TP  +  +  G    +         +N L G   E +A   +   A ++   E E    +    DE ISMKDDGYI LVLK+LA ICDGQH GLQ YLREQPDN+KSFN+VAEV QF+NV Y+NIN DTIDL+ Q+FST+NEF AGNQENR TVYDNKIIDYIN+ILR  ++  C   Q+++L+Q I NLVIS+IEEN+P+A  IA EVKDTLDK A+YR M+E YE  +                ++ K    + +   K+E ++LK  + EVGF++Y ILARLYD+DP +GKKD                    + L I+  QQKAFKF+KKN+++IE+LK D LQKVHFR+RNKN++REE+KE +KWNVDRSSPS KIRDFMDW+K+IL DI YQKK ++NP     T  WL+WN+A T+ +VI+NL+ML   +A    +   +  +     ++P    N    WK +FE+L+ W  AF    ++L   +L  +F+A+HP PP ++     ++R        E DPA  D   +G EG  K+  +L S  T YY +    + AG +Y PYFFAFHL+N+V+NNQLLQGVI AVT NG SLIWV++LG+ ++YL++++ FA  R GF     ++C  L  CFV+V+RFGL+GDLFEN++P +   +F +F  + I+H+ FFILITT+GLNIIFGIIVDTFSELR++KWTAE DMRD CFICSR++YDFEHHGQGF+YHV NEHNMW+YIFFFIHLQDT  NDYTSL++ V  LL E+K+DFFP+NRALCL+AKDEDST+SKIDELL++V  L+ HQK E++ERKR+ EL RQ++WQ+R
Sbjct:  174 EAKQHFEQARCAANAENVDNMAEQKRNQGKRVRYGEIIQLKHVFTGKFVHVNTNQTSQYDKNNMLLSLHEFNSKNAQFRILPRYKVKSEGEYVQLLDQTSFESIKSPGHFFHASHGFPIEAGRIVSELNLGVDQTGFTILKSHTHYGEFEAFARGGQFVQLFHKELEAYVVAEGLFDDEVTEGVHLRIREVDQLNARTLRQSTSAITYWQVESEKTMLNGDILTWDQQFRFRHATTRKYLCLQQEGSGYVVSLLDDATDPHTVFKLHPVLQETAELKFESYARIEHVITGSWLHAIKDKAYERREFLNMEDEKSMKALRWDGGELREVTCCSDRRYDDAYTIKKVEQLQVQNFNFVAGMVPFLQNLIAMRQSGKQLVGKETFGICHALKELRDFMVVNGEPCKEKQKLLRNLRVIDLLVTLLKFPLKGTSDEHNLSRVFYYAYDILHTYMLGNSRKNALYFAKYIEFFQTQMIDKSDLALKVTKMLVELMKDNRKIVDRISKEQIDDFVDLLRKNEHYSYLELLKVLCVCNGVAITDNQSYIAQKWLLEDTRGIYLSERGQNIDRKPNETYVSTDQMKTWTPLVDFVQPDESDQESVERCLFLRTQLDLFIALCHGRNEECIRLITKDLSYLTWEEAYLGLSSDSLPQAFRAKYCEIVIGLFVNVGNNYSVVESPQLSFIYEYVGTKDSVGSATAPDQYAAKDLITVFPVIRDWITQFLDQNRFMVAAQIPNNMLIEQVLRLLHYLVKFGYYGDVHDLAMLLPPLKNLLNGENDVPFLPDKSSQGRADYTKDNKKIVQRFKQHDRYKKSPQTLAIVNAKHAALRVLDLVMTFQENARLASFISKFKDCEMSE-VKKKQARHPMVPALYSSFDSFDTKKSARKKQNAIRKELRIMFDESSRYLDTDNLTAILIDLANYEYDPMVELSLQLLNKLYSSKSSMFQRAINSLVLTTPDSCRVHREVSKQVPLLRMTARSKWTAEQARKMQTILGELYELCHLPKAEEEPHPMNQRLMISHNILPVIFDILATETDAQLSENYVETAGVLRKAVRLLKALTLRYPDVQEQVFAHLDDLLRVRLVESDLALALKEVFANNQELCLRVLPKQILRIVYLVAEHQERAPEFLELLSAIVKVEGTGLALKRNQTLVMKYIMQNYSRVAYILEQCSVKDRMDVLNGNRGADHCQYLVSFIDLLATCAEGENRYIESLCQTILSVQEILGILNDPDVENHLKKPFLRYMFFAYMKTTAAAGENRSLDIIHDSVTWQIWDYLDHLGRELLGLAYWIRDDADRDTVYFMTAKPFPKIMRLHDTCPLCSSLVSEDESKPLKLNLENAVVKMREDDYRGHSSLHYVFDAVFPFLQAFAQKFYVVDEDKDFQNEREIFDRMTTGAVEFCCQLASIVVEPKVLTQMVSCLSCIVKRSSHPPSIMEPVVENIGKGTKLQDTVSQMKSGNKEYYEQEIILNTKLKSLAVNLSLLWGGHNTVKAQLKVNSNREYTTIGGDEALPLDEEFQSHVRCLIGMGSRKPEQRYKLGALLVNGLRICATTSGTTHVPTTSTETKLRREQERLTVRILQILRAFMHNEERKLPADWEVRTTEFRVKKGLRNISDIQTTLNSFELVKHALPHLASTSSLVAKEVLSLLGMMLFNANERVQESMLNYFLHTKEEVFFYAVRNRLQMSTANIKERRLLISQQKARQSEAKSQAENLRATMTLGIKALQQIKQYRIEMKIEQANNDLTRRVSLTKMQSQSMMTKRRKESG--SQTPSNSSGKKSGGSGNKKVAF-----ANGLKGESQEPMAQSLLEESASSDSGAEVENLASQTHDEDETISMKDDGYIALVLKVLASICDGQHFGLQNYLREQPDNIKSFNIVAEVSQFINVAYSNINGDTIDLLIQLFSTVNEFCAGNQENRATVYDNKIIDYINFILRSSDFESCEPQQVVQLRQTIANLVISLIEENSPEALVIAREVKDTLDKGALYRAMSECYEAQQ----------------RTGKDGGFLVRLFKKEENRELKEAMYEVGFTFYVILARLYDIDPAMGKKDSD---------------PYGRELQISDIQQKAFKFFKKNAMTIEILKNDNLQKVHFRVRNKNVLREELKEKLKWNVDRSSPSTKIRDFMDWTKAILKDIHYQKKVLSNPFTILLTRLWLIWNHAATLTAVIINLIMLIGLEATDTPTMLADTGMF----TIP---ANESARWKSQFEHLEMWKDAFAYTMDILAIVILLAFFVANHPEPPNVRRIRDRLRRLRRAKADEEDDPA--DCRDRGSEGGNKLAVNLFSIATLYYLSFAACAFAGTFYCPYFFAFHLLNMVNNNQLLQGVIQAVTMNGLSLIWVSVLGIAIMYLFSVLAFARLRRGFGGL--MFCSDLSQCFVTVLRFGLIGDLFENMVPREDSPTFDSFFWMAIFHIVFFILITTVGLNIIFGIIVDTFSELRNMKWTAEVDMRDNCFICSRSNYDFEHHGQGFDYHVRNEHNMWAYIFFFIHLQDTAKNDYTSLELHVYKLLIEEKYDFFPMNRALCLSAKDEDSTESKIDELLQHVKNLVQHQKEEEAERKRWAELNRQRKWQRR 2726          

HSP 2 Score: 102.064 bits (253), Expect = 2.994e-17
Identity = 40/65 (61.54%), Postives = 54/65 (83.08%), Query Frame = -3
Query: 8822 CIGDFICLYCEETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKY 9016
            CIGD++ LYCE+TDG+VYS S+S+ FN L +YH  DR+ P+ +PDPQ++ FQ+ IQNRYKL+KKY
Sbjct:   35 CIGDYVGLYCEDTDGHVYSHSSSNAFNGLFVYHSLDRDHPTQVPDPQVLLFQVCIQNRYKLDKKY 99          
BLAST of SMED30029683 vs. TrEMBL
Match: A0A210PSZ2 (Inositol 1,4,5-trisphosphate receptor type 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13580 PE=4 SV=1)

HSP 1 Score: 2427.9 bits (6291), Expect = 0.000e+0
Identity = 1286/2695 (47.72%), Postives = 1783/2695 (66.16%), Query Frame = -3
Query:  971 ITFQISIQNRYKLNKKYLRKFANIED-ENVLDADT-----RQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILVKESRDPRTVFKLHPVIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLT-EKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKI-SSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMK-NAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHD-----NNDSNKLLGAEAE------ELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIA------------NEVKDTLDKEAIYRVMTEAYEMHESESLTPDGI---RPKSNTN--------KSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENF-NISKYNNS---LPD-------------FFRNPVPDWKP-RFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGL 8872
            + FQI IQNRYKLNKKY RK+ N ++ EN    ++       L  QA+ AAEAEN DN AEQ R   K+VRYGEV+QLK +F+ K++H++TTQTSQKDKNNM VSL+  N K AQF+ILPRYKVKSEGE VQ++DQI+ ES+KS GH+FHAS  F +D+F  GSELNLGVE+S FT++  Y    + E FVRGG  ++LFHKE+EAY+VAEGLFDDC+TE VH R+R IDQ   ++L  S S ITYWQIE E SI+ GD + W+QQ R RH  TR YL +D + +V L  ++ DPRTVF+LH V+++ +E+ FESYARIEH+L+G WLHALKD++Y R+       ERSM  +RWD   +RKV    +  YDDAYTIQ+V       FNF+AG+VPFL NL++D      L+AK+ + + +A +E+K FM+  G   K RQKL+RNLRVID+LV LL   L    +E++ +++  E YD+L+ YMIG SRKNALYFAKYI+ F+TQ   K  I L V Q+IVELIRD RKIVDRI+K  I+ F++ L  N NYR+L+LL+VLCVC+GV I +NQ+YI ++WL + +  VY+ +RGQNI+++PNI+YVSTD  KSW+ L+ F+  + P + ++  +FLL QLDLF A+C+GRN++   +IT++  YL+WE+ +L + +E LPD +RAKYCE+IIGLFVDVGNNYSV+DHP   FVYEYVG+KD        QY   DLVTIFP LRDW+A FL +N  M AS I HN+LIEQVLRLL  LVKFGYY D+DDV+ LL  L+ L+DG+ D+PFP ++ GK  +KE +K+V +Y+   R+  SKE  AI+NAKY A+EVL  +L F+ N RL  F+ KFK+CE+N G        +L   +YE FNP+++    VR QK ++KEL+EM  +++   I+  T++L +L+ Y Y KM   +L++LN LYS + D FQ A+++ +L+T DS  VHREV + +P+LR +AK K +DEQV     I  EL  FCHLPK  EEPH MNQ IL S  V+  +++ILS E D++L  ++Y   + + +K L LL  +  +   +Q  +F +LD LL V++V S LA+ LKE+F+ NQ  CLK+  +QI KIV LAA++Q +APEFL+LL  +VKVEGL L +KRNQ LVMKYIMQ++  AAY+L+QP ++RE +L  +    H+ Y I L++LLSTCAEGEN++IESLCQTI+ VE+IL VLNH +I  +LK+PF+KY+++ YLK   N  ES  A++  +K++W F+ +  + I  L+  I +   + V  LL +P                     P K       +A+    +     H  + Y+ ++V+ F+ ++    +  D +    E D  + L + + + C      +T P H+KA+ A +T +I  ST   ++   V+E      ++ DT + +++GN EYY  E+++N K  TFA N ++I+ G+NTV AQ+K   S R+YT    ++ L LG+EFQ+ +KCFI  + +K   ++  A +L+ QL IS  +   G LA T          E+LDI+C+Q+LRA+IHNEERKLPEDW T TS+ +IKK L  I+++QN LN   F  K+LPH+A  SD IA+EVL+  ++MLFNAN  +QKS+LD+FL T+EEVFF AVR+R+Q+S  +IKE+R LLAQ  +R KEA     +   ++T+G +A++ I+     QR+K   +   S  S+ ++     +K  + K K   + +F++S    +  N   HD     +N    LL    +      E+ + +V        E +  +  +   + +  KDDGYIELVLKLLAR+CDGQH GLQ Y+REQPDNVKSFN+V E  QFLNVVY+ IN  TIDL+ QVFST+NEF +GNQENR  +YD K++DYIN+ILR G   DC   ++++L+Q I +LVI++IEEN P  +Q+A             EVKDTLDK A+YR MT+ +EMH+++    D +    P  +TN         +F   +I      K E   +K  L EVGF++Y ILAR+ D+DP + ++ +                       I+P Q++AF FYKKNS+SIE++K + LQKV+FR++NKN +R+EVKE +KWNVDR+SPSNKIRD M W++ I+ DI YQ++ ++NPIA  FT GWLLWNY  T LSV +NL+ML  +    + + +E++  +++Y ++   LPD              F++PVP       +     M+A G  HN+   F+L +YFL++HPS P  +    +++    + E    D+   Q+ +EG K+     S  TFYY   LG S+ G  +  YFFAFHL+NIV+NNQLL GVI AVTQNG SL+WVAILGM+VIY+YA++GFA  R  F     LYC +LW C ++VMR+GL+GD+FE +   D   SF  F  LV+YH+SFFI ITTIGLNIIFGIIVDTFSELRDLKW  ESDM+DTCFICSRNSYDFEH G+GF++HV NEHNMW+Y+FF IHL D K +DYT+++++V  L++E+ +DFFP+NRALCL+  D DST+SKIDELL+ V+T+ N QK E++++KR  E L+QKRWQ++HR F+    + +   E D +  LG+
Sbjct:   34 VVFQICIQNRYKLNKKY-RKWQNTDNRENSSSTESPAVAKHSLALQARLAAEAENKDNEAEQTRQYGKRVRYGEVVQLKHIFTGKFVHMSTTQTSQKDKNNMKVSLHEFNAKNAQFRILPRYKVKSEGEVVQLFDQIVFESVKSHGHYFHASESFQIDHFTFGSELNLGVERSSFTLIGCYREHADQERFVRGGSVIRLFHKELEAYLVAEGLFDDCITEDVHFRVRVIDQHRPKSLSASTSGITYWQIEAEHSILDGDVIRWEQQIRMRHLLTRQYLCIDSKMDVSLANDASDPRTVFRLHSVLKERDEIQFESYARIEHMLTGCWLHALKDEDYDRRGMEEN-GERSMQGLRWDTASVRKVSASSESMYDDAYTIQEVVRLDTSNFNFVAGMVPFLFNLIQDLQLATQLNAKKTHGIIVALQELKNFMVPQGLPDKNRQKLMRNLRVIDILVNLLQCCLREGDEESHMIRIFKEAYDVLHAYMIGKSRKNALYFAKYIDFFQTQFTQKGGIGLNVAQMIVELIRDKRKIVDRITKKHIDTFIQLLIKNHNYRFLDLLQVLCVCDGVAIPNNQSYIVEQWLRKYKASVYMMDRGQNINKRPNIVYVSTDGAKSWVPLNVFVDTEGPEFVEDDYKFLLHQLDLFKALCFGRNDFSGFVITREYGYLTWEDAYLCMTAEQLPDIIRAKYCELIIGLFVDVGNNYSVLDHPNICFVYEYVGSKDAK--VEHSQYVVMDLVTIFPVLRDWLAEFLRQNCQMTASDIGHNLLIEQVLRLLQHLVKFGYYLDIDDVKQLLTPLLSLLDGTHDVPFPKDK-GKGYTKESQKLVTQYRSKGRFDSSKENEAIINAKYRAMEVLDFLLTFQRNLRLKAFVTKFKQCEQNLG------HRTLEPLMYESFNPHDQSKKVVRHQKQVLKELKEMVGSSSIFDIESTTSVLKDLSMYSYDKMVTKSLDILNKLYSSQSDMFQLASKAQILLTHDSAKVHREVQRSLPVLRRLAKQKLNDEQVTLTGEILDELAGFCHLPKNLEEPHFMNQNILVSHGVLPAILDILSQEIDAKLVDQQYKGMKTIFKKTLDLLALITRENSAMQEAMFNHLDTLLEVQIVPSCLALALKELFIANQTTCLKVHSKQIQKIVLLAAQYQSEAPEFLELLKVLVKVEGLDLTIKRNQALVMKYIMQNFRKAAYVLDQPRDSREQILTNKRDPGHLAYFICLVDLLSTCAEGENKFIESLCQTIMPVEEILWVLNHRDIDGNLKQPFVKYMLWVYLKPAGNLVESGAADLQHDKEMWNFVASAADTIKQLSDTITKH-RDRVALLLKQP---------------------PGK-------SAVAVPGDTNAGLHGCVFYVLEAVLPFVEVFYSMFYSPDKDLYPGEIDTTETLAQGLSSFCEVAGQFLTSPVHMKAIAASITILISVSTTNKSLYISVLERFSTEMRLGDTKSAVRKGNMEYYAGELELNAKFHTFAKNNNIIYQGYNTVAAQIKYKKSKREYTAQGTNEELLLGEEFQSLVKCFIDVHERKPAKRFLPARILLEQLQISQESIRQG-LAQT----------EELDIKCMQILRAIIHNEERKLPEDWDTCTSDQKIKKQLAYIKEVQNALNVHGFVEKVLPHVARRSDLIAREVLAFMSLMLFNANRDVQKSMLDFFLSTREEVFFMAVRDRMQISTNSIKEKRSLLAQHQARVKEAFNNMGSFNASLTVGRKALQLIQDY--EQRLKEEKMQGWSALSRAKEPP-HDQKRRSKKRKSKQQESFKKSKKLGVIPNGLAHDHTVIRDNSHEALLKPAPDSPDFTPEVELTSVNVESMKTAENMVSNIDEGVVDMLEYKDDGYIELVLKLLARLCDGQHCGLQNYMREQPDNVKSFNIVGETAQFLNVVYSTINSKTIDLIIQVFSTLNEFCSGNQENRFVIYDRKVVDYINFILRAGELADCDPEKILDLRQAIASLVIALIEENGPGKSQVAKQGKADELRYIHKEVKDTLDKNALYRCMTQCFEMHQADKPKLDDVLNNGPPGSTNYLKSAKSIAAFGGNFISGVMSGKKENASMKEMLMEVGFTFYLILARMIDIDPAMPERVD-----------------------ISPEQRRAFDFYKKNSMSIEIVKDNILQKVNFRVKNKNYLRDEVKEKLKWNVDRTSPSNKIRDLMSWTRDIMKDISYQRRILHNPIAMLFTKGWLLWNYGATFLSVAINLLMLLTW---NNKATEEDYAKLAEYGSTHAPLPDGSPGSTLSPPNWEVFKDPVPRISGISLDTYTILMYALGGTHNLFSLFVLISYFLSNHPSLPTCKEITDVVRGVFGKKE--KVDDSGDQKKEEGSKLEVKFFSFTTFYYVFFLGMSVMGTLFHGYFFAFHLLNIVNNNQLLSGVIKAVTQNGVSLLWVAILGMIVIYIYALVGFALLREFFTPGDYLYCTNLWQCTITVMRYGLIGDMFETIHQTDLRNSFEYFWPLVLYHVSFFIFITTIGLNIIFGIIVDTFSELRDLKWRTESDMKDTCFICSRNSYDFEHTGKGFDHHVRNEHNMWAYVFFLIHLDDVKTSDYTAMELYVNKLMEEENYDFFPMNRALCLSTVDVDSTESKIDELLQQVTTIANKQKQEEADKKRKVEKLKQKRWQEKHRQFMFGISTEDIHREGDTDTLLGV 2646          
BLAST of SMED30029683 vs. TrEMBL
Match: A0A1S3H9B8 (inositol 1,4,5-trisphosphate receptor type 3 isoform X13 OS=Lingula unguis OX=7574 GN=LOC106152615 PE=4 SV=1)

HSP 1 Score: 2422.12 bits (6276), Expect = 0.000e+0
Identity = 1277/2751 (46.42%), Postives = 1787/2751 (64.96%), Query Frame = -3
Query:  968 CIGDFICLYCEETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILVKESRDPRTVFKLHPVIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGT-----KDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPAT--------------------------IMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQR----MKNA-VNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRL----HDNNDSNKLLGAEAEELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNK-------SFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKR---RLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN------------------EGSLEKLDEDDNENGLGLR 9016
            CIGD+I L+CEET+GYVYS  TSS  N L IY  QDR +P  IP+P  ITF++ IQNRYKLNKKY RK      ++  + + + L  QAK +A AEN DN++EQ+R   K+VRYGE+IQLK VF+DKY+H++TTQTS +DKNNM++SL+ +N K AQF+ILPRYKVKSEGEYVQI DQI+ ES KS GH+FH+S+P+ ++  ++GSELNLGV Q+GFT+V+ Y   DE+E  VRG  F++LFHKE+EAY+VAEGLF + V E+VHLRIREIDQLN RTL   NSAITYWQ+E E +I++G  + W+QQ R RH TTR +L +D +  V L  E  DPR+VF+ HPV+ +  E+ FESY RIEHVL+GNWLHALKD+ Y+R++    E++RSM A+RWDGGE+RK+    +RRY D +TI +V  E     NF+AG+VPFL  L+E R +  +L+A + +++  A +E+K+FM++NG++ K  QKL+RN R++DLLV+LL  PL   PD    L V  E YDILYTYM G+SRKNALYFAKYIE F+TQ+  K +I L V Q++VELIRDNR+IVDRI+  QI+ FV+ LR  +NYR+L+LL VLCVC+G  I++NQ+YI + WL  D+  VYL ERGQ IH++ N++Y+STD   +W+ LH+F   D P Y +E+  +L  QLDL   +C GRN++ IR+ITKDL  L+WE  F+ L+SE+LP  +RAKYC +II LFVDVG ++SV+D     FVYE +         +++  T+  + A++L T+FP +RDWI  F++ N  M +S++  N LIEQV+RLL +LV+FG Y   D++R LL  L+ ++DG  D PFP   + +  SKE KK+V++Y++ DR+ +S ET A+V+AKY  L VL+++  F+SN RL  F++KFK  E      KKK+ S L+  + + ++ +      +RKQK  + ELR MFE+++   ++ +TNI ++L++YKY KM   +L +LN  YS K D F+ A  +LVL T +SC +H ++ +Q+PL+R +AK  ++ EQ   M  +F + + F HL   P   HPMNQ+IL +  V+ ++  ILS E D Q+TE+ +  E V  KAL LL+ +A    DVQ ++ + LD L+ +KLV S LAI L+EVF  NQN CLKI P+QI KIV LA E+Q +APEFLDLL +IVKVE L L LKRNQ LVMKY+MQ+Y  AAY+ +Q  E R  +L  + G  H +YLISL++LL+ CAEGENRYIESLCQTI+ +E+I++VLN+  I N+LK P+L+YLM+ Y+K      ES   ++  ++ +W +I  L  E   L  YI E+  + V  +   P                     PK         A+  + + +  AHA++ Y FD+V+ FL  +  + +  D E    E +  D L  S+V  C  +   +    HLK +I CV  ++  S++P                            +ME  +E  G G  + D   +  +    YY  E ++N K + F+ NCSL++ GHNTV AQLK  S R+YT + GD+ LPLG+EFQ H++CF+  N K    +Y+    L+ QL +SA   N          +    E ++LDI+ LQ+LRA+IHNEERKL EDW+  T + +++K LK I ++QNTLNS+    ++LPHL  PS+ I +E L+  ++MLFNAN  +Q+++LD F   + E FF+A+R RL+++   +KERR L  Q  +R KE+  QAK+L T +T+G +AMK+I+ +  ++R    MK A  NSL    + RQ  +      + K     +  F+  +G    E P +    H++ + N+++   ++ L++               + E D   + +  KD+GYI LVL+LLA +CDGQ+  +Q YLR+QPDN+KS N+VA+  QF+NVVY+NI   TIDLV Q+FST+NEF AGNQ NRV + DNK++DYIN+ILR G Y   S+   +EL++ I NL++S+IEEN P+  ++A EVKDT+DKEA+YR M + Y +H+     P   + K +TN        S     ++ + M K++  DLK K  EVGF Y+ ++AR YD+DP L +K                      GL+ITP+Q  A+ +YKKNS+SIEL+K   LQKVHFR++NKN++REEVKE +KW+VDRSSPSNKIRD M WSK IL DI YQ+K + NPIA FFT  WLLWNY + +LSV +N++ML  +KAP D S     N++  ++++     NP PD     E     ++A G  HN+   F+L +YFL++HP  P +     L +R   R  + E + A E   ++     K+     S  TFYY   +G S+AG ++  YFFAFHL+NIV+NNQ+LQGVI AVTQNG SL+WV ILG+++ Y+YA+I FAF R+ F  +   YC +L  C V+V+R+GL+G +F+ L   +SE +F  F+++ ++HLSFFILITTIGLN+I GI+VDTFSELRDLKWTAESDMRDTCFICSR S+DFEHHG GF  H   EHNMW+YIFFFIHL DTK+NDYT+LD+ VA  L+ ++++FFP+N AL LT  +ED TD KID +L+ V+ L+  Q+ E+S+R R EE  RQK+WQ+ +R  LS                   EG   +  +DD+  G G+R
Sbjct:    6 CIGDYISLFCEETEGYVYSYQTSSSHNGLYIYQGQDRKKPGKIPNPHAITFRVCIQNRYKLNKKY-RKLLAASSKDPENLELKALVAQAKTSANAENQDNISEQKRQHGKRVRYGEIIQLKHVFTDKYVHISTTQTSHRDKNNMLISLHQYNGKHAQFRILPRYKVKSEGEYVQILDQIVYESFKSQGHYFHSSVPWNIEKDMVGSELNLGVAQTGFTVVRYYRPSDENEANVRGSSFIRLFHKELEAYLVAEGLFGEPVQEEVHLRIREIDQLNPRTLSPPNSAITYWQVEPEDTILNGGVVRWEQQVRLRHVTTRRFLCLDADFEVCLTAEENDPRSVFRFHPVLSEQNEIDFESYCRIEHVLTGNWLHALKDEPYQRRRDMGRENDRSMQALRWDGGEVRKISSTENRRYVDVFTIHEVEWEQIYSANFVAGMVPFLSKLIESREECDYLNAMKTHQITTALQELKQFMIINGETYKDHQKLMRNFRIVDLLVQLLQSPLQDAPDSNYLLSVFKEAYDILYTYMTGNSRKNALYFAKYIEFFQTQLSLKGDIGLNVAQMLVELIRDNRQIVDRITHEQIDIFVDLLRQRKNYRFLDLLNVLCVCDGKTILENQSYITETWLRHDKADVYLIERGQYIHKEHNVVYISTDAGHTWVPLHQFANADSPYYSEEEYLYLDRQLDLLGKLCKGRNQFSIRVITKDLDILTWENTFVCLRSELLPPSLRAKYCSLIIDLFVDVGASHSVLDQHTLVFVYEDIDNPRPLYSTKSQVATNVLFLAQELGTVFPVMRDWIQEFVESNPEMYSSQVGQNKLIEQVMRLLCYLVRFGCYCSADEIRILLKPLMIMLDGRNDRPFPKNAEIQN-SKEVKKLVKQYRETDRFEKSAETKALVDAKYQGLSVLELLFTFQSNTRLESFVSKFKTAETTANAKKKKHRSVLSPLVDDSYDAFNTSKKNLRKQKKFLHELRAMFESSSYFDVEYITNISLDLSNYKYEKMLTQSLNILNKYYSSKTDMFKIAIPTLVLTTQESCKIHIDIMRQLPLVRHLAKCSYNMEQAEAMSVVFDQFVLFTHLRDEPTLRHPMNQKILINHGVLDLIFAILSQEVDVQITEQAAPMELVFGKALNLLRFLAQGNEDVQAKMNDRLDSLMNIKLVPSHLAIALREVFAGNQNNCLKIQPKQILKIVHLAGENQDRAPEFLDLLGSIVKVELLELPLKRNQGLVMKYLMQNYHKAAYLFDQSQEDRLRILTSKTGNSHQRYLISLVDLLAKCAEGENRYIESLCQTIMPIEEIMDVLNNHFIDNNLKSPYLRYLMWVYMKTAGTMIESGAGDLPHDRHVWIYIQALAREAESLKTYISENEVKTVEVMRAPP---------------------PK--------GAVAEMDDSDGAAHATLFYFFDAVLPFLQTFFTKFYSPDKELYPDELEYVDQLAHSLVLWCDRVGAVLCNATHLKVLIGCVPSVLQSSSIPKNLSTESALTNYPSLKPKQVQLWKNTYKVMEGFIEQYGNGRCLRDPTRETIDTYTIYYQNEDELNKKFRAFSVNCSLVYGGHNTVTAQLKHKSKREYTEIGGDEDLPLGEEFQAHVRCFVKHNEKNIAKRYQNVSKLVQQLAVSANAVN---------PKDGTYENDELDIKSLQILRAVIHNEERKLREDWEENTQDKKVQKQLKVILEVQNTLNSYSAVEEVLPHLGRPSNAIVRESLAFLSIMLFNANRNVQRTMLDVFKSMRTETFFFAIRIRLEIAANGLKERRALATQHEARVKESMTQAKSLQTNLTVGRKAMKDIQAIERSRRQSRLMKGARANSLRALQRDRQSGLTSISPASSKCNSLQR--FKLPNGSLNEETPLVFGSNHNDIELNEVMVEGSDNLSV---------------DVEEDDVLDGLEFKDEGYIVLVLRLLAAMCDGQNQSIQDYLRDQPDNIKSINVVADTAQFVNVVYSNITASTIDLVIQLFSTLNEFTAGNQANRVVLLDNKVVDYINFILRAGKYEGISMEMQLELREVIANLLVSLIEENGPEPIKVAREVKDTVDKEAVYRCMVDCYSIHQ-----PPTYKAKISTNMGDNMKNLSQMGGGLLREIMEKNKKNDLKDKAYEVGFLYFLLMARFYDIDPVLNEK---------------------AGLVITPDQMAAYNYYKKNSMSIELMKDGNLQKVHFRVKNKNVLREEVKEKLKWDVDRSSPSNKIRDLMAWSKDILKDIYYQRKMLRNPIAVFFTKFWLLWNYLVILLSVAINVLMLWAWKAPYDMSQAPE-NMTHLDHAI----YNPNPD-TSSVEIYDLLLYAMGGTHNLFSLFVLISYFLSNHPKCPSLSAIPNLCRRLCGRKDEEEDEIAHEVDCEKAKRQSKLDVKFFSLATFYYVIFVGMSVAGTFFHGYFFAFHLLNIVNNNQILQGVIKAVTQNGVSLLWVGILGVIIFYIYALISFAFMRALFLPKDEEYCGTLLECSVTVIRYGLIGAIFDRLTLPESENNFIAFAVVAVFHLSFFILITTIGLNVILGIVVDTFSELRDLKWTAESDMRDTCFICSRGSHDFEHHGNGFLKHAREEHNMWAYIFFFIHLDDTKSNDYTALDLHVAQALQREQYEFFPMNCALSLTG-EEDGTDEKIDAVLEKVTELLRRQREEESKRMREEEHRRQKQWQEMYRKALSGSHDTLAAAIEGPRRPEDREGDAARYSDDDDSRG-GVR 2665          
BLAST of SMED30029683 vs. TrEMBL
Match: A0A1S3H6U8 (inositol 1,4,5-trisphosphate receptor type 3 isoform X12 OS=Lingula unguis OX=7574 GN=LOC106152615 PE=4 SV=1)

HSP 1 Score: 2414.42 bits (6256), Expect = 0.000e+0
Identity = 1284/2776 (46.25%), Postives = 1791/2776 (64.52%), Query Frame = -3
Query:  968 CIGDFICLYCEETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILVKESRDPRTVFKLHPVIQ-----------DSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDR--------------RGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGT-----KDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPAT--------------------------IMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQR----MKNA-VNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRL----HDNNDSNKLLGAEAEELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNK-------SFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKR---RLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN------------------EGSLEKLDEDDNENGLGLR 9016
            CIGD+I L+CEET+GYVYS  TSS  N L IY  QDR +P  IP+P  ITF++ IQNRYKLNKKY RK      ++  + + + L  QAK +A AEN DN++EQ+R   K+VRYGE+IQLK VF+DKY+H++TTQTS +DKNNM++SL+ +N K AQF+ILPRYKVKSEGEYVQI DQI+ ES KS GH+FH+S+P+ ++  ++GSELNLGV Q+GFT+V+ Y   DE+E  VRG  F++LFHKE+EAY+VAEGLF + V E+VHLRIREIDQLN RTL   NSAITYWQ+E E +I++G  + W+QQ R RH TTR +L +D +  V L  E  DPR+VF+ HPV+            +  E+ FESY RIEHVL+GNWLHALKD+ Y+R++    E++RSM A+RWDGGE+RK+    +RRY D +TI +V  E     NF+AG+VPFL  L+E R +  +L+A + +++  A +E+K+FM++NG++ K  QKL+RN R++DLLV+LL  PL   PD    L V  E YDILYTYM G+SRKNALYFAKYIE F+TQ+  K +I L V Q++VELIRDNR+IVDRI+  QI+ FV+ LR  +NYR+L+LL VLCVC+G  I++NQ+YI + WL  D+                VYL ERGQ IH++ N++Y+STD   +W+ LH+F   D P Y +E+  +L  QLDL   +C GRN++ IR+ITKDL  L+WE  F+ L+SE+LP  +RAKYC +II LFVDVG ++SV+D     FVYE +         +++  T+  + A++L T+FP +RDWI  F++ N  M +S++  N LIEQV+RLL +LV+FG Y   D++R LL  L+ ++DG  D PFP   + +  SKE KK+V++Y++ DR+ +S ET A+V+AKY  L VL+++  F+SN RL  F++KFK  E      KKK+ S L+  + + ++ +      +RKQK  + ELR MFE+++   ++ +TNI ++L++YKY KM   +L +LN  YS K D F+ A  +LVL T +SC +H ++ +Q+PL+R +AK  ++ EQ   M  +F + + F HL   P   HPMNQ+IL +  V+ ++  ILS E D Q+TE+ +  E V  KAL LL+ +A    DVQ ++ + LD L+ +KLV S LAI L+EVF  NQN CLKI P+QI KIV LA E+Q +APEFLDLL +IVKVE L L LKRNQ LVMKY+MQ+Y  AAY+ +Q  E R  +L  + G  H +YLISL++LL+ CAEGENRYIESLCQTI+ +E+I++VLN+  I N+LK P+L+YLM+ Y+K      ES   ++  ++ +W +I  L  E   L  YI E+  + V  +   P                     PK         A+  + + +  AHA++ Y FD+V+ FL  +  + +  D E    E +  D L  S+V  C  +   +    HLK +I CV  ++  S++P                            +ME  +E  G G  + D   +  +    YY  E ++N K + F+ NCSL++ GHNTV AQLK  S R+YT + GD+ LPLG+EFQ H++CF+  N K    +Y+    L+ QL +SA   N          +    E ++LDI+ LQ+LRA+IHNEERKL EDW+  T + +++K LK I ++QNTLNS+    ++LPHL  PS+ I +E L+  ++MLFNAN  +QK++L+YF+ TK+E FF+A+R RLQLS   IKERR L  Q  +R KE+  QAK+L T +T+G +AMK+I+ +  ++R    MK A  NSL    + RQ  +      + K     +  F+  +G    E P +    H++ + N+++   ++ L++               + E D   + +  KD+GYI LVL+LLA +CDGQ+  +Q YLR+QPDN+KS N+VA+  QF+NVVY+NI   TIDLV Q+FST+NEF AGNQ NRV + DNK++DYIN+ILR G Y   S+   +EL++ I NL++S+IEEN P+  ++A EVKDT+DKEA+YR M + Y +H+     P   + K +TN        S     ++ + M K++  DLK K  EVGF Y+ ++AR YD+DP L +K                      GL+ITP+Q  A+ +YKKNS+SIEL+K   LQKVHFR++NKN++REEVKE +KW+VDRSSPSNKIRD M WSK IL DI YQ+K + NPIA FFT  WLLWNY + +LSV +N++ML  +KAP D S     N++  ++++     NP PD     E     ++A G  HN+   F+L +YFL++HP  P +     L +R   R  + E + A E   ++     K+     S  TFYY   +G S+AG ++  YFFAFHL+NIV+NNQ+LQGVI AVTQNG SL+WV ILG+++ Y+YA+I FAF R+ F  +   YC +L  C V+V+R+GL+G +F+ L   +SE +F  F+++ ++HLSFFILITTIGLN+I GI+VDTFSELRDLKWTAESDMRDTCFICSR S+DFEHHG GF  H   EHNMW+YIFFFIHL DTK+NDYT+LD+ VA  L+ ++++FFP+N AL LT  +ED TD KID +L+ V+ L+  Q+ E+S+R R EE  RQK+WQ+ +R  LS                   EG   +  +DD+  G G+R
Sbjct:    6 CIGDYISLFCEETEGYVYSYQTSSSHNGLYIYQGQDRKKPGKIPNPHAITFRVCIQNRYKLNKKY-RKLLAASSKDPENLELKALVAQAKTSANAENQDNISEQKRQHGKRVRYGEIIQLKHVFTDKYVHISTTQTSHRDKNNMLISLHQYNGKHAQFRILPRYKVKSEGEYVQILDQIVYESFKSQGHYFHSSVPWNIEKDMVGSELNLGVAQTGFTVVRYYRPSDENEANVRGSSFIRLFHKELEAYLVAEGLFGEPVQEEVHLRIREIDQLNPRTLSPPNSAITYWQVEPEDTILNGGVVRWEQQVRLRHVTTRRFLCLDADFEVCLTAEENDPRSVFRFHPVLSLREQDLDPDTPEQNEIDFESYCRIEHVLTGNWLHALKDEPYQRRRDMGRENDRSMQALRWDGGEVRKISSTENRRYVDVFTIHEVEWEQIYSANFVAGMVPFLSKLIESREECDYLNAMKTHQITTALQELKQFMIINGETYKDHQKLMRNFRIVDLLVQLLQSPLQDAPDSNYLLSVFKEAYDILYTYMTGNSRKNALYFAKYIEFFQTQLSLKGDIGLNVAQMLVELIRDNRQIVDRITHEQIDIFVDLLRQRKNYRFLDLLNVLCVCDGKTILENQSYITETWLRHDKVSFDAKTCHIHLTGADVYLIERGQYIHKEHNVVYISTDAGHTWVPLHQFANADSPYYSEEEYLYLDRQLDLLGKLCKGRNQFSIRVITKDLDILTWENTFVCLRSELLPPSLRAKYCSLIIDLFVDVGASHSVLDQHTLVFVYEDIDNPRPLYSTKSQVATNVLFLAQELGTVFPVMRDWIQEFVESNPEMYSSQVGQNKLIEQVMRLLCYLVRFGCYCSADEIRILLKPLMIMLDGRNDRPFPKNAEIQN-SKEVKKLVKQYRETDRFEKSAETKALVDAKYQGLSVLELLFTFQSNTRLESFVSKFKTAETTANAKKKKHRSVLSPLVDDSYDAFNTSKKNLRKQKKFLHELRAMFESSSYFDVEYITNISLDLSNYKYEKMLTQSLNILNKYYSSKTDMFKIAIPTLVLTTQESCKIHIDIMRQLPLVRHLAKCSYNMEQAEAMSVVFDQFVLFTHLRDEPTLRHPMNQKILINHGVLDLIFAILSQEVDVQITEQAAPMELVFGKALNLLRFLAQGNEDVQAKMNDRLDSLMNIKLVPSHLAIALREVFAGNQNNCLKIQPKQILKIVHLAGENQDRAPEFLDLLGSIVKVELLELPLKRNQGLVMKYLMQNYHKAAYLFDQSQEDRLRILTSKTGNSHQRYLISLVDLLAKCAEGENRYIESLCQTIMPIEEIMDVLNNHFIDNNLKSPYLRYLMWVYMKTAGTMIESGAGDLPHDRHVWIYIQALAREAESLKTYISENEVKTVEVMRAPP---------------------PK--------GAVAEMDDSDGAAHATLFYFFDAVLPFLQTFFTKFYSPDKELYPDELEYVDQLAHSLVLWCDRVGAVLCNATHLKVLIGCVPSVLQSSSIPKNLSTESALTNYPSLKPKQVQLWKNTYKVMEGFIEQYGNGRCLRDPTRETIDTYTIYYQNEDELNKKFRAFSVNCSLVYGGHNTVTAQLKHKSKREYTEIGGDEDLPLGEEFQAHVRCFVKHNEKNIAKRYQNVSKLVQQLAVSANAVN---------PKDGTYENDELDIKSLQILRAVIHNEERKLREDWEENTQDKKVQKQLKVILEVQNTLNSYSAVEEVLPHLGRPSNAIVRESLAFLSIMLFNANRNVQKAMLEYFMSTKKESFFFAIRCRLQLSAIAIKERRALATQHEARVKESMTQAKSLQTNLTVGRKAMKDIQAIERSRRQSRLMKGARANSLRALQRDRQSGLTSISPASSKCNSLQR--FKLPNGSLNEETPLVFGSNHNDIELNEVMVEGSDNLSV---------------DVEEDDVLDGLEFKDEGYIVLVLRLLAAMCDGQNQSIQDYLRDQPDNIKSINVVADTAQFVNVVYSNITASTIDLVIQLFSTLNEFTAGNQANRVVLLDNKVVDYINFILRAGKYEGISMEMQLELREVIANLLVSLIEENGPEPIKVAREVKDTVDKEAVYRCMVDCYSIHQ-----PPTYKAKISTNMGDNMKNLSQMGGGLLREIMEKNKKNDLKDKAYEVGFLYFLLMARFYDIDPVLNEK---------------------AGLVITPDQMAAYNYYKKNSMSIELMKDGNLQKVHFRVKNKNVLREEVKEKLKWDVDRSSPSNKIRDLMAWSKDILKDIYYQRKMLRNPIAVFFTKFWLLWNYLVILLSVAINVLMLWAWKAPYDMSQAPE-NMTHLDHAI----YNPNPD-TSSVEIYDLLLYAMGGTHNLFSLFVLISYFLSNHPKCPSLSAIPNLCRRLCGRKDEEEDEIAHEVDCEKAKRQSKLDVKFFSLATFYYVIFVGMSVAGTFFHGYFFAFHLLNIVNNNQILQGVIKAVTQNGVSLLWVGILGVIIFYIYALISFAFMRALFLPKDEEYCGTLLECSVTVIRYGLIGAIFDRLTLPESENNFIAFAVVAVFHLSFFILITTIGLNVILGIVVDTFSELRDLKWTAESDMRDTCFICSRGSHDFEHHGNGFLKHAREEHNMWAYIFFFIHLDDTKSNDYTALDLHVAQALQREQYEFFPMNCALSLTG-EEDGTDEKIDAVLEKVTELLRRQREEESKRMREEEHRRQKQWQEMYRKALSGSHDTLAAAIEGPRRPEDREGDAARYSDDDDSRG-GVR 2690          
BLAST of SMED30029683 vs. Ensembl Cavefish
Match: itpr1a (inositol 1,4,5-trisphosphate receptor, type 1a [Source:ZFIN;Acc:ZDB-GENE-070604-3])

HSP 1 Score: 184.882 bits (468), Expect = 9.278e-46
Identity = 140/535 (26.17%), Postives = 242/535 (45.23%), Query Frame = -3
Query: 1013 EVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLK-----QNELDPADE-DIIQQ--------GDEGCKMRSH--LISSKTFY----YFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLY-------------------------CDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSL 2467
            E K  V ++ +R    +KI DF   +  + N++R+QKK    P+  + +     W+     L+V++N+  L  F  P D   D     S                      +L  W+   G +     GF++        PSP  ++   I    RL      Q+ L      ++  +        G+ G   R +  ++  + F     Y  I    L G  +   F++  L ++V+  + L  VI +VT+NG+S++  A+LG++++YL++I+G+ FF+  F  E N                           CDSLW C ++V+  GL     VGD+     P   E     F+  VIY L FF L+  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W Y++F + ++   + +YT  + +VA ++KE   D+FP  RA+ L + D +   +++  L + + + +    +  ++    +E + ++R  K+  G L N   L
Sbjct: 2131 ESKLRVYYSTERDEQGSKINDFFLRADDLYNEMRWQKKLRAQPVLYWCSRNMSFWSNVSFNLAVLINV--LVAFFYPLDSVRDSTLEPSL---------------------SLLLWVCVLGSL-----GFVVLL------PSPNAVRILVISSVLRLGFSLGLQHMLSLLGAFNVCNKIVFLLSFVGNRGTFTRGYRAMVMDREFLFHLLYLLICTLGLCGHVF---FYSLLLFDLVNREETLLNVIKSVTRNGRSIVLTAVLGLILVYLFSIVGYIFFKDDFILEVNRIPNRNINVCVFGMLCPFVCADDVERACDSLWMCMITVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFLVIIIVLNLIFGVIIDTFADLRSEKQRKEEVLKTTCFICGLERDKFDNKTVTFEEHIKEEHNLWHYLYFIVLVRVKDSTEYTGPESYVAQMIKEHNLDWFPRMRAMSLVSSDGEGEQNELRCLQEKLESTMRLVSNLTNQLTELKEQMTEQRKHKQRIGLLGNPAHL 2623          

HSP 2 Score: 150.599 bits (379), Expect = 2.132e-35
Identity = 222/926 (23.97%), Postives = 378/926 (40.82%), Query Frame = -3
Query: 6515 IGDFICLYCEETDGYVYSMSTSSFFNNLAIYHKQDRNQP--SHIPDPQM----ITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAV------DEES---------------------------NVILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFM------------LVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPD-------------EANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVS--TDCMKSWI------------ALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPER-----SFVYEYVGTKD-QNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE---NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVR 9013
            IGD   LY E         STS F + L +   +   QP    + +P        F++   NRY   K++  K A     +  D     L ++   AA+ E   N +E ++     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  E  ++GG  V+LFH E E ++      DD   +Q ++ +R   + +A T  TS+ A+  W++E  +     G    W+  FRF+H  T  YLA       +EE                             ++ V +  D  ++F+L P      +  V   SY R+ H+ +  W+H+      K       E+E+ +  +R     L++     D+   +A+ I  V P   R  +F       L + +  +L++  +   E   V     ++  F+            +   K  + RQKL+R   ++  + KLL  P     D              A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV     I   Q  I    +L+   G  L E   +     N   ++   D  + W+            ++ +  Q    G+  D E + +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C M++ + VD      V   P +     S +   +   D  N  T+ D+   K     F    +++  +L +    ++  + K E N L  +V+ L   L+ FG+Y   D +R
Sbjct:   11 IGDICSLYAEG--------STSGFISTLGLVDDRCVVQPDAGDLNNPPKKFRDCLFRLCPMNRYSAQKQFW-KAAKPGGTSTTDT---VLLNKLHHAADLEKKQNESENKKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDAAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASGHQLVDN-PGCNEVNSVNCSTSWKIVLFMKWSDNQEVVLKGGDVVRLFHAEQEKFLTC----DDHRKKQ-YVFLRTTGRQSA-TSATSSKAL--WEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVNPDYEEECLESRSSVSVCLLYTQLWKKLRDHFIMYTLVSVPDGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNHPIDK-------EEEKPV-MLRIGTSPLKE-----DK---EAFAIVPVSPAEVRDLDFANDASKVLAS-IAGKLEKGTITQNERRAVTKLLEDLVYFVVDIPNSAQDVLEITVNKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELADQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFRFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICNA-VLDPANGDILIETKYDKICATNHCRLTDREDEEEVWLFWKDSSGEVKSKSIRELAQDAKDGHTEDQEVISYYRYQLNLFARMCLDRQYLAINKISAQLDV---DLILRCMSDEDLPFDLRASFCRMMLHMHVDRDPQEQVT--PVKYARLWSEIPSQISIDDYDNDGTSRDEVKEK-----FSQTMEFVENYLRDVVCQSFPFSDK-EKNKLTFEVVNLARNLIYFGFYNFSDLLR 880          

HSP 3 Score: 79.7221 bits (195), Expect = 6.071e-14
Identity = 120/560 (21.43%), Postives = 227/560 (40.54%), Query Frame = -3
Query: 4916 KETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKE--CERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMA--------KSKWSDEQVNRMENIFSE----------------------------------LIEFCHLP-KAPEEPHPMNQRILDSDNVIGVVMEILSV--ETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAV----LKEELGEDH--VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFI-----------GNLGEEIH---YLTQYILESPHELVYYLLTKPF 6373
            K+   +++ K   +E+LQ ILN   + R++  ++ FK    E N  +    NP S   AL   F   E++   +              E  T + +D         +L++L  + Y  +   AL +L   +S +Q+  QA  +  +L+T+     ++++   +  LR +         K + SD  ++  E I SE                                  L + C +   +  +     QR+L +     VV+E+L +  E D  + E  +   + L+              + QNQ  + +++++ L   ++E   A+T++ +F+NN  LC +I  R +   V     H  ++  +L  L  IVK E     +K+ Q +VM  ++ +              +  V    L+ E  +D+  ++Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+              N  +  H    L +Y+ E+   +V    + PF
Sbjct:  952 KQDILVMDTKLKIIEILQFILNVRLDYRISCLLSIFKREFDESNSQVEPSINPDSHTSAL--DFEHIEEQAEGIFGGS----------EENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSRALHLLFRHFSQRQEVLQAFKQVQLLVTSQDVENYKQIKADLDQLRSIVEKSELWVYKRQGSDSGLHTGEGIASETHHKSDSISDGMDKPKVESTSSSNYRLMKEILLRLSKLCVMECLSGRKNKKQQQRLLRNMGAHSVVLELLQIPYEKDVWMQEIMTLAHQFLQNFCA---------GNQQNQTLLHKHINLFLNPGILE---AVTMQHIFMNNFQLCSEINERVVQHFVHCIETHG-RSVHYLKFLQTIVKAENK--FIKKCQDIVMAELVNAGEDVLVFYNDRASFQTLVQMMRLERERLDDNSALRYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKMAYVNFLNHCYV-----DTEVEMKEIYTSNHMWKLFDDFLVDICRVCNNTSDRKHADTVLERYVTETIMSIVTTFFSSPF 1479          
BLAST of SMED30029683 vs. Ensembl Cavefish
Match: itpr1b (inositol 1,4,5-trisphosphate receptor, type 1b [Source:ZFIN;Acc:ZDB-GENE-070604-2])

HSP 1 Score: 172.94 bits (437), Expect = 3.198e-42
Identity = 134/540 (24.81%), Postives = 240/540 (44.44%), Query Frame = -3
Query: 1028 IREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAP----KDGSFDENFNISKYNN---SLPDFFRNPVPDWKPRF--ENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF-----------------------------------NTE--------KNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLS 2476
            + +E K  V +  +R    +KI DF   S+ + N++ +QKK    PI  + +     W+     L+V++NL  L  F  P    + G+ D + +   +     SL      P P          +   +F+ GL   +   FLL  + + +     ++ +    +  R                G      ++ ++  +  Y+   L     G +   +F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+G+ FF+  F                                    TE        K   CDSL  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+FF + ++   + +YT  + +VA +++E   D+FP  RA+ L + D +   ++I  L + + + +    +   +    +E + ++R QK+  G L 
Sbjct: 2185 LTQESKLRVYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPILYWCSRNMSFWSSISFNLAVLMNL--LVAFFYPLGGIRGGTLDPHLSALLWVAMLVSLAIVIVLPQPHGIRALIASTILRLIFSVGLEPTL---FLLGAFNVCN-----KVIFLMSFVGNR----------------GTFTRGYKAMIMDVEFLYHLLYLIICSLGVFVHVFFYSLLLFDLIYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILAVDRIPNKTMMSEFLTGGVCRKEGGGENCSSEVTTETVAMVVEDKERTCDSLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLIKVKDSTEYTGPESYVAEMIREHNLDWFPRMRAMSLVSSDAEGEQNEIRSLQEKLESTMKLVSNLSGQLTELKEQMTEQRKQKQRIGLLG 2693          

HSP 2 Score: 148.288 bits (373), Expect = 9.436e-35
Identity = 202/824 (24.51%), Postives = 337/824 (40.90%), Query Frame = -3
Query: 6797 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLA-----------------VDEES----------------NVILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQF------STTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPL-------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCV-------------CNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYV-------STDCMKSWIALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVD 9013
            IGD   LY E  T+G++   ST    ++  +         N P    D     F++   NRY   K++  K A     +  D     L ++   AA+ E   N +E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  E  ++GG  V+LFH E E ++      DD   +Q ++ +R   + +A T  TS+ A+  W++E  +     G    W+  FRF+H  T  YLA                 +D E                  ++ V +  D  ++F+L P      +  V   SY R+ H+ +  W+H+     DKE ++         +  ED+ +   +     E+R +D       +DA  +                   F+  LLED +   F        +  + +++ E M+   K  + RQKL+R   ++  + KLL  P               G    A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV             CN V    N   + +  L+  R  +     G+   E              ST  ++S  ++ +  Q    G   D E V +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C +++ + VD
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPDTGDLNNPPKKFRD---CLFKLCPMNRYSAQKQFW-KAAKPGGNSTTDT---VLLNKLHHAADLEKKQNESENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASTHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWSDNKEVILKGGDVVRLFHAEQEKFLTC----DDHRKKQ-YVFLRTTGRQSA-TSATSSKAL--WEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVNPDYEEESHESRSSLDSEHEALRARLRTPNEKVMYTLVSVPDGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNNPIDKEEEKPVMLRIGTSAIKEDKEAFAIVPVPPAEVRDLDFA-----NDASKVLASIAGKLEKGTITQNERRFVTKLLEDLV---FF----VVDIPNSGQDVLEIMV--NKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFRFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICNAVLDPANADILIETKLVLSRFEIEAVNVGEPPVEAEEDEEEVWLFWKDSTKEIRSK-SIRELAQDAKEGQKEDQEVVSYYRYQLNLFARMCLDRQYLAINKISGQLDV---DLILRCMSDEDLPYDLRASFCRLMLHMHVD 791          

HSP 3 Score: 70.4774 bits (171), Expect = 3.863e-11
Identity = 66/259 (25.48%), Postives = 117/259 (45.17%), Query Frame = -3
Query: 4916 QNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPF 5617
            QNQ  + +++++ L   ++E   AIT++ +F+NN  LC +I  R +   V     H +   ++L  L  IVK E     +K+ Q +VM  ++ +       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L +Y+ E+   +V    + PF
Sbjct: 1254 QNQALLHKHINLFLNPGILE---AITMQHIFMNNFQLCSEINERVVQHFVHCIETHGRHV-QYLKFLQTIVKAENK--FIKKCQDIVMAELVNAGEDVLVFYNDRASFQTLVQMMRSERDRMDEN---SPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYIDFLNHCYV-----DTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADATLERYVTETVMSIVTTFFSSPF 1498          
BLAST of SMED30029683 vs. Ensembl Cavefish
Match: itpr2 (inositol 1,4,5-trisphosphate receptor, type 2 [Source:ZFIN;Acc:ZDB-GENE-050419-192])

HSP 1 Score: 168.703 bits (426), Expect = 6.253e-41
Identity = 220/914 (24.07%), Postives = 385/914 (42.12%), Query Frame = -3
Query: 6482 IGDFICLYCEET-DGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILVKESR----------------DPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQQF------STTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFM-LVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDE-------------ANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYL-------TERGQN---IHEQPNILYVSTDCMKSWIALHK--------FLQVDYPG---YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE--NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID 9013
            IGD + LY E T +G++   ST    ++  +   +     N P    D     F++   NRY   K++ +     +  N  + D   L  + + AAE E   N  E ++   + V+Y +VIQL  + S+KY+ VN    +  +KN M VSL+P  ++ + F I P +K++SEG+ V + D+++L  + + G   HAS    LDN    +E+N     + + +       D  +  ++GG  V+LFH E E ++  +   D     Q H+ +R   + +A T  TS+ A+  W++E        G    W+  FRF+H  T  YLA + ES+ +  K+ R                D  ++F+L        +  V   SY R+ ++ +  W+ +     D E +R          T ED+ +   +     E+R +D       +DA  + + +        F      F+  LLED +          + VC      ++ + +V     + RQKL+R   ++  +  +L  P   + D              A F  +   CY IL  +     RKN  Y AK   + ++Q+       +     I  L+ +NRK++++ I+  +I  FV+ LR N   R+L+ L  LCV N   I   Q  I +  L      + +       TE   +   +HE+ +      +    WI  +K         L  D  G    D + + +   QL+LF  +C  R    I  I+  L     +     +  + LP ++RA +C +++ + VD     +VV  P R   Y  +  +  +K +  +  +  D+   F    D++  +L +  +        E N L  +V+ L   LV FG+Y    ++  L   L+ ++D
Sbjct:   11 IGDIVSLYAEGTVNGFI---STLGLVDDRCVVQPEAGDLANPPKKFRD---CLFKVCPMNRYSAQKQFWKAKQGKQGGNT-EGD---LFKKLQHAAELEQKQNETENKKLLGEVVKYSQVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPSGNEGSWFYIQPFWKLRSEGDNVVVGDKVVLMPVNA-GQPLHASNIELLDN-PGCNEVNAVNCNTSWKVTLFMKFSDYKDDILKGGDVVRLFHAEQEKFLTCDDYKD-----QQHIFLRTTLRQSA-TSATSSKAL--WEVEVVHYDPCRGGAGQWNSLFRFKHLATGKYLAAETESDAVYSKKKRPVEKITYILVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRNLCTNTWVTSTNNSIDHEEERPVMLKIGTCPTKEDKEAFAIVSVPLSEVRDLDFA-----NDANKVLEAFVRKLEKNTFAQNDRRFVIKLLEDLV----------FFVCEVPNNGQDVLSVVISNPNRERQKLMREQNILAQIFGILKAPFADREDGPILKLEDLGDQRYAPFKYMLQLCYRIL-RHSQQDYRKNQEYIAKKFSIMQSQI----GYEILAEDTITALLHNNRKLLEKHITAREIETFVKLLRRNREPRFLDYLSDLCVSNKTAIPVTQELICKFMLNPTNADILIQTKLIPHTENSMDSSLMHEEGD----EEEVWLYWIDHNKEPHGKSIRHLAQDSKGNHKLDIDIITYYRCQLNLFAKMCLDRQYLAINQISTQLPV---DLILRCMFDDCLPYNLRASFCRLMLHMHVDRDPQEAVV--PVR---YARLWNEIPSKISVKEDTSRADMKRKFAPTMDFVDEYLKDVLSQPFPFGDEEKNELTLEVVNLARNLVYFGFYS-FSELLCLTRTLLAILD 871          

HSP 2 Score: 150.214 bits (378), Expect = 2.850e-35
Identity = 88/304 (28.95%), Postives = 161/304 (52.96%), Query Frame = -3
Query: 1025 LAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLY--------------------CDSLWHCFVSVMRFGLV-GDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 1873
            + G +   +F++  L ++V   + L  V+ +VT+NG+S+   A+L ++++YL++I+GF F +S F  E + +                    C++L  C V+V+  GL  G    ++L   S K    F+  V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y++F + ++     +YT  + +VA ++KE+  D+FP  +A+ L     +S  +++  L + +   +       ++    +E + ++R  K+  GFL +
Sbjct: 2233 MLGLFVHEFFYSILLFDLVRREETLLNVMRSVTKNGRSIFLTAVLAIILVYLFSIVGFLFLQSDFLMEVDRHPALDLTCKVEKSDEPEMERVCETLLMCIVTVLNHGLRNGGGIADILRKPS-KDEPMFAARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQRKEEILKTTCFICGLERDKFDNKTVSFEEHIKVEHNMWHYLYFLVLVRVKDPTEYTGPESYVAQMIKEKNLDWFPRMQAMSLVTSAGESEQNEMRSLQEKLDITVTLVSQLSAQLAELKEQMTEQRKNKQRMGFLGS 2535          

HSP 3 Score: 67.781 bits (164), Expect = 2.532e-10
Identity = 62/215 (28.84%), Postives = 105/215 (48.84%), Query Frame = -3
Query: 5009 QNQIF--ENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDH-VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQF 5617
            QNQI   ++L++ L   ++E   A T+  +F NN +LC +I  R +H  V     H  ++  +L  L  IVK +G    +K+ Q  VM  ++         Y+  A    L Q M +     +E   E+  + Y I+L+ELL+ C EG+N Y E  C ++L ++DI+NV+ H +    +K  ++ ++   Y+      +E    EI     IW+ 
Sbjct: 1216 QNQILLHKHLNLFLTPGILE---ARTMHYIFQNNYHLCNEISDRVVHHFVHCIETHG-RSIHYLRFLQTIVKSDGK--YVKKCQDKVMTELVNGGEEVLLFYNDRASFPALLQLMNSE----RERHDENSALSYHINLVELLAACTEGKNVYTEIKCNSLLPLDDIVNVVTHDDCIPEVKIAYVNFVNHCYV-----DTEVEMKEIYTSNHIWKL 1415          
BLAST of SMED30029683 vs. Ensembl Cavefish
Match: ryr1b (ryanodine receptor 1b (skeletal) [Source:ZFIN;Acc:ZDB-GENE-070705-417])

HSP 1 Score: 149.828 bits (377), Expect = 4.506e-35
Identity = 91/261 (34.87%), Postives = 138/261 (52.87%), Query Frame = -3
Query: 1172 LISSKTFYYFA-ILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNT-----EKNLYCDS-----LWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDED 1921
            + +  TF Y    L  SL G  Y+ +FFA HL++I    + L+ ++S+VT NGK L+    L  VV+YLY ++ F FFR  +N      E ++ CD      L+H +V V   G +GD  E+  P   E   +     V++ ++FF  +  I L II G+I+D F ELRD +     DM   CFIC   S  F+    GFE H L EHN+ +Y+FF ++L +    ++T  + +V  + +E+ +DFFP     C   + ED
Sbjct: 4703 VFTDNTFLYLVWYLVMSLLGH-YNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNMSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIED--PAGDEYELYR----VVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGD--CFRKQYED 4954          

HSP 2 Score: 82.8037 bits (203), Expect = 8.341e-15
Identity = 84/313 (26.84%), Postives = 133/313 (42.49%), Query Frame = -3
Query: 7877 AENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQ---FKILPRYKVKSEGEYVQIYDQIILESIKSPG--HFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAI-----TYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILV--------------KESRDPRTVFKLHPV-IQDSEEVTF-ESYARIEHVLSGNWL-HALKDKEYKR 8734
            A  VD     +   ++ + YG  I L+   S  Y+   TT  S  DK  + V L    D T +   + I P  K +SEGE V++ D +IL S+ S    H   AS    +D   M +  N+    SG  +         +E F+ GG  ++LFH  M          D+C      L I   DQ   +  +  + A+     + W++E  +   SG  + W Q FR RH +T  Y+ +DEE  ++++              + S++   V K   V      E+ + ES   ++HV +G WL +A  D +  R
Sbjct:   66 ANTVDLSESSQGGAHRTLLYGHAILLRHNHSSMYLSCLTTSRSLTDKLAIDVGL--QEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSMASGDLMVDASFMQTLWNMNPVCSGCEL---------AEGFLTGGHVLRLFHGHM----------DEC------LAISPPDQGEDQIAQYESGAVCSQARSLWRLEPLRISWSGGHMKWGQAFRIRHISTGRYVCLDEEKGLMVLDPEKANTKLSAFCFRASKEKVEVAKKRDVEGMGIPEIKYGESMCFVQHVSTGLWLTYAALDAKAAR 351          
BLAST of SMED30029683 vs. Ensembl Cavefish
Match: ryr1a (ryanodine receptor 1a (skeletal) [Source:ZFIN;Acc:ZDB-GENE-020108-2])

HSP 1 Score: 149.058 bits (375), Expect = 7.384e-35
Identity = 87/248 (35.08%), Postives = 134/248 (54.03%), Query Frame = -3
Query: 1211 LISSKTFYYFA-ILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFN-----TEKNLYCDS-----LWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFP 1921
            + +  TF Y       SL G  Y+ +FFA HL++I    + L+ ++S+VT NGK L+    L  VV+YLY ++ F FFR  +N      E ++ CD      L+H +V V   G +GD  E+  P   E   +     V++ ++FF  +  I L II G+I+D F ELRD +   + DM   CFIC   S  F+    GFE H L EHN+ +Y+FF ++L +    ++T  + +V  + +E+ +DFFP
Sbjct: 4683 VFTDNTFLYLVWYTVMSLLGH-YNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDENEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIED--PAGDEYELYR----VVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFP 4923          

HSP 2 Score: 80.8777 bits (198), Expect = 3.240e-14
Identity = 70/236 (29.66%), Postives = 104/236 (44.07%), Query Frame = -3
Query: 8024 NKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQ---FKILPRYKVKSEGEYVQIYDQIILESIKSPG--HFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTS--------NSAITYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILV 8692
            ++ + YG  I L+   S  Y+   TT  S  DK    V L    D T +   + I P  K +SEGE V++ D +IL S+ S    H  +AS    +D   M +  N+    SG  + + Y         + GG  ++LFH  M          D+C      L I   DQ  A   R +        + A + W++E  +   SG  + W Q FR RH TT  YL++D+E  ++LV
Sbjct:   91 HRTLLYGHAILLRHTHSSMYLSCLTTSRSLTDKLAFDVGL--QEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYASGDLMVDASFMQTLWNMNPVCSGCELAEGY---------LTGGYVLRLFHGHM----------DEC------LAIPAADQ-GADQRRNAHYEGGAVCSHARSLWRLEPLRIGWSGSHIKWGQAFRIRHITTGRYLSLDDEKGLLLV 298          
BLAST of SMED30029683 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003582.1 (pep scaffold:Pmarinus_7.0:GL477251:10655:41631:-1 gene:ENSPMAG00000003274.1 transcript:ENSPMAT00000003582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 2.259e-21
Identity = 95/366 (25.96%), Postives = 165/366 (45.08%), Query Frame = -3
Query: 7901 FQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEFEKSIISGDKLT-----WDQQFRFRHTTTRMYLAVD----------------------EESNVILVKESRDPRTVFKLHPVIQDSEEVT-FE----------------SYARIEHVLSGNWLHA 8866
            F++   NRY   K++L K A     +  D+    L  + + AA+ E   N +E ++     ++YG V+QL  + S+KY+ VN    +  +KN M V LN   ++ + F + P YK++S G+ V + D+++L  + + G   HAS    +DN     E+N     + + I    +  +  E  ++GG  V+LFH E E ++ +     D   ++ H+ +R   + +A T  TS+ A+  W+IE    ++  D        W+  FRF+H  T  YLA +                      E +     + S+  R +F L PV   S+  + FE                SY R+ H+ +  W+H+
Sbjct:   39 FRMCPMNRYSAQKQFL-KAAKPAIHSSTDS---LLLKKLQHAADLEKKQNESENKKLLGTVIQYGNVVQLLHMKSNKYMTVNKRLPALLEKNAMRVVLNGSGNEGSWFYVQPFYKLRSMGDSVVVGDKVVLNPVNA-GQPLHASNYELVDNPGC-KEVNSVNCSTSWKISLFMTWSENKEDILKGGDVVRLFHAEQEKFLTS-----DEYRKKQHVFLRTTGRQSA-TSATSSKAL--WEIE----VVQHDPCREGAGHWNSLFRFKHLATGDYLAAEVTAWAPRNVSVPPPPRRSQADAEPAASSTSRSSKRDRMMFTLVPVDHGSDIASIFELDPTTMQRGDSLVPRNSYVRLRHLCTNTWVHS 386          
BLAST of SMED30029683 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007822.1 (pep scaffold:Pmarinus_7.0:GL476823:160879:181935:-1 gene:ENSPMAG00000007060.1 transcript:ENSPMAT00000007822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 6.126e-20
Identity = 56/160 (35.00%), Postives = 94/160 (58.75%), Query Frame = -3
Query: 1088 FSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSY--DFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSK---IDELLKNVSTLINHQKSEDSERK 1552
            F   VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC+       F++    FE H+  EHNMW+Y++F + ++     +YT  + +VA +++E+  D+FP  RA+ L + + +   ++   + E L+  + LI+   S+ SE K
Sbjct:  281 FVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICAAGLERDKFDNKTVSFEEHIKVEHNMWNYLYFIVLIKVKDPTEYTGPESYVAQMIREENVDWFPRMRAMSLVSSEGEGEQNEMRVLQEKLEMTARLISGLCSQLSELK 440          

HSP 2 Score: 54.299 bits (129), Expect = 3.281e-7
Identity = 23/78 (29.49%), Postives = 47/78 (60.26%), Query Frame = -3
Query: 1670 FYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTE 1903
             ++ + L     G     +F++  L ++V+  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +  F  E
Sbjct:  111 LFHLSYLIICALGLVMHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGFLFLKDDFVME 188          
BLAST of SMED30029683 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007816.1 (pep scaffold:Pmarinus_7.0:GL476823:160879:205429:-1 gene:ENSPMAG00000007060.1 transcript:ENSPMAT00000007816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 3.899e-19
Identity = 56/160 (35.00%), Postives = 94/160 (58.75%), Query Frame = -3
Query: 1088 FSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRN--SYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSK---IDELLKNVSTLINHQKSEDSERK 1552
            F   VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC+       F++    FE H+  EHNMW+Y++F + ++     +YT  + +VA +++E+  D+FP  RA+ L + + +   ++   + E L+  + LI+   S+ SE K
Sbjct:  736 FVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICAAGLERDKFDNKTVSFEEHIKVEHNMWNYLYFIVLIKVKDPTEYTGPESYVAQMIREENVDWFPRMRAMSLVSSEGEGEQNEMRVLQEKLEMTARLISGLCSQLSELK 895          

HSP 2 Score: 90.5077 bits (223), Expect = 4.340e-18
Identity = 124/590 (21.02%), Postives = 251/590 (42.54%), Query Frame = -3
Query: 1670 IELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYAN-----------INKDTIDLVSQVFSTINEFVAG----NQENRVTVXXXXXXXXXXXILRGGN-YPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQ--YIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLD-PNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQ----QKAFKFYKKNSVSIELLKGD-YLQKVHFRIRNK-NIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLP----------DFFRNPVPDWKPRFENLKSWMFA--FGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTE 3328
            +E +L+ L  +C+  +P LQ +LR Q +N  ++NLV E +QFL+ +  +           IN+  + L++Q   ++ E+  G    NQ    T   N I   I  IL   N      +  ++ELK N   L+++++E  +   ++ A  +   +  + +  V+ +AY     ES   DG+  + +T+        YI+A  +   E+   +  L E        L  L D+  P+L  +              R  +  ++ L ++ +Q     +A  +Y K++  IE+++ D  ++++ F + N    +  + K  V    +R    +KI DF   S  + +++ +QK+     +        ++W    + L+V +NL++          +F   FN S    +LP                +    PR  ++++ +      L+ +V C  +L     A+  +       F+              ++     G +   M    +   ++     LG  +       +F++  L ++V+  + L  VI +VT+NG+S++  A+L ++++YL++I+GF F +  F  E
Sbjct:   99 MEPILRFLQLLCENHNPALQNFLRCQ-NNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINERNVGLINQTLESLTEYCQGPCHENQNCIATHESNGIDIIIALILNDINPLGKDRMELVLELKDNASKLLLAIMESRHD--SENAERILYNMRPKELVAVIKKAYHQEGEES--EDGVVEEQSTSPKEVGHNIYILAHQVGTGEVNSAR-HLSET-------LTGLKDMSSPSLAAQ------------LARHNKELDQMLHLSSSQGEEGSEALDYYTKHTSQIEIVRHDRVMEEIVFPVPNVCEFLTSQSKTRVYLTTERDDQGSKISDFFQSSHELFSEMVWQKQLRGRALLFLAVALPVVWGTISSNLTVFMNLLV----------AFFYPFNSSSGGGTLPLRLSGLLWLAVLVVLALVVLLPRPHSVRALVVVVILRLIFSVGCQPILILLGTANVLNKVVFLVSFV-------------GNKGTFTHGYQAMVMDVEFLFHLSYLIICALGLVM-----HEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGFLFLKDDFVME 635          
BLAST of SMED30029683 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010602.1 (pep scaffold:Pmarinus_7.0:GL476450:29:322425:-1 gene:ENSPMAG00000009553.1 transcript:ENSPMAT00000010602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 8.405e-16
Identity = 81/283 (28.62%), Postives = 121/283 (42.76%), Query Frame = -3
Query: 7907 NKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQ---FKILPRYKVKSEGEYVQIYDQIILESIKSPG--HFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILV-KESRDPRT-VFKLHPVIQ-------------DSEEVTF-ESYARIEHVLSGNWL 8692
            ++ + YG  I L+   S  Y+    T  S  DK    V L    D T +   + I P  K +SEGE V++ D +IL SI S    H  HA+   ++D     +  N+    SG  + + Y         + GG  ++LFH   E   V      D     VH     +   +AR+L         W++E  +   SG+ L W Q FR RH TT  YLA+ EE  ++LV +   D +T  F +    +              S E+ + +S   ++HV SG WL
Sbjct:   82 HRTLLYGHAIILRHAHSGMYLSCLRTSHSSSDKLAFDVGL--QEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSISSERYLHLSHANGSLHVDASFQQTLWNVSPVCSGSEMAQGY---------LIGGDVLRLFHGHDECVTVPPADRGDEHRRSVHYEGGAVCS-HARSL---------WRLETLRVSWSGNHLHWGQPFRLRHVTTGKYLALTEERVLLLVDRGCADVKTSAFSMRSSKEKLDSGPRRDIDGMGSPEIKYGDSVCYMQHVESGRWL 343          
BLAST of SMED30029683 vs. Ensembl Nematostella
Match: EDO37876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK1])

HSP 1 Score: 155.606 bits (392), Expect = 2.463e-37
Identity = 193/820 (23.54%), Postives = 336/820 (40.98%), Query Frame = -3
Query: 6797 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESN------------------VILVKESRDPRTVFKLHP--VIQDSEEVTFESYARIEHVLSGNWLHALK---DKEYKRQQF------STTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLE----------------CYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQR--------WLLEDRRG---------------------VYLT-ERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVD 9013
            IGD + LY E    G++   ST    ++  +         N P    D     F+I   NRY   K++ +  A     +  DA    L  +   AAE E   N +E ++  +  V+YG V+QL  V S+K++ VN    + ++KN M V+L+P+ ++ + F I+P YK+++ G+ V + D +IL  + + G   HAS    +DN     E+N    Q+ + I    S+ +  E  ++GG  V+LFH E E ++       D   ++ ++ +R   +   +T  ++ S+   W++E  +     G    W+  FRF+H  T  YLA + + +                  ++      D  ++F+L P  + +    V   SY R+ H+ +  W+H+     DK  +R         S  ED+ +   +     E+R +D       +DA  +   +       N+      F+  LL D +     H      V           +      + RQKL+R   ++  +  LL  P     D+ N   + +E                CY +L  +     RKN  Y AK     + Q+       +     I +L+ +NRK++++ I++ +I  FV  +R  +  R+L+ L  LCV N   I   Q  I +          L+E   G                     V+L  ERG+ +  Q +I       +K  I +     +DY  Y          QL+LF+ +C  R    I  I+K L     +     +  + LP D+RA +C +++ + +D
Sbjct:   10 IGDIVSLYAEGNVTGFI---STLGLIDDRCVVQPGAGDLSNPPKKFRD---CLFKICPMNRYSAQKQFWK--AAKPTTSATDA---VLLKKLHHAAELEKKQNESEYKKMLSSVVQYGSVMQLLHVKSNKFLTVNKRLPALREKNAMRVTLDPNGNEGSWFYIVPFYKLRAAGDNVVVGDMVILNPVNA-GQPLHASNQELIDN-PGCKEVNCVNCQTSWKISLFLSYDENDEDILKGGDVVRLFHAEQEKFLTC-----DDFKKKSYIFLRTTAR---QTATSATSSKALWEVEVVQHDPCRGGAGHWNCLFRFKHLATGDYLAAEADDDNTKDATRHKLKGSDPVFHLVPAPHGNDIASIFELDPTTLTRSDSLVPRCSYVRLRHLCTNTWVHSTGIPIDKGEERPVMLKIGTASIKEDKEAFAIVPVPALEVRDLDFA-----NDASKVLGTFASKLETGNYTQHERRFVTQLLTDLVYFVTEHDTGGEDV---------LNIQVQDPNRDRQKLMREQNILKEVFHLLKAPF---TDKGNGPMLRIEELSDQRNAPLRHIFRLCYRVL-RHSQQDYRKNQEYIAKQFGFMQAQI----GYDILAEDTITDLVHNNRKLLEKHITRTEIETFVSLVRKKKECRFLDYLSDLCVSNHTAIPATQELICKTVLHPSNSDLLIETSMGDVLLVWEMNNGKRCVPGLGEYVFLVWERGEKMKAQKDIAKGVKMMVKEDIKI-----LDYYRY----------QLNLFSQMCLDRQYLAINSISKQLDV---DLILRCMADKELPCDLRAAFCRLMLHMHID 768          

HSP 2 Score: 152.14 bits (383), Expect = 2.609e-36
Identity = 127/523 (24.28%), Postives = 242/523 (46.27%), Query Frame = -3
Query: 1013 IREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFK-APKDGSFDENFNISKYNNSLPDF---FRNPVPDWKPRF--ENLKSWMFAFGL--------VHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTE-----------------KNLYCDSLWHCFVSVMRFGLV-GDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLT---AKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSL 2476
            + +E K  V    +R   ++K+ DF   ++ +  ++++QKK   + +    +    LW       +V++NL++   +  +   G  D   +I  +   L  F      P P     F    +   +F+ GL        + NV+   +    F+ +  +    QY    ++R L   EL                     I   T++ F +LG ++       +F++  L++++     L  VI +VT+NG+S+I   IL ++++Y+++I+GF F +  F  E                 K   CD+L  C V+ +  GL  G    ++L   S K    F+  V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  +++TCFIC  +   F++    F+ H+ ++HNMW Y+++ + L+     ++T  + +V+ + K++  D+FP  +A+ L      +E +    + + L+N + L+     + S+ K   E + ++R QK+  G L  +  L
Sbjct: 2127 LTDESKINVYATCERDDQNSKVSDFFHRTEDLFQEMQWQKKLREHRLLFGLSSRLSLWEQISINFAVLINLLVGFFYPFSDGPGDLDPRLSILVWLAMLVSFAIIITFPRPSGIRTFVGSTILRLIFSLGLEPTLRILGLANVINKAISVVSFVGNRGT---FQYG---VRRILTDKEL---------------------ILHLTYFGFGVLGLTV-----HTFFYSVLLLDVIFREDTLLNVIRSVTRNGRSIILTGILALIIVYMFSIVGFLFLKDDFLIETDPPPALPSIGEGGESVKERACDTLIMCIVTTLNQGLRNGGGIGDVLRRRSSKEKM-FAGRVVYDLMFFFIVIIIVLNLIFGVIIDTFADLRSEKQNKEEVLKNTCFICGLDRSAFDNKSVSFDEHIKSQHNMWHYLYYIVLLRVKDPTEFTGPESYVSHMTKDKNLDWFPRMQAMSLAIDEGGNEQNEMRNLQDKLENTTKLVQTLSQQLSDLK---EQMTEQRKQKQRMGLLGPQHGL 2613          

HSP 3 Score: 89.7373 bits (221), Expect = 2.374e-17
Identity = 119/547 (21.76%), Postives = 234/547 (42.78%), Query Frame = -3
Query: 4916 AIVNAKYAALEVLQMILNFESNARLAGFMAKFK----ECERNEGLLKKKNP------SSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WS---------------------------DEQVNRMENIFSELIEFC--HLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVM-------KYIMQSYS---SAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFI-----------GNLGEEIH---YLTQYILESPHELVYYLLTKPF 6361
             ++  K   +E+L+ I+N   + R++  +  FK    E   N G +   N       S+ A A++ G        SA     L  +  R                +L+ L  + Y  +   +L++L   +S +Q+  QA  +  +L++T     ++++   +  LR++ +    W                            D+Q    + I   + + C  + P   ++     QR+L +     VV+E+L +       ++  + E ++  A + L+   L  P  Q+ + ++LD+ L   L+ES+   TL+ +F++N  LC ++  R +  I+    E + +  E+L LL  +VK EG   ++++ Q +VM       + ++  YS   S  +++E     RE +  +E G   + Y I+L++LL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     IW+              N+ +  H    L +Y+ E+   L+ +    PF
Sbjct:  942 VVMETKLKVIEILEFIMNVRLDYRISSLLTIFKKDFDESNANIGDVNADNGIDLENISAQAEAIFGG-----SIGSADIDLDLDGQGGRTFLR------------VLLYLCMHDYPSLVTGSLQLLIRHFSQRQEVLQAFKQVQLLVSTSDVENYKQIRSDLDELRLLVEKSELWVYKSKKDSIGSTKKKKETADGDNDKEALDKQDKAAQQILQRISQLCVTYGPDDVKKNRKHEQRLLRNMGAHTVVLELLQI---PYAKDEDIRMEDIMALAHEFLQNFCLGNPQNQSLLHKHLDLFLTPGLLESQ---TLRYIFMDNSALCYEVTERVVQHIIH-CIESRGRHVEYLKLLQTLVKAEGQ--SIRKTQDMVMAELVNVGEDVLVFYSDTKSFNHLIEMMQSERERL--DEAGA--LLYHINLVQLLACCTEGKNVYTEIKCHSLLPLDDIVRVVTHEDCIPEVKNAYVNFLNHCYV-----DTEVEMKEIYTSNHIWRLFEDFLVDMARVCNNMMDRYHADTMLEKYVTETIMNLITFFFNSPF 1453          
BLAST of SMED30029683 vs. Ensembl Nematostella
Match: EDO28592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T616])

HSP 1 Score: 147.902 bits (372), Expect = 8.894e-36
Identity = 124/522 (23.75%), Postives = 239/522 (45.79%), Query Frame = -3
Query: 1013 IREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFK-APKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTE-----------------------------KNLYCDSLWHCFVSVMRFGLV-GDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLT---AKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSL 2476
            + +E K  V    +R   ++K+ DF   ++ +  ++++QKK   + +    +    LW       +V++NL++   +  +   G  D   +I  +   L  F    +    PR   ++++         V    L   + L   P+  RI     +I + +        +    Q G         LI   T++ F +LG ++       +F++  L++++     L  VI +VT+NG+S+I   IL ++++Y+++I+GF F +  F  E                             K   CD+L  C V+ +  GL  G    ++L   S K    F+  V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  +++TCFIC  +   F++    F+ H+ ++HNMW Y+++ + L+     ++T  + +V+ + K++  D+FP  +A+ L      +E +    + + L+N + L+     + S+ K   E + ++R QK+  G L  +  L
Sbjct:  263 LTDESKINVYATCERDDQNSKVSDFFHRTEDLFQEMQWQKKLREHRLLFGLSSRLSLWEQISINFAVLINLLVGFFYPFSDGPGDLDPRLSILVWLAMLVSF---AIIITFPRPSGIRTF---------VGSTILRLIFSLGLEPTL-RILGLANVINKAISVVSF-VGNRGTFQYGVRRILTDKELILHLTYFGFGVLGLTV-----HTFFYSVLLLDVIFREDTLLNVIRSVTRNGRSIILTGILALIIVYMFSIVGFLFLKDDFLIETDPPPALPSIGSPRGGVCASSGGEGGESVKERACDTLIMCIVTTLNQGLRNGGGIGDVLRRRSSKEKM-FAGRVVYDLMFFFIVIIIVLNLIFGVIIDTFADLRSEKQNKEEVLKNTCFICGLDRSAFDNKSVSFDEHIKSQHNMWHYLYYIVLLRVKDPTEFTGPESYVSHMTKDKNLDWFPRMQAMSLAIDEGGNEQNEMRNLQDKLENTTKLVQTLSQQLSDLK---EQMTEQRKQKQRMGLLGPQHGL 761          
BLAST of SMED30029683 vs. Ensembl Medaka
Match: itpr1b (inositol 1,4,5-trisphosphate receptor type 1 [Source:NCBI gene;Acc:101155104])

HSP 1 Score: 226.868 bits (577), Expect = 1.700e-58
Identity = 353/1536 (22.98%), Postives = 628/1536 (40.89%), Query Frame = -3
Query: 4916 IGDFICLYCEETDGYVYSMSTSSFFNNLAIYHKQDRNQP--SHIPDP----QMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVD------EESNVILVKESRDPR-----------------TVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALK---DKEYKRQ---QFSTTE---DERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPL-------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPN--ILYVSTDCMKSWI------------ALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPER-SFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKI-----EHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID--------------------------GSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMF----ENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--W-------------------SDEQVNR-------------MENIFSELIEFC-HLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEI--------------HYLTQYILESPHELVYYLLTKPF 9013
            IGD   LY E         STS F + L +   +   QP    + +P    +   F++   NRY   K++  K A     +  D     L ++   AA+ E   N +E R+     ++YG VIQL  + S+KY+ VN    +  +KN M V+L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + +V      D  E  ++GG  V+LFH E E ++      DD   +Q H+ +R   + +A T  TS+ A+  W++E   +    G    W+  FRF+H  T  YLA +      EE+N  L    R P+                 ++F+L P      +  V   SY R++H+ +  W+H+     DKE ++    +  T+E   D+ +   +     E+R +D       +DA  +                   F+  LLED +   F        +  + +++ E M+   K  + RQKL+R   ++  + KLL  P               G    A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV     I   Q  I    +L+      L E    I    N  I   + D  + W+            ++ +  Q    G   D E V +   QL+LF  +C  R    I  I+  L     +     +  E LP D+RA +C +++ + VD      V   P + + ++  + +K       +D  +  ++   F    D++  +L E   +++  I     E N L  +V+ L   L+ FG+Y +  D+  L   L+ ++D                          G   LP  P  Q       + ++V+   + +R     E   +++ K   +E+LQ ILN   + R++  +  FK CE +E     +N  +   +L   F+ +E            I+E  E      E  T + +D         +L++L  + Y  +   AL +L   +S +Q+   A  +  +L+T+     ++++   +  LR + +    W                   + ++V+R             ++ I   L + C       ++     QR+L +     VV+E+L +       EK  + + +++ A + L+         Q  + +++++ L   ++E   A+T++ +F+NN  LC +I  R +   V     H +   ++L  L  IVK E     +K+ Q +VM  ++ S       Y+  A    L Q M +    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ V+ H +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L +Y+ E+   +V    + PF
Sbjct:   11 IGDICSLYAEG--------STSGFISTLGLVDDRCVVQPDAGDLNNPPKKFRDCLFKLCPMNRYSAQKQFW-KAAKPGGNSTTDT---VLLNKLHHAADLEKKQNESENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSLGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKVVLFMKWSDNKETILKGGDVVRLFHAEQEKFLTC----DDHKKKQ-HVFLRTTGRQSA-TSATSSKAL--WEVEVVHRDPCRGGAGYWNSLFRFKHLATGCYLAAEVNPDFEEENNEALRGRLRTPQEKVMCTLVPVPDGMEISSIFELDPTTLRGGDSMVPRSSYVRLKHLFTNTWVHSTNNPIDKEEEKPVMLRIGTSEVKEDKEAFAIVPVPPAEVRDLDFA-----NDASKVLASIAGKLEKGTITQNERRFVTKLLEDLV---FF----VVDIPNSGQDVLEIMV--NKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFRFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVTLVRKNREPRFLDYLSDLCVSMSKSIPVTQELICNA-VLDSNNADILIETKFEIETSTNGDIPLQAEDEEEVWLFWKDNAKDIRSKSVRELAQDAREGQKEDQEVVSYYRCQLNLFARMCLDRQYLAINKISNQLDV---DLILRCMSDEDLPFDLRASFCRLMLHMHVDRDPQEQVT--PVKYARLWSEIPSKIAIDDYDNDGNSRDEIKERFSLTMDFVENYLRE---VVSQNIPFTDKEKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLNILDCVHVTGSNVMKSIHGVGELMTQVVLRGGGLLPTAPAHQ------PEGEVVKTQTEPER-----EDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFK-CEFDENNPPGENAPNQIPSLTGNFD-FEN-----------IEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKSDLDQLRSIVEKSELWVYKRQGEDGMDGDGPSESENKKKVSRTKSAVDNSYNYRVVKEILIRLSKLCVQEGSTGKKSKKQQQRLLRNMGAHSVVLELLQIP-----YEKDVRMQDIMKLAHEFLQNFCAGNQPNQALLHKHINLFLNPGILE---AVTMQHIFMNNFQLCSEINERVVQHFVHCTESHGRHV-QYLKFLQTIVKAE--NKFIKKCQDIVMAELVNSGEDVLVFYNDRASFQTLVQMMRSERDRMDE---NSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYV-----DTEVEMKEIYTSNHMWKLFENFLVDICRVCNTTSDRKHADTMLERYVTETVMSIVTCFFSSPF 1452          

HSP 2 Score: 172.555 bits (436), Expect = 4.282e-42
Identity = 101/343 (29.45%), Postives = 169/343 (49.27%), Query Frame = -3
Query: 1013 FYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF---------------------NT--------------------EKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSL 1903
              Y  I G    G +   +F++  L ++V+  + L  VI +VT+NG+S++  A+L ++++YL++I+G+ FF+  F                     NT                    +K   CDSL  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHNMW Y+FF + ++   + +YT  + +VA +++E   D+FP  RA+ L + D D   ++I  L + + + +    +  S+    +E + ++R QK+  G L     +
Sbjct: 2285 LLYLIICGL---GVFVHVFFYSLLLFDLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILAVDRIPNKTLGTTEAHFQLNTLTLSSQPCPKLSFHPSVVIEDKERTCDSLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEYTGPESYVAEMIREHNLDWFPRMRAMSLVSSDADGEQNEIRNLQEKLESTMKLVTNLSSQLTELKEQMTEQRKQKQRIGLLGQPAHM 2619          
BLAST of SMED30029683 vs. Ensembl Medaka
Match: itpr2 (inositol 1,4,5-trisphosphate receptor, type 2 [Source:ZFIN;Acc:ZDB-GENE-050419-192])

HSP 1 Score: 197.593 bits (501), Expect = 7.070e-50
Identity = 154/570 (27.02%), Postives = 269/570 (47.19%), Query Frame = -3
Query: 1028 NQQKAFKFYKKNSVSIELLKGD-YLQKVHFRIRN-KNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFI-LIKRRLKQNELDPA-----DEDIIQQ--------GDEGCKMRSH--LISSKTF-YYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKN------------------------LYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSK---IDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLS 2584
            +++ A  +Y K++  IE+++ D  ++++ F + N    I EE K  V    +R    +K+ DF     ++ N++++QKK   N +  +F+    LW      L+ +LN ++ T +    DG  DE    S +N +L          W            + G          LFT  L   P P  I ++ + LI R +    L PA       ++  +        G++G   R +  ++    F Y+ A     + G +   +F++F L ++V   + L  VI +VT+NG+S+   A+L + ++Y ++IIGF F +  F  E +                          CD+L  C ++V+  GL     VGD+     P   E     F+  V+Y L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+ +EHNMW Y++F + ++     +YT  + +VA ++ E+  ++FP  RA+ L + + D+  ++   + E L N  TLI+   S+ +E K   E + ++R  K+  GFL+
Sbjct: 1049 DREDALHYYAKHTAQIEIVRHDRTMEQIVFPVPNICEYITEESKMRVFTTTERDDQGSKVNDFFQQFDNLYNEMKWQKKIRKNRVLFWFSSHISLWGSISFYLANLLNFVVATFYPFGDDG--DEGTLSSMWNITL----------WA-----------SLG----------LFTALLPVFPKPWGILFFLVSLILRAIYTMGLAPALFLLGSVNLFNKLVFLASFVGNQGTFTRGYKAVVMDMLFVYHLAYAIICVLGLFVHEFFYSFLLFDLVSREETLLNVIKSVTRNGRSIFLTAVLAIFLVYFFSIIGFLFLKDDFRMEVDPLPLPGHPSQDTCLCERCEDDGMERVCDTLLMCIITVLNQGLRNGGGVGDILRR--PSKEEP---LFAARVVYDLLFFFVVIIIVLNLIFGVIIDTFADLRSEKQRKEEILKTTCFICGLERDKFDNKTVTFEEHIKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIAEKNLEWFPRMRAMSLVSNEGDNEQNEMRSLQEKLTNTVTLISQLSSQLAELK---EQMTEQRKNKQRMGFLA 1577          

HSP 2 Score: 67.781 bits (164), Expect = 2.366e-10
Identity = 59/219 (26.94%), Postives = 105/219 (47.95%), Query Frame = -3
Query: 4997 QNQIF--ENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYS---------SAAYILEQPMETREAVLKEELGEDH-VQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNL 5617
            QNQ+   ++L++ L   L+E+E   T++ +F+NN  LC +I  R +H  V     H +   ++L  L  IVK +G    +K+ Q  VM  ++ +           S+  +L+  M +     +E   ED  + Y  +L+ELL+ C EG+N Y E  C ++L ++DI+ V+        +K  ++ ++   Y+      +E    EI     IW+   N 
Sbjct:  179 QNQVLLHKHLNLFLTPGLLEAE---TMRHIFMNNYQLCNEISDRVVHHYVHCIETHGRHT-KYLKFLETIVKSDGK--YVKKCQDKVMTELVNAGEDVLVFYNDRSSFQVLKDLMRSE----RERSDEDGALAYHNTLVELLAACTEGKNVYTELKCNSLLPLDDIVKVVTEENCVPEVKTAYVNFVNHCYV-----DTEVEMKEIYTSCHIWKLFDNF 382          
BLAST of SMED30029683 vs. Ensembl Medaka
Match: itpr1a (inositol 1,4,5-trisphosphate receptor type 1 [Source:NCBI gene;Acc:101167700])

HSP 1 Score: 197.978 bits (502), Expect = 9.595e-50
Identity = 348/1556 (22.37%), Postives = 629/1556 (40.42%), Query Frame = -3
Query: 4916 IGDFICLYCE-ETDGYVYSMSTSSFFNNLAIYHKQD---RNQPSHIPDPQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEAENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEF-EKSIISGDKLTWDQQFRFRHTTTRMYLAVD-----EESN----------------------VILVKESRDPRTVFKLHPVIQDSEE--VTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFML---VNGKSV---------KARQKLLRNLRVIDLLVKLLNMPL-------------YGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCV-------------CNGVGIVDNQTYIAQRWLLEDR---RGVYLTERGQNIHEQPNILYV-STDCMKSWI---ALHKFLQVDYPGY--DDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPER-SFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDE--NTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSR-DLPFPPERQGKELSKEK----------KKIVQKYQQGDRYLQS------------------KETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKE--CERNE-------GLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQ-----MTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--W------SDEQVNRMENIFSELIEFCHLPKAPEEPHPMN-----------------------------QRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQ--IFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQS-------YSSAAYI--LEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH--------------YLTQYILESPHELVYYLLTKPF 9013
            IGD   LY E  T+G++   ST    ++  +         N P    D     F++   NRY   K++ +      + + +      L ++   AA+ E   N +E ++     ++YG VIQL  + S+KY+ VN    +  +KN M V L+   ++ + F I P YK++S G+ V I D+++L  + + G   HAS    +DN    +E+N     + + IV      D  E  ++GG  V+LFH E E ++      DD   +Q ++ +R   + +A T  TS+ A+  W++E  +     G    W+  FRF+H  T  YLA +     EE                        ++ V +  D  ++F+L P      +  V   SY R+ H+ +  W+H+        Q     E++  M  I   G    K D        +A+ I  V P   R  +F       L ++   +L++  +   E   V     ++  F++    NG+ V         + RQK++R   ++  + KLL  P               G    A F  +   CY +L  +     RKN  Y AK     + Q+       +     I  L+ +NRK++++ I+  +I+ FV  +R N   R+L+ L  LCV             CN V    N   + +  L+  R   +GV L E      E    +++   +  K  I   ++ +  Q    G   D E + +   QL+LF  +C  R    I  I+     L  +     +  E LP D+RA +C M++ + VD      V   P + + ++  +  K   +   +D  +  ++   F    +++  +L    +  +     E N L  +V+ L   L+ FG+Y +  D+  L   L+G++D       +   +Q KE SK            + + Q   +G  +L +                  K+   +++ K   +E+LQ ILN   + R++  ++ FK    ERN        G+++ +N  ++  AL   F   E++   +              E    + +D         +L++L  + Y  +   AL +L   +S +Q+  QA  +  +L+T+     ++++   +  LR + +    W       DE ++  + + SE  +  H  K  E     N                             QR+L +     VV+E+L +  +     +     K+  + LQ   A      + QNQ  + +++++ L   ++E   A+T++ +F+NN  LC +I  R +   V     H +   ++L  L  IVK E     +K+ Q +VM  ++ +       Y+  A    L   M++    + E      + Y I L+ELL+ C EG+N Y E  C ++L ++DI+ ++ + +    +K  ++ +L   Y+      +E    EI     +W+   N   +I                L QY+ E+   +V    + PF
Sbjct:   11 IGDICSLYAEGSTNGFI---STLGLVDDRCVVQPDAGDLNNPPKKFRD---CLFKLCPMNRYSAQKQFWKAAKPGGNTDTV------LLNKLHHAADLEKKQNDSENKKLLGSVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVMLDTAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNA-GQPLHASSHQLVDN-PGCNEVNSVNCNTSWKIVLFMKWGDNQEVVLKGGDVVRLFHAEQEKFLTC----DDHRKKQ-YVFLRTTGRQSA-TSATSSKAL--WEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVNPEYEEERPDNQHEALRARLRCAQEKVMYALVAVPDGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHS------TNQPIDKEEEKPVMLRI---GTSPHKED-------KEAFAIVPVSPAEVRDLDFANDASKVLASI-AGKLEKGTITQNERRAVTKLLEDLVFFVVDIPNNGQDVLEIMVNKHNRERQKVMREQNILKQIFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRLCYRVL-RHSQQDYRKNQEYIAKQFRFMQKQI----GYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVNLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICNAVLDPANADILIETKLVLSRFEIQGVPLGENSVESEEDEEEVWLFWKENNKKEIRSKSIRELAQDAKEGQKEDKEVISYYRYQLNLFARMCLDRQYLAINKIS---CQLDVDLILRCMSDEDLPFDLRASFCRMMLHMHVDRDPQEQVT--PVKYARLWSEIPLKISIEDYDNDGTSKDEIKERFSQTMEFVETYLRNVVSPNLSFGNKEKNKLTFEVVNLARNLIYFGFY-NFSDLLRLTKILLGILDCVHVGAIYSFNKQEKEDSKGSNVMRSIHGVGELMSQVVLRGGGFLPTTTVNTSNGEAVKTQIEPEKQDILVMDTKLKIIEILQFILNVRLDYRISCLLSIFKTEFDERNSQSDLSINGVIESQN--NMQGAL--DFEHMEEQAEGIFGGS----------EQNNPLDLDDHGGRTFLRVLLHLTMHDYPPLVSRALHLLFRHFSQRQEVLQAFKQVQLLVTSQDVENYKQIKSDLDQLRSIVEKSELWVYKRLGPDEGMDGGDALASEHKKV-HWGKKTESTSSYNYRVVKEILLRLSKLCVQEGPTGRKNRKQQQRLLRNMGAHAVVLELLQIPYEKGEDLRMQDIMKLAHQFLQNFCA-----GNQQNQALLHKHINLFLNPGILE---AVTMQHIFMNNFQLCSEINDRVVQHFVHCIETHGRNV-QYLKFLQTIVKAE--NKFIKKCQDIVMAELVNAGEDVLVFYNDRASFQTLVHMMQSERDRMDE---NSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRIVTNEDCIPEVKIAYINFLNHCYV-----DTEVEMKEIYTSNHMWKLFDNFLVDICRVCNNTSDRKHSDVILEQYVTETVMSIVTTFFSSPF 1482          

HSP 2 Score: 171.014 bits (432), Expect = 1.350e-41
Identity = 128/536 (23.88%), Postives = 241/536 (44.96%), Query Frame = -3
Query: 1025 EVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVF--KAPKDGSFDENFN----ISKYNN-SLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF-------------------------------------------NTEKNLYCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSN 2467
            E K  V +  +R    +KI DF   ++ + N++ +QKK    P+  + +    +W+     L+V++NL++   +  +    G  D + +    I  +   ++      P+      F  +   +F+ GL   +   FLL  + + +     +I +    +  R                G      ++ ++  +  Y+   L     G +   +F++  L ++V+  + L  VI +VT+NG+S++  A+L ++++YL++I+G+ FF+  F                                           N E+   CDSL  C V+V+  GL     VGD+     P   E     F+  VIY L FF ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H++ EH+MW Y++F + ++   + +YT  + +VA ++KE   D+FP  RA+ L + D +   ++I  L   + + +    +   +    +E + ++R QK+  G L +
Sbjct: 2148 ESKLRVYYTTERDEQGSKINDFFLRAEDLFNEMNWQKKLRAQPVLYWCSRNMSVWSNISFNLAVLMNLLVCFFYPLEGVHGGMLDPHLSALLWIGVFATLAIVILMPQPLGIRALVFVTILRLIFSVGLEPTL---FLLGAFNVCN-----KIIFMISFVGNR----------------GTFTRGYKAMVMDFEFLYHLLYLIICCLGVFGHVFFYSLLLFDLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILEVDRIPNITLSADDADGELLSAVCHNGAGENCSTAVHEEDSNMERT--CDSLLMCIVTVLSHGLRSGGGVGDVLRK--PSKEEP---LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVTFEEHIMEEHSMWHYLYFIVLVKVKDSTEYTGPESYVAQMIKEHNLDWFPRMRAMSLVSSDGEGEQNEIRSLQDKLDSTMKLVANLSGQLTELKEQMTEQRKQKQRIGLLGH 2652          
BLAST of SMED30029683 vs. Ensembl Medaka
Match: itpr3 (inositol 1,4,5-trisphosphate receptor type 3 [Source:NCBI gene;Acc:101170574])

HSP 1 Score: 177.563 bits (449), Expect = 1.466e-43
Identity = 293/1361 (21.53%), Postives = 561/1361 (41.22%), Query Frame = -3
Query: 4880 SDKYIHVNTTQTSQKDKNNMMVSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASLPFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKEMEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIE-FEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEES--------------NVILVKESRDPRTVFKLHP-VIQDSEEVTFESYARIEHVLSGNWLHALK---DKEYKR------QQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLEDRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNM----------PLY-----GQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDR-ISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKS--WIALHKFLQVDYPG-YDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVV--------DHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMF--ENTTQVKID-----QMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSK--WSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILS---VETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYP--DVQNQ-----------------------IFENLDMLLRV-KLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH-------------YLTQYILESPHELVYYLLTKPFPKH---LKTHLTCSI 8644
            S+KY+ VN    +  +KN M V+L+   ++ +   I P +K+++ G+ V + D++IL  + + G   HAS  + L++     E+N     + + I       D  E  ++GG  V+LFH E E ++       D    ++H+ +R   + +A +  +SN+    W+IE        G    W+  +RF+H  T  YLA + +                ++++ +  D  ++F+L P  +Q ++     SY R+ H+ +  W+ +     D + +R          T ED+ +   +     E+R +D  +D     +  ++++   +  P                DR   K L     +   +A        +V  K  + RQKL+R   ++  +  +L            PL+     G    +++  +   CY +L  +     RKN  + AK   + + Q+       +     I  L+ +NRK++++ I+K ++  FV  +RTN    +L+ L  LCV N V I   Q  I +           L  + Q+I  +  +  + TD +K     ++ +  Q    G   DE V     QL LF  +C  R    I  I+K L     E  FL +  E+LP D+RA +C +++   VD      V              S   +Y    D ++    +++A      +F  + +++   L  N  M    +E N L  +V+ L   L+ FG+Y    ++  L   L+G+ID SR  P  P   G     +        Q+G++    K    +++ K   LE+LQ ILN   + RL+  ++ F          KK+       A  +     E + + +  Q++  ++   MF  +  + +++D         +LI+L  ++YA +   AL++L   +S +Q+      +  +L++      ++ +   +  LR + +    W +++ +   +   +  +   + +  ++P P  +++   +    +V EIL        S + +K  +  K +     +L  + + Y   DV+ Q                       + +NL++ L   +L+E+E   T++ +F NN  LC +I    +   +   A H +   ++L+ L  I+K E  G  +K+ Q ++M                                  +Y ISL+ELL+ CAEG+N Y E  C ++L +ED++ V+ H +    +K  ++ ++   Y+      +E    EI     IW    +   ++               L +YI+    + +    + PF ++   L+TH T  I
Sbjct:   36 SNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWKLRANGDNVLVGDKVILNPVNA-GQPLHAS-NYDLNDHSGCKEVNSVNCNTSWKINLFMMFSDHREDVLKGGDVVRLFHAEQEKFLTC-----DEYKSKLHVFLRTTLRQSATSATSSNA---LWEIEVVHHDPCRGGAGHWNSLYRFKHLATGNYLAAEMDGRRISKRSQGERIKYKLVVLSDGNDIASLFELDPTTLQKTDSFVPNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLMLGTCPTKEDKEAFAIVSVPVMEIRDLDFANDASAMLSTVVEQLTRGFISP---------------NDRFAIKLLEDVVFFVTDVANAGQSVLDVVMKKPNRERQKLMREQNILKQIFGILKTPSAKREGGEAPLFRLEELGDQKNSHYQYMFQLCYRVL-RHSQEDYRKNQ-HIAKQFGMMQGQI----GYDILAEDTITALLHNNRKLLEKHITKTEVETFVNLVRTNRE-PFLDYLSDLCVSNNVAIPVTQELICK---------CVLDPKNQDILIK-TVWLLWTDKIKEKHEKSIRQLAQEARQGNTHDENVLTYYYQLKLFARMCLDRQYLAIDEISKQLDV---ELIFLCMMDEMLPFDLRASFCRLMLHAHVDRDPQELVTPVKFARLWTEIPTSISIKYDSNMDDSRDNKKNRFAN---TMVF--MEEYLNNVL--NDEMPFHNVEKNKLTYEVVSLARHLIYFGFYS-FFELLRLTRTLLGIID-SRPNPGHP---GPIFQDDGPA-----QRGNKDSLEKMDLTVMDTKSKILEILQFILNVRLDYRLSFLLSVF----------KKEFVDVYPMADADATTNME-QAATINLQRIG-EQAEAMFGIKGNSILEVDDEGGRMFLRVLIHLTMHEYAPLVSGALQLLFRHFSQRQEVLHTFKQVQLLISAQDVENYKLIKANLDRLRTLVEKSELWVEKKSSAGGDGKKDKKDKKEISEVSDKPTPTKEKLEKGNENYQMVKEILERLHRMCSSGVWKKQQRLLKNMGAHKVMLDLLQVSYDKNDVKMQEIIKYTHLFLQKFCMGNQENQALLHKNLNLFLNPGQLLEAE---TVQHIFSNNYQLCSEISESVLQHFIHCLATHGRHV-QYLNFLHTIIKAE--GKYVKKCQDMIM---------------------------------TEYHISLVELLAACAEGKNVYTEIKCTSLLPLEDVVKVVTHVDCITEVKTAYVNFVNHCYV-----DTEVEMKEIYTSNHIWNLFEDFTVDMARVCNKRESRLADPVLEKYIVNVVLDTINAFFSSPFSENSTSLQTHHTIVI 1278          

HSP 2 Score: 143.665 bits (361), Expect = 2.247e-33
Identity = 90/302 (29.80%), Postives = 167/302 (55.30%), Query Frame = -3
Query: 1031 FYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGF----NTEKNL--YCDSLWHCFVSVMRFGL-----VGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFL 1903
             Y+ A +  S+ G +    F++  L ++++  + L  VI +VT+NG+S++  A+L ++++YL++I+GF   +  F    + E NL   CD+L  C V+V+  GL     VGD+     P   ++  F     V+Y L F+ ++  I LN+IFG+I+DTF++LR  K   E  ++ TCFIC      F++    FE H+  EHN+W+Y++F + L++    DYT  + +VA ++K    D+FP  +A+ L   D D   +++  L   + + +    +  ++    +E + ++R +++  GF+
Sbjct: 1997 LYHLAYVLTSILGLFIHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLCLKEDFIMEVDPESNLERACDTLLMCIVTVLNHGLRNGGGVGDVLRK--PSKDQEPLFPAR--VVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICLERD-KFDNKTVSFEEHINMEHNIWNYLYFIVLLREKNKTDYTGPESYVAHMMKNNNLDWFPRMQAMSLVVTDSDGEQNEMRILQDKLGSTMKVVTTLTAQLTELKEQMTEQRKRRQRMGFV 2293          
BLAST of SMED30029683 vs. Ensembl Medaka
Match: ryr1b (ryanodine receptor 1 [Source:NCBI gene;Acc:101160087])

HSP 1 Score: 123.635 bits (309), Expect = 3.102e-27
Identity = 86/261 (32.95%), Postives = 135/261 (51.72%), Query Frame = -3
Query: 1172 LISSKTFYYFA-ILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNT-----EKNLYCDS-----LWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDED 1921
            + +  TF Y    +  S+ G  Y+ +F+A HL++I    + L+ ++S+VT NGK L+    L  VV+YLY ++ F FFR  +N      E ++ CD      L+H +V V   G +GD  E+  P   E   +     V++ ++FF  +  I L  I  +I+D F ELRD +     DM   CFIC   S  F+    GFE H L EHN+ +Y FF ++L +    ++T  + +V  + +E+ +DFFP     C   + ED
Sbjct: 4425 VFTDNTFLYLVWYMVMSVLGH-YNNFFYACHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIED--PAGDEYELYR----VVFDITFFFFVIVI-LLAIIQLIIDAFGELRDQQEQVREDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANY-FFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGD--CFRKQYED 4674          

HSP 2 Score: 59.3066 bits (142), Expect = 1.054e-7
Identity = 99/450 (22.00%), Postives = 173/450 (38.44%), Query Frame = -3
Query: 7013 NSAITYWQIEFEKSIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILV-----------------KESRD---PRTVFKLH-PVIQDSEEVTFESYARIEHVLSGNWL-HALKDKEYKRQQFSTTEDERSMHAIRWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLE--DRLKEKFLHAKEAYRVCMAFR----EIKEFML-----VNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTY------------------------------MIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEAL-RTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDY 8170
            + A + W++E  + I SG  + W Q FR RH TT  YL +DEE  +++V                 KE  D    R V  +  P I+  E + F     ++HV +G WL +A  D +  R                  G   R+V    +   DDA T+ +   E  +    I   +   R  +   D L  K   +K    V +        +++ +            + +Q  LR+LR         N     Q +    + + LEC D L  Y                              +I  +R N   F   ++   ++ LD+ E S  +++++  ++ ++ ++++ I +  I   +  L +   N++ L++L+ LCVCNGV +  NQ  I +  LL  R  +  T        +PNI   + +    +   +  + VDY
Sbjct:   27 SQARSLWRLEPLR-IWSGSHMKWGQSFRIRHITTGRYLCLDEEKGLMVVDPEKANTKLSAFCFRASKEKVDVAQKRDVEGMGIPEIKYGESMCF-----VQHVSTGLWLTYAALDAKAARL-----------------GMMKRRVILHQEGHMDDALTVSRSQTEESQAARMIYSTMGLFRQFIRGLDSLSGK---SKSLGTVSLPLAGVILSLQDLIFYFRPPEEELEHEEKQTKLRSLR---------NRQNLFQEEFQGMITIVLECIDRLNVYNTAAHFSEFAGEEAAESWKEIVNLLYELLSLIRGNRSNCALFCDNLDWLVSK-LDRLEAS-SILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLRSLCVCNGVAVRSNQNLITEN-LLPGRDLLLQTNIVNYATVRPNIFLGTCEGSTQYKKWYYEMMVDY 438          
BLAST of SMED30029683 vs. Planmine SMEST
Match: SMESG000023213.1 (SMESG000023213.1)

HSP 1 Score: 4608.9 bits (11953), Expect = 0.000e+0
Identity = 2341/2342 (99.96%), Postives = 2342/2342 (100.00%), Query Frame = -3
Query:  605 MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 7630
            MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLISRSKSKSIRGRRNRNKGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISK+NNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS
Sbjct:    1 MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLISRSKSKSIRGRRNRNKGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKFNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 2342          
BLAST of SMED30029683 vs. Planmine SMEST
Match: SMESG000023213.1 (SMESG000023213.1)

HSP 1 Score: 4603.12 bits (11938), Expect = 0.000e+0
Identity = 2334/2353 (99.19%), Postives = 2335/2353 (99.24%), Query Frame = -3
Query:  605 MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXX-----------XXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 7630
            MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLISRSKSKSIR                 K LIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISK+NNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS
Sbjct:    1 MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLISRSKSKSIRGRRNRNKVIGDSLIKTTKSLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKFNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 2353          
BLAST of SMED30029683 vs. Planmine SMEST
Match: SMESG000023213.1 (SMESG000023213.1)

HSP 1 Score: 4590.79 bits (11906), Expect = 0.000e+0
Identity = 2319/2349 (98.72%), Postives = 2320/2349 (98.77%), Query Frame = -3
Query:  605 MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEK-------KIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 7630
            MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEK       KIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKK                     K LIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISK+NNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS
Sbjct:    1 MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKNLFMISRKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKK-----------VIGDSLIKTTKSLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKFNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 2338          
BLAST of SMED30029683 vs. Planmine SMEST
Match: SMESG000023213.1 (SMESG000023213.1)

HSP 1 Score: 4590.02 bits (11904), Expect = 0.000e+0
Identity = 2315/2333 (99.23%), Postives = 2316/2333 (99.27%), Query Frame = -3
Query:  605 MLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 7603
            MLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVL                K LIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISK+NNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS
Sbjct:    1 MLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVL-ISRSKSKRDSLIKTTKSLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKFNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 2332          
BLAST of SMED30029683 vs. Planmine SMEST
Match: SMESG000023213.1 (SMESG000023213.1)

HSP 1 Score: 4524.15 bits (11733), Expect = 0.000e+0
Identity = 2290/2342 (97.78%), Postives = 2291/2342 (97.82%), Query Frame = -3
Query:  605 MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVXXXXXXXXXXXXXQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEXXXXXXXIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTXXXXXXXXXXXXXXXXXXAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVXXXXXXXXXXXILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKKDESVLXXXXXXXXXXXXXXXXXGLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 7630
            MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHE                             VKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKK                     K LIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISK+NNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS
Sbjct:    1 MAFREIKEFMLVNGKSVKARQKLLRNLRVIDLLVKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELFETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENYRYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPNILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNEYCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNYSVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLDENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLIDGSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAALEVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNPYEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQLALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAKSKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVMEILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLLRVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFLDLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLKEELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPEIANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIHYLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLNNENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKDVYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPVVEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHNTVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKMADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHNEERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSDQIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMANIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMKNAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLHDNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDGYIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYANINKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPDCSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTEAYEMHE-----------------------------VKDEIKDLKSKLCEVGFSYYFILARLYDLDPNLGKK-----------VIGDSLIKTTKSLIITPNQQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDRSSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITILSVILNLMMLTVFKAPKDGSFDENFNISKFNNSLPDFFRNPVPDWKPRFENLKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNELDPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFHLVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSGFNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIYHLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSYDFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKEQKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRFEELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLLRHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYAIGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYAKHDSDGSMS 2302          
The following BLAST results are available for this feature:
BLAST of SMED30029683 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITPR32.962e-5421.92inositol 1,4,5-trisphosphate receptor type 3 [Sour... [more]
ITPR32.962e-5421.92inositol 1,4,5-trisphosphate receptor type 3 [Sour... [more]
ITPR22.654e-5222.55inositol 1,4,5-trisphosphate receptor type 2 [Sour... [more]
ITPR13.030e-3926.39inositol 1,4,5-trisphosphate receptor type 1 [Sour... [more]
ITPR11.024e-3826.39inositol 1,4,5-trisphosphate receptor type 1 [Sour... [more]
back to top
BLAST of SMED30029683 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itr-11.547e-3526.65Inositol 1,4,5-trisphosphate receptor itr-1 [Sour... [more]
itr-11.685e-3526.65Inositol 1,4,5-trisphosphate receptor itr-1 [Sour... [more]
itr-11.693e-3526.65Inositol 1,4,5-trisphosphate receptor itr-1 [Sour... [more]
itr-11.703e-3526.65Inositol 1,4,5-trisphosphate receptor itr-1 [Sour... [more]
itr-11.890e-3526.65Inositol 1,4,5-trisphosphate receptor itr-1 [Sour... [more]
back to top
BLAST of SMED30029683 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Itp-r83A1.676e-3724.62gene:FBgn0010051 transcript:FBtr0078686[more]
Itp-r83A1.676e-3724.62gene:FBgn0010051 transcript:FBtr0344265[more]
Itp-r83A1.677e-3724.62gene:FBgn0010051 transcript:FBtr0078687[more]
RyR7.569e-2530.12gene:FBgn0011286 transcript:FBtr0088639[more]
RyR7.762e-2530.12gene:FBgn0011286 transcript:FBtr0304568[more]
back to top
BLAST of SMED30029683 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itpr31.143e-5722.29inositol 1,4,5-trisphosphate receptor, type 3 [Sou... [more]
itpr1b1.303e-5622.38inositol 1,4,5-trisphosphate receptor, type 1b [So... [more]
itpr1b1.177e-5522.39inositol 1,4,5-trisphosphate receptor, type 1b [So... [more]
itpr1a1.710e-5522.65inositol 1,4,5-trisphosphate receptor, type 1a [So... [more]
itpr1b2.369e-5522.27inositol 1,4,5-trisphosphate receptor, type 1b [So... [more]
back to top
BLAST of SMED30029683 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasgrp17.827e-6322.89RAS guanyl releasing protein 1 [Source:Xenbase;Acc... [more]
rasgrp11.231e-6122.82RAS guanyl releasing protein 1 [Source:Xenbase;Acc... [more]
rasgrp13.250e-6122.66RAS guanyl releasing protein 1 [Source:Xenbase;Acc... [more]
rasgrp19.668e-6122.65RAS guanyl releasing protein 1 [Source:Xenbase;Acc... [more]
rasgrp11.374e-6022.94RAS guanyl releasing protein 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of SMED30029683 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Itpr31.253e-5821.93inositol 1,4,5-triphosphate receptor 3 [Source:MGI... [more]
Itpr24.462e-5722.93inositol 1,4,5-triphosphate receptor 2 [Source:MGI... [more]
Itpr16.013e-5422.17inositol 1,4,5-trisphosphate receptor 1 [Source:MG... [more]
Itpr11.004e-5322.17inositol 1,4,5-trisphosphate receptor 1 [Source:MG... [more]
Itpr26.072e-5122.48inositol 1,4,5-triphosphate receptor 2 [Source:MGI... [more]
back to top
BLAST of SMED30029683 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70227|ITPR3_MOUSE8.767e-5821.93Inositol 1,4,5-trisphosphate receptor type 3 OS=Mu... [more]
sp|Q63269|ITPR3_RAT1.794e-5621.85Inositol 1,4,5-trisphosphate receptor type 3 OS=Ra... [more]
sp|Q9Z329|ITPR2_MOUSE3.121e-5622.93Inositol 1,4,5-trisphosphate receptor type 2 OS=Mu... [more]
sp|P29995|ITPR2_RAT4.154e-5622.81Inositol 1,4,5-trisphosphate receptor type 2 OS=Ra... [more]
sp|Q9TU34|ITPR1_BOVIN1.408e-5522.14Inositol 1,4,5-trisphosphate receptor type 1 OS=Bo... [more]
back to top
BLAST of SMED30029683 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G7Y30.000e+054.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E8352.994e-1756.51Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A210PSZ20.000e+047.72Inositol 1,4,5-trisphosphate receptor type 1 OS=Mi... [more]
A0A1S3H9B80.000e+046.42inositol 1,4,5-trisphosphate receptor type 3 isofo... [more]
A0A1S3H6U80.000e+046.25inositol 1,4,5-trisphosphate receptor type 3 isofo... [more]
back to top
BLAST of SMED30029683 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itpr1a9.278e-4626.17inositol 1,4,5-trisphosphate receptor, type 1a [So... [more]
itpr1b3.198e-4224.81inositol 1,4,5-trisphosphate receptor, type 1b [So... [more]
itpr26.253e-4124.07inositol 1,4,5-trisphosphate receptor, type 2 [Sou... [more]
ryr1b4.506e-3534.87ryanodine receptor 1b (skeletal) [Source:ZFIN;Acc:... [more]
ryr1a7.384e-3535.08ryanodine receptor 1a (skeletal) [Source:ZFIN;Acc:... [more]
back to top
BLAST of SMED30029683 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003582.12.259e-2125.96pep scaffold:Pmarinus_7.0:GL477251:10655:41631:-1 ... [more]
ENSPMAT00000007822.16.126e-2035.00pep scaffold:Pmarinus_7.0:GL476823:160879:181935:-... [more]
ENSPMAT00000007816.13.899e-1935.00pep scaffold:Pmarinus_7.0:GL476823:160879:205429:-... [more]
ENSPMAT00000010602.18.405e-1628.62pep scaffold:Pmarinus_7.0:GL476450:29:322425:-1 ge... [more]
back to top
BLAST of SMED30029683 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029683 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO378762.463e-3723.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285928.894e-3623.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30029683 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itpr1b1.700e-5822.98inositol 1,4,5-trisphosphate receptor type 1 [Sour... [more]
itpr27.070e-5027.02inositol 1,4,5-trisphosphate receptor, type 2 [Sou... [more]
itpr1a9.595e-5022.37inositol 1,4,5-trisphosphate receptor type 1 [Sour... [more]
itpr31.466e-4321.53inositol 1,4,5-trisphosphate receptor type 3 [Sour... [more]
ryr1b3.102e-2732.95ryanodine receptor 1 [Source:NCBI gene;Acc:1011600... [more]
back to top
BLAST of SMED30029683 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023213.10.000e+099.96SMESG000023213.1[more]
SMESG000023213.10.000e+099.19SMESG000023213.1[more]
SMESG000023213.10.000e+098.72SMESG000023213.1[more]
SMESG000023213.10.000e+099.23SMESG000023213.1[more]
SMESG000023213.10.000e+097.78SMESG000023213.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029683 ID=SMED30029683|Name=SMED30029683|organism=Schmidtea mediterranea sexual|type=transcript|length=9372bp
GGGGGCTACAGATTTTATTGGACATTCCATATTGACGCACATATTTAAGC
CAACACCTTTTTTTAAAATTAGAATTTAAATGAATACTTTCCGTCGGAAT
TCTGCATTAGAATTATCCAATTTAATTAAACCAAGCGATCTGAAATTACA
TTCTTCGCCATCAAACGAAAATTTGAGAAAAATGGACTTTGCTTGCAGTA
ACATAGTAACAAAACCTTTTTATCTCATTCAACCAGCTAAAATCACAAAA
GTTGTTGATCATGAATCCATAAATGGAATTCATGGAATTCATGGAATTAT
TTCTGAAAATTCTGATTCATCTATCCTTGAGTCATTATCGGTTTCTAAGA
ATCCTTTCGACAAATTTGTTAAGGAAGAATTCCGGTTTCAAAATGAATCT
GTAAGACGATTGAGTCTTGAGATTACGAAAGATGTTTGTTTCAAACGGAA
ACACTGCCAATGCATGAGTAAGATTTGTGAAACGAATTCGAATCTAATTA
TTACTACGAAAAACTCACCAACCTCAAATCAATCTTTTCAAAATGATTTG
ATTCATATTATAAATAATAATAATAATAATATTGCATAGGAAATTGTGAA
TTTATGACATGGAACCGTCACTGTCATGTTTTGCATAATCATCAAGGAAT
TTCATGGGGTCGTCAGACGGATAATCTATGGGGTAAGCTGGTAGAATTGG
GGCCTGGTCGAGATCGGGCTGAATATTCGGGGGAGAAATACAAAATATCG
AATCGTTTTTCTCAGGAATCTCGTCACCAATCGCGTAATCGGAATCGCCG
CTTTCACCACCTATCGATTCAGAGTGGGGAGGGATGCTGTAAGGTTTAGA
TGAAATCTTTGATTTGCTACTTTTATGGGCGGCGCCTTCGTGAGGTTCGT
GATGAATTCGGTCGTTTGTAGAATCATGTCTCAACAGTAAACTGGAATGA
TGACAGTTGCTAACTTGTCTCAAACCCAGCCCGTTTTCATTGTCATCCTC
GTCCAATTTCTCTAGTGATCCTTCATTGCTTAGGAATCCTCGGTGGCGTT
TTTGCCAGCGCTTTTGACGAAGAAGTTCTTCAAATCTCTTTCTTTCCGAA
TCTTCAGATTTCTGGTGATTAATCAGCGTGCTGACGTTCTTTAACAGTTC
ATCGATCTTTGAATCTGTGGAATCTTCATCTTTAGCAGTCAAACATAAGG
CTCGGTTCAATGGAAAGAAATCAAATTTTTGTTCTTTTAATAATGTCGCA
ACAAACATATCTAGGCTTGTGTAATCATTAGCTTTTGTATCTTGTAAATG
TATAAAAAAGAAAATATACGACCACATATTATGCTCATTGAGAACATGGT
ATTCAAACCCTTGGCCATGATGTTCAAAGTCGTAACTGTTTCTACTACAA
ATGAAACAAGTGTCTCTCATATCTGATTCTGCGGTCCACTTGAGGTCTCG
CAATTCACTGAAGGTGTCAACTATTATACCGAAAATGATATTCAAACCAA
TAGTAGTAATAAGTATGAAAAAGGATAAATGATATATAACAAGCATTGAG
AATGTGAAAAAAGACTTTTCGGAATCATGTGGTAACAGGTTTTCAAATAG
ATCTCCGACCAATCCGAATCTCATCACCGATACGAAGCAGTGCCACAAAG
AATCACAATAAAGGTTTTTTTCCGTATTGAACCCCGATCGGAAGAACGCA
AATCCGATTATTGCATAAAGGTAAATGACGACCATTCCAAGGATGGCTAC
CCATATTAGTGACTTTCCGTTCTGTGTTACTGCTGATATAACTCCTTGAA
GGAGCTGATTGTTGTGTACAATGTTGACTAAATGGAAAGCAAAGAAGTAC
GGGGAATACCACTGACCTGCAAGTGAGAATCCCAAAATAGCAAAATAATA
AAAGGTCTTGGATGATATCAGATGCGATCGCATTTTGCAACCTTCATCTC
CTTGCTGAATGATGTCCTCATCCGCTGGATCCAGTTCATTCTGTTTTAAG
CGTCTTTTTATTAATATGAAATAATACTGGATTCTTGGTGGGGAAGGATG
ATCAGCAAGAAAATACGTGAACAGCAGAAACCCACACAAAACGTTGTGAA
CTAGTCCAAAAGCAAACATCCAACTCTTCAAATTTTCAAATCTTGGTTTC
CAATCAGGGACAGGATTTCTGAAAAAATCTGGCAAACTATTATTGTATTT
TGATATATTGAAGTTTTCGTCAAATGATCCGTCTTTTGGAGCCTTGAAAA
CCGTGAGCATCATCAAATTTAAAATAACACTGAGAATAGTTATGGCATAG
TTCCATAATAACCATCCTCCTGTAAAGAATTTCGCTATTGGATTATTCAT
AGCTTTTTTCTGGTATCGAATGTCATTCAAGATTGACTTGGACCAGTCCA
TGAAGTCTCTGATTTTATTGCTCGGTGATGACCTGTCCACATTCCACTTG
ACAACTTCTTTCACTTCTTCTCGAATAATGTTCTTGTTCCTAATTCGGAA
ATGAACCTTCTGTAGATAATCTCCTTTCAATAATTCGATGGAAACACTAT
TCTTTTTGTAGAATTTGAATGCCTTTTGTTGATTTGGTGTTATTATCAAA
CCTTTATTTCTGTTTCGCCGTCCTCTAATACTTTTAGATTTAGATCGGGA
TATTAACACGGACTCGTCTTTTTTCCCGAGATTTGGATCCAAATCATAAA
GTCTGGCAAGAATGAAGTAATAGGAAAATCCAACTTCACACAATTTACTT
TTCAAGTCTTTAATTTCGTCTTTTACCATAAACTTTGCGATTATATATTG
TGTTTTAAATGATTTATTCGTGTTGCTTTTCGGTCTAATACCATCTGGAG
TCAATGATTCAGACTCGTGCATCTCATACGCTTCAGTCATCACTCGATAG
ATTGCCTCTTTGTCCAGTGTATCTTTGACTTCATTAGCTATTTGTGTAGC
ATCGGGATTGTTTTCTTCAATCATTGAGATAACCAAATTTCCGATGTTCT
GTTTCAACTCAATCATTTGGTGTATGGAACAATCGGGATAATTACCCCCC
CTCAAAATGTAATTTATATAATCTATTATTTTGTTGTCATAAACTGTGAC
ACGATTTTCTTGATTTCCTGCTACAAATTCATTAATTGTTGAGAATACTT
GAGATACGAGGTCTATAGTGTCCTTGTTGATATTCGCGTAGACTACGTTA
AGAAATTGAACAACTTCAGCAACGAGATTGAATGATTTTACGTTGTCAGG
TTGTTCTCTCAGGTAAGTCTGCAAACCCGGATGTTGTCCATCACAAATTC
GTGCCAGAAGTTTCAACACCAATTCTATATAACCATCATCTTTCATGCTT
ATCGCTTCATCTCCCGCATCGGCTTCGTCTTCTTCTAACTCTTCTTCCTC
AGCCTCTTCAGTTTTAGCTACAGTGACCATGGCCAATTCTTCGGCTTCAG
CTCCAAGAAGTTTATTAGAATCATTGTTGTCATGTAATCTTGGATTCTCA
CCAAGAAATTTTCCATCACTTTGTCGGAATGTGGCTTTTGGAGTATGTTT
CACCTTTCCATTGATGTTCTTTTCTTTTTTTATCACTTTCTGTCTGGTTT
TGGAGTTATTAGATAGACTGTTTACTGCATTTTTCATTCGTTGAGTGCTG
ATCATCATTCGTATTTCCTTCATTGCCCGATTTCCTAAAGTCATTGTCGT
TGCCAGATTTTTGGCTTGCTCTTGGGCTTCTTTTTTCCGGGATATTTGTT
GGGCCAATAGCAAACGTCTTTCTTTAATGTTCGCCATTGATAACTGCAAT
CGATTTCGAACAGCATAGAAAAAGACCTCTTCTTTAGTTTCAAGAAAATA
ATCCAGTAAAGATTTTTGTATTCCATGATTGGCGTTGAATAACATCATTG
CCTGTAGCGAGAGAACTTCTTTGGCAATCTGATCGCTTGGATTTGCAAGA
TGGGGTAAAATTTTTGTACCAAATTTAAAAGAATTCAAAGTGTTTTGAAT
ATCTTCAATGTTTTTCAATCCCTTCTTGATTCGAAATTCTGATGTTCTAG
TTTGCCAATCTTCGGGAAGTTTTCTTTCTTCATTGTGGATCATTGCTCGT
AACAACTGTAAACATCTTATATCAAGCTTTTCCTGTTCTAATCGGCGTTT
ACGGGCTCCACCTGTTGTTGCGAGATTTCCAAAATTAGTAGTTGTGGCTG
ATATATGTAATTGGTTTATTAGAAGATCTGCCATTTTGTACTTGATTTCA
GTCTTTTTTGTGTTAGGAACTATAAAACACTTCAAATGATTTTGAAACTC
ATCCCCAAGGGGCAAATAGTCATCACCATTTAATGTTGTATAGTCTCTAT
TTGAGGATATTTTCAACTGTGCTTGGACAGTATTGTGTCCGCTGAATATA
AGGCTGCAATTCGCTGCAAAAGTCTTTAATTTCAAATTCATTTTTACTTC
TTGATTATAATACTCTTGATTTCCCTCTTTCATTTGTGTGATTGTGTCAA
CAATTTTTCCTCCTTTACCAATTCCTTCAACGACAGGCTCCATTATCGTT
GCAGGTAAAGTAGATTTTGGTATCATGTGGGTTACACAAGCAATCATGGC
CTTGAGATGGTGCGGTTGGGTCATGGCGGGGGAAAGGGCAGCACACAGAT
TCACCATCGAGCGAGTAAGGTCGTCATAAACATCTTTCTCGGATTTATTA
TCTTCGGAATCAAAAAGAAATACTTGTCGTGAATAGAGATGTAGAAATGC
CATAACAGAATCAAAAATATAATGAATTGAAGCATGAGCTCTAAATTCGT
CTTCCTTAACTCGAAGAATTGCATTTTCGTTATTTAATTTCAAGGGCTTT
TTAGGATCTTGGGACACGAGTTCAGTGCATATTGAGCACGTTAAATGAGT
TTTTAAGTGTTTAGGAAAGGGTTTCGTCAACAGATAATAAACCAGTTCGT
GAGGTGATTCTAAAATGTACTGAGTGAGATAATGTATCTCTTCCCCTAAG
TTTCCTATGAATTGCCATATCTTTTTTTCTTTCAGAATTTCCGCCGTGTT
ACTCTCGGAGCTGTTTATTGGCTTCTTTAAATAGGCAAACATGAGATATT
TTAGGAAAGGTCTTTTTAAATGATTGGCAATTTCCGGATGATTTAGGACA
TTAAGGATGTCTTCCACAGATAAAATCGTTTGACATAATGATTCGATGTA
GCGGTTTTCTCCTTCAGCACAAGTTGAAAGCAATTCAATTAAACTAATCA
AATATTGAACATGATCTTCACCGAGTTCCTCTTTAAGTACCGCTTCTCTC
GTTTCCATTGGCTGTTCGAGAATGTAAGCGGCACTGCTATAACTTTGCAT
TATATACTTCATCACAAGCGTTTGATTTCTTTTCAGTGCCAATCCCAGAC
CTTCCACTTTCACAATGGCACATAAAAGATCTAAAAATTCCGGTGCCTTT
TGTTGGTGCTCGGCGGCTAGACTGACGATTTTATGGATTTGACGAGGAAG
AATTTTCAGACAAAGATTTTGATTGTTGACAAAGACTTCTTTCAGAGTTA
TCGCTAATTCCGATTCGACAAGTTTAACACGAAGCAACATGTCGAGATTC
TCGAAAATCTGGTTTTGGACATCAGGATATTGAAGTGCCATGGCTTTTAG
CAATTGCAAAGCTTTTCGAAGTACCTTTTCCGTTTGGGAATACTTTTCAG
TTAGCTGACTGTCGGTCTCGACAGATAGGATTTCCATTACCACTCCAATA
ACATTATCACTATCGAGAATCCTTTGATTCATTGGATGAGGTTCTTCGGG
CGCTTTTGGCAAATGACAAAATTCGATTAATTCCGAAAAAATGTTTTCCA
TTCTATTGACTTGCTCGTCTGACCATTTAGATTTTGCCATCATCCTCAAC
AGTGGAACTTGTTTAGCGACTTCTCGATGGACACAACATGAATCGGTGGT
CATTAATACCAAGGATTCTGTGGCGGCCTGGAATGTGTCTTGTTTGCCGG
AATAGAGAAGATTGAGAACTTCTAAGGCCAACTGGTTCATCTTCGCGTAT
TTATAATGGGCCAGATTTATCAATATATTTGTCATTTGGTCGATTTTCAC
TTGTGTTGTATTTTCAAACATTTCTCGAAGTTCTTTGATCATCAATTTCT
GTTTCCGAACCGCCGAAGGCTTTTTTTCATACGGATTGAATCCTTCGTAT
AATGCACATGCTAATGAGCTTGGGTTTTTCTTTTTTAATAGGCCTTCGTT
TCTTTCACATTCTTTAAATTTTGCCATGAATCCCGCTAATCTTGCGTTAG
ATTCAAAATTCAAAATCATTTGAAGAACTTCGAGGGCCGCATATTTAGCA
TTTACAATGGCACTAGTTTCTTTTGACTGCAAGTACCTGTCTCCTTGCTG
ATATTTTTGAACAATTTTCTTTTTCTCTTTCGATAATTCTTTTCCCTGTC
TCTCGGGAGGAAATGGTAAGTCTCTGCTACCATCTATCAATCCGATAAGC
TTATCCAACAAACTCCTCACGTCGTCTACGTCTCCATAATATCCGAATTT
CACCAAGAAATTCAAAAGTCTCAAAACTTGTTCAATGAGCATATTATGTT
CGATTTTCGACGCAATCATGTAAGTATTTTCATCAAGAAAAGCGGCAATC
CAATCCCGGAGAGCTGGGAAAATCGTCACCAAGTCTTTTGCAGCATATTG
ATCTGATGTTGTCGTTTTATTTTGATCCTTAGTTCCAACATATTCATAGA
CAAAGCTTCGTTCCGGATGATCAACGACTGAGTAATTGTTTCCCACATCC
ACAAATAATCCGATTATCATTTCACAGTATTTCGCTCTAACGTCATCCGG
TAGGATCTCAGATTGCAGAGAAAGGAATCCTTCTTCCCATGATAAGTAGC
TGAGGTCTTTCGTTATCAACCGAATGCAGTACTCATTCCGGCCATAGCAT
ATTGCGTTGAACAAATCGAGTTGCGCTAAAAGAAATTGAACCTTTTCATC
ATCATATCCGGGATAGTCGACTTGTAGGAACTTATGTAGAGCAATCCAGG
ATTTCATACAGTCTGTGCTGACATATAATATGTTCGGTTGCTCGTGGATA
TTTTGCCCCCTTTCTGTGAGATATACACCTCTCCTATCTTCCAAAAGCCA
TCTTTGAGCAATGTAAGTTTGATTGTCGACAATTCCAACCCCATTGCAAA
CGCACAAAACTTTAAGCAATTCCAAATATCGATAATTTTCATTTGTTCTC
AAAGCTTCAACAAATTGGTTGATTTGAACTTTACTAATTCTGTCGACGAT
TTTACGATTGTCTCGAATCAGTTCGACAATAAGCTGTACCACCTTGAGAC
TTATCTCTGATTTATCTAACATTTGGGTTTCAAAAAGCTCTATGTATTTA
GCGAAATACAAAGCGTTCTTTCTACTGGAGCCAATCATGTAAGTATACAA
AATGTCGTAACATTCTAAATGAACTTTGAGAAAGTTCGCCTCGTCTGGTT
GACCGTAAAGTGGCATGTTTAACAACTTGACCAAAAGGTCTATGACTCTT
AAATTTCTCAGTAGTTTTTGACGAGCTTTAACGGACTTTCCATTAACTAA
CATAAATTCTTTGATTTCTCTAAATGCCATGCATACTCGGTAAGCTTCCT
TGGCATGCAGAAATTTCTCTTTCAATCTGTCTTCTAATAAATTTCTCAAA
AATGGCACAATTCCAGCAATAAAATTAAAAGGCCTATAGTATTCAGGATA
AACTTTTTGTATTGTGTAGGCGTCATCATAACGTCTGTCATGAACGCAGT
CAACCTTTCTAAGTTCTCCGCCATCCCATCGAATTGCATGCATCGATCTT
TCATCTTCTGTTGTGCTAAATTGCTGCCTTTTGTATTCCTTGTCTTTTAA
AGCATGCAACCAATTGCCGGATAAAACATGCTCAATTCTCGCATAACTTT
CAAACGTTACTTCTTCACTGTCTTGAATTACCGGATGCAATTTGAAAACC
GTTCTTGGATCTCGAGATTCTTTCACCAAAATGACATTGCTTTCTTCATC
CACAGCCAGATACATTCTCGTCGTCGTGTGCCGAAACCTAAATTGTTGAT
CCCAAGTCAACTTGTCTCCGCTAATAATACTCTTTTCGAATTCGATTTGC
CAGTACGTTATTGCCGAATTTGACGTTCGCAACGTGCGAGCATTCAACTG
ATCTATTTCTCGTATTCTTAAATGCACTTGCTCTGTGACGCAATCATCAA
ACAGCCCTTCGGCAACGATATAAGCTTCCATTTCTTTGTGAAATAATTGT
ACAAATTGTCCTCCTCTGACAAATGGCTCACTTTCATCGAAATGTGAGTA
GCTCTTCACAATTGTAAATCCACTTTGCTCGACCCCAAGATTGAGCTCTG
ACCCCATTAAAAAGTTATCCAAATAAAACGGTAGACTGGCGTGAAAAAAA
TGGCCCGGAGATTTGATACTTTCCAGAATTATTTGATCGTAAATTTGCAC
ATATTCTCCTTCAGATTTGACTTTGTAGCGGGGAAGAATTTTGAATTGTG
CCGTTTTATCGTTGTGGGGGTTTAATGATACCATCATGTTGTTCTTGTCC
TTCTGGCTGGTTTGAGTAGTGTTGACATGAATATATTTGTCACTGAATAC
CTGCTTCAACTGGATTACTTCTCCATAGCGAACTTTTTTATTTTGGTTTC
GCCTTTGTTCGGCCAGATTATCCACATTTTCCGCCTCAGCTGCCGCTTTC
GCCTGATCACAAAGTTGCCTCGTGTCGGCATCCAAGACATTCTCGTCTTC
AATATTTGCAAATTTTCGGAGGTATTTCTTGTTAAGTTTATATCGGTTTT
GTATTGATATTTGAAATGTTATCATTTGAGGATCAGGAATATGGCTTGGT
TGGTTTCTATCCTGTTTGTGGTAAATAGCTAGATTGTTGAAAAAGGAGCT
TGTGCTCATGCTGTATACATATCCATCGGTTTCCTCACAATAGAGACAAA
TAAAATCCCCAATGCACAAAAAGTCTGCCATTTTCAATAAAAATAACAGT
TGCAGAAATCAAGTCCGTAACGGTGATGCTGCTAGTAAGTAAGTCTAACG
GATTGGAAACGTAGAAATAATGAATATATCAATTCCAATAGGGCTATTTA
AAGTCAAGATCACAATCAAATCGTCGACGAAATCATAATGAAACAGAGAA
ATCAGCCAATGATGTTTCGTTGTTGTTCAAAGTCGCAATCTCGATTCTAT
CAGTAGTAGATCATTTTTTAAAAAGATATTTGGGAGCATTTTTTATAGGA
ATTTCGATAGTTTCTCGGGAAATTCCAGTTCCGCTTGCTAGGATTCGCTG
TTTTCACTAATTTCCATTTTCA
back to top

protein sequence of SMED30029683-orf-1

>SMED30029683-orf-1 ID=SMED30029683-orf-1|Name=SMED30029683-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2810bp
MADFLCIGDFICLYCEETDGYVYSMSTSSFFNNLAIYHKQDRNQPSHIPD
PQMITFQISIQNRYKLNKKYLRKFANIEDENVLDADTRQLCDQAKAAAEA
ENVDNLAEQRRNQNKKVRYGEVIQLKQVFSDKYIHVNTTQTSQKDKNNMM
VSLNPHNDKTAQFKILPRYKVKSEGEYVQIYDQIILESIKSPGHFFHASL
PFYLDNFLMGSELNLGVEQSGFTIVKSYSHFDESEPFVRGGQFVQLFHKE
MEAYIVAEGLFDDCVTEQVHLRIREIDQLNARTLRTSNSAITYWQIEFEK
SIISGDKLTWDQQFRFRHTTTRMYLAVDEESNVILVKESRDPRTVFKLHP
VIQDSEEVTFESYARIEHVLSGNWLHALKDKEYKRQQFSTTEDERSMHAI
RWDGGELRKVDCVHDRRYDDAYTIQKVYPEYYRPFNFIAGIVPFLRNLLE
DRLKEKFLHAKEAYRVCMAFREIKEFMLVNGKSVKARQKLLRNLRVIDLL
VKLLNMPLYGQPDEANFLKVHLECYDILYTYMIGSSRKNALYFAKYIELF
ETQMLDKSEISLKVVQLIVELIRDNRKIVDRISKVQINQFVEALRTNENY
RYLELLKVLCVCNGVGIVDNQTYIAQRWLLEDRRGVYLTERGQNIHEQPN
ILYVSTDCMKSWIALHKFLQVDYPGYDDEKVQFLLAQLDLFNAICYGRNE
YCIRLITKDLSYLSWEEGFLSLQSEILPDDVRAKYCEMIIGLFVDVGNNY
SVVDHPERSFVYEYVGTKDQNKTTTSDQYAAKDLVTIFPALRDWIAAFLD
ENTYMIASKIEHNMLIEQVLRLLNFLVKFGYYGDVDDVRSLLDKLIGLID
GSRDLPFPPERQGKELSKEKKKIVQKYQQGDRYLQSKETSAIVNAKYAAL
EVLQMILNFESNARLAGFMAKFKECERNEGLLKKKNPSSLACALYEGFNP
YEKKPSAVRKQKLMIKELREMFENTTQVKIDQMTNILINLAHYKYAKMNQ
LALEVLNLLYSGKQDTFQAATESLVLMTTDSCCVHREVAKQVPLLRMMAK
SKWSDEQVNRMENIFSELIEFCHLPKAPEEPHPMNQRILDSDNVIGVVME
ILSVETDSQLTEKYSQTEKVLRKALQLLKAMALQYPDVQNQIFENLDMLL
RVKLVESELAITLKEVFVNNQNLCLKILPRQIHKIVSLAAEHQQKAPEFL
DLLCAIVKVEGLGLALKRNQTLVMKYIMQSYSSAAYILEQPMETREAVLK
EELGEDHVQYLISLIELLSTCAEGENRYIESLCQTILSVEDILNVLNHPE
IANHLKRPFLKYLMFAYLKKPINSSESNTAEILKEKKIWQFIGNLGEEIH
YLTQYILESPHELVYYLLTKPFPKHLKTHLTCSICTELVSQDPKKPLKLN
NENAILRVKEDEFRAHASIHYIFDSVMAFLHLYSRQVFLFDSEDNKSEKD
VYDDLTRSMVNLCAALSPAMTQPHHLKAMIACVTHMIPKSTLPATIMEPV
VEGIGKGGKIVDTITQMKEGNQEYYNQEVKMNLKLKTFAANCSLIFSGHN
TVQAQLKISSNRDYTTLNGDDYLPLGDEFQNHLKCFIVPNTKKTEIKYKM
ADLLINQLHISATTTNFGNLATTGGARKRRLEQEKLDIRCLQLLRAMIHN
EERKLPEDWQTRTSEFRIKKGLKNIEDIQNTLNSFKFGTKILPHLANPSD
QIAKEVLSLQAMMLFNANHGIQKSLLDYFLETKEEVFFYAVRNRLQLSMA
NIKERRLLLAQQISRKKEAQEQAKNLATTMTLGNRAMKEIRMMISTQRMK
NAVNSLSNNSKTRQKVIKKEKNINGKVKHTPKATFRQSDGKFLGENPRLH
DNNDSNKLLGAEAEELAMVTVAKTEEAEEEELEEDEADAGDEAISMKDDG
YIELVLKLLARICDGQHPGLQTYLREQPDNVKSFNLVAEVVQFLNVVYAN
INKDTIDLVSQVFSTINEFVAGNQENRVTVYDNKIIDYINYILRGGNYPD
CSIHQMIELKQNIGNLVISMIEENNPDATQIANEVKDTLDKEAIYRVMTE
AYEMHESESLTPDGIRPKSNTNKSFKTQYIIAKFMVKDEIKDLKSKLCEV
GFSYYFILARLYDLDPNLGKKDESVLISRSKSKSIRGRRNRNKGLIITPN
QQKAFKFYKKNSVSIELLKGDYLQKVHFRIRNKNIIREEVKEVVKWNVDR
SSPSNKIRDFMDWSKSILNDIRYQKKAMNNPIAKFFTGGWLLWNYAITIL
SVILNLMMLTVFKAPKDGSFDENFNISKYNNSLPDFFRNPVPDWKPRFEN
LKSWMFAFGLVHNVLCGFLLFTYFLADHPSPPRIQYYFILIKRRLKQNEL
DPADEDIIQQGDEGCKMRSHLISSKTFYYFAILGFSLAGQWYSPYFFAFH
LVNIVHNNQLLQGVISAVTQNGKSLIWVAILGMVVIYLYAIIGFAFFRSG
FNTEKNLYCDSLWHCFVSVMRFGLVGDLFENLLPHDSEKSFFTFSMLVIY
HLSFFILITTIGLNIIFGIIVDTFSELRDLKWTAESDMRDTCFICSRNSY
DFEHHGQGFEYHVLNEHNMWSYIFFFIHLQDTKANDYTSLDMFVATLLKE
QKFDFFPLNRALCLTAKDEDSTDSKIDELLKNVSTLINHQKSEDSERKRF
EELLRQKRWQKRHRGFLSNEGSLEKLDEDDNENGLGLRQVSNCHHSSLLL
RHDSTNDRIHHEPHEGAAHKSSKSKISSKPYSIPPHSESIGGESGDSDYA
IGDEIPEKNDSIFCISPPNIQPDLDQAPILPAYPIDYPSDDPMKFLDDYA
KHDSDGSMS*
back to top

protein sequence of SMED30029683-orf-2

>SMED30029683-orf-2 ID=SMED30029683-orf-2|Name=SMED30029683-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=170bp
MNTFRRNSALELSNLIKPSDLKLHSSPSNENLRKMDFACSNIVTKPFYLI
QPAKITKVVDHESINGIHGIHGIISENSDSSILESLSVSKNPFDKFVKEE
FRFQNESVRRLSLEITKDVCFKRKHCQCMSKICETNSNLIITTKNSPTSN
QSFQNDLIHIINNNNNNIA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016024ARM-type_fold
IPR013809ENTH
IPR000493InsP3_rcpt
IPR016093MIR_motif
IPR005821Ion_trans_dom
IPR000699RIH_dom
IPR013662RIH_assoc-dom
IPR014821Ins145_P3_rcpt
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006816calcium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0070588calcium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005220inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0005216ion channel activity
GO:0005262calcium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1135..1155
NoneNo IPR availableCOILSCoilCoilcoord: 1022..1042
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 1673..1791
e-value: 4.2E-7
score: 31.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1976..2016
NoneNo IPR availablePANTHERPTHR13715RYANODINE RECEPTOR AND IP3 RECEPTORcoord: 2..1921
NoneNo IPR availablePANTHERPTHR13715:SF99INOSITOL 1,4,5-TRISPHOSPHATE RECEPTOR-LIKE PROTEIN Acoord: 2..1921
NoneNo IPR availableTMHMMTMhelixcoord: 1762..1784
NoneNo IPR availableTMHMMTMhelixcoord: 1567..1589
NoneNo IPR availableTMHMMTMhelixcoord: 1688..1710
NoneNo IPR availableTMHMMTMhelixcoord: 1503..1525
NoneNo IPR availableTMHMMTMhelixcoord: 1640..1662
IPR000699RIH domainPFAMPF01365RYDR_ITPRcoord: 349..492
e-value: 5.5E-9
score: 35.7
IPR013662RyR/IP3R Homology associated domainPFAMPF08454RIH_assoccoord: 1164..1256
e-value: 9.1E-21
score: 73.6
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 1659..1792
e-value: 3.6E-9
score: 36.2
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 262..1318