baculoviral IAP repeat-containing protein 3 isoform X2

Overview
Namebaculoviral IAP repeat-containing protein 3 isoform X2
Smed IDSMED30029680
Length (bp)1061
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of baculoviral IAP repeat-containing protein 3 isoform X2 (SMED30029680) t-SNE clustered cells

Violin plots show distribution of expression levels for baculoviral IAP repeat-containing protein 3 isoform X2 (SMED30029680) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of baculoviral IAP repeat-containing protein 3 isoform X2 (SMED30029680) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for baculoviral IAP repeat-containing protein 3 isoform X2 (SMED30029680) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029680

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30029680h1SMcG0021913 dd_Smed_v4_8155_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029680h1SMcG0021913 dd_Smed_v4_8155_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 66.6254 bits (161), Expect = 1.806e-11
Identity = 62/251 (24.70%), Postives = 104/251 (41.43%), Query Frame = 3
Query:  177 MYHFESDILNFDKFEIE-NREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVE-KLQLHLFHRFNCIVL---NG----NNLPICSQNKNKIEEFCTVEYVAQEDMIIRTLDS------LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI------KYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            M  +E+ I  F  +    N+EQ          LA+ G Y + +     +KC+ C   +   K  E   + H      C  L    G    NN+ +     + +EE C V    +   + R +D       ++ +   +GF  + +K+I+ +   + G NY S   L  D+           ++Q SL    +       +     C +CM RN+ ++F+PCGHL+ C  C+E +  CP+C   I  K K F
Sbjct:  262 MADYEARIFTFGTWIYSVNKEQ----------LARAGFYALGE--GDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHL----THSLEE-CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIF 495          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 66.6254 bits (161), Expect = 1.806e-11
Identity = 62/251 (24.70%), Postives = 104/251 (41.43%), Query Frame = 3
Query:  177 MYHFESDILNFDKFEIE-NREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVE-KLQLHLFHRFNCIVL---NG----NNLPICSQNKNKIEEFCTVEYVAQEDMIIRTLDS------LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI------KYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            M  +E+ I  F  +    N+EQ          LA+ G Y + +     +KC+ C   +   K  E   + H      C  L    G    NN+ +     + +EE C V    +   + R +D       ++ +   +GF  + +K+I+ +   + G NY S   L  D+           ++Q SL    +       +     C +CM RN+ ++F+PCGHL+ C  C+E +  CP+C   I  K K F
Sbjct:  262 MADYEARIFTFGTWIYSVNKEQ----------LARAGFYALGE--GDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHL----THSLEE-CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIF 495          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 66.6254 bits (161), Expect = 1.806e-11
Identity = 62/251 (24.70%), Postives = 104/251 (41.43%), Query Frame = 3
Query:  177 MYHFESDILNFDKFEIE-NREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVE-KLQLHLFHRFNCIVL---NG----NNLPICSQNKNKIEEFCTVEYVAQEDMIIRTLDS------LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI------KYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            M  +E+ I  F  +    N+EQ          LA+ G Y + +     +KC+ C   +   K  E   + H      C  L    G    NN+ +     + +EE C V    +   + R +D       ++ +   +GF  + +K+I+ +   + G NY S   L  D+           ++Q SL    +       +     C +CM RN+ ++F+PCGHL+ C  C+E +  CP+C   I  K K F
Sbjct:  262 MADYEARIFTFGTWIYSVNKEQ----------LARAGFYALGE--GDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHL----THSLEE-CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIF 495          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Human
Match: BIRC3 (baculoviral IAP repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:591])

HSP 1 Score: 58.5362 bits (140), Expect = 8.503e-9
Identity = 21/46 (45.65%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  729 CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            C VCM + V ++F+PCGHL++C  C+  +  CPICR  I+  V+ F
Sbjct:  598 CKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTF 643          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Human
Match: BIRC3 (baculoviral IAP repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:591])

HSP 1 Score: 58.5362 bits (140), Expect = 8.702e-9
Identity = 21/46 (45.65%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  729 CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            C VCM + V ++F+PCGHL++C  C+  +  CPICR  I+  V+ F
Sbjct:  557 CKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTF 602          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Fly
Match: Diap2 (gene:FBgn0015247 transcript:FBtr0087297)

HSP 1 Score: 55.0694 bits (131), Expect = 4.537e-8
Identity = 21/48 (43.75%), Postives = 30/48 (62.50%), Query Frame = 3
Query:  723 HFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
              C VC+   V V+FLPCGHL  C+ C+  +  CP+CR +I+  V+ F
Sbjct:  449 RLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTF 496          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Fly
Match: Diap2 (gene:FBgn0015247 transcript:FBtr0087296)

HSP 1 Score: 55.0694 bits (131), Expect = 4.537e-8
Identity = 21/48 (43.75%), Postives = 30/48 (62.50%), Query Frame = 3
Query:  723 HFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
              C VC+   V V+FLPCGHL  C+ C+  +  CP+CR +I+  V+ F
Sbjct:  449 RLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTF 496          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Fly
Match: Diap1 (gene:FBgn0260635 transcript:FBtr0075500)

HSP 1 Score: 50.8322 bits (120), Expect = 1.142e-6
Identity = 20/60 (33.33%), Postives = 32/60 (53.33%), Query Frame = 3
Query:  660 TQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRR 839
            T ++ PS ++  + S  I     C +C        FLPCGH++ C  C+  +T CP+CR+
Sbjct:  370 TAVATPSTNS--SGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRK 427          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Fly
Match: Diap1 (gene:FBgn0260635 transcript:FBtr0333618)

HSP 1 Score: 50.8322 bits (120), Expect = 1.142e-6
Identity = 20/60 (33.33%), Postives = 32/60 (53.33%), Query Frame = 3
Query:  660 TQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRR 839
            T ++ PS ++  + S  I     C +C        FLPCGH++ C  C+  +T CP+CR+
Sbjct:  370 TAVATPSTNS--SGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRK 427          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Fly
Match: Diap1 (gene:FBgn0260635 transcript:FBtr0075501)

HSP 1 Score: 50.8322 bits (120), Expect = 1.142e-6
Identity = 20/60 (33.33%), Postives = 32/60 (53.33%), Query Frame = 3
Query:  660 TQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRR 839
            T ++ PS ++  + S  I     C +C        FLPCGH++ C  C+  +T CP+CR+
Sbjct:  370 TAVATPSTNS--SGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRK 427          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Zebrafish
Match: lrsam1 (leucine rich repeat and sterile alpha motif containing 1 [Source:ZFIN;Acc:ZDB-GENE-060526-97])

HSP 1 Score: 62.003 bits (149), Expect = 4.186e-10
Identity = 27/62 (43.55%), Postives = 36/62 (58.06%), Query Frame = 3
Query:  675 PSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVK 860
            PS    PT  +    N  C VCM    QVIFLPCGH+  C  CS+ +  CP+CR +I ++V+
Sbjct:  649 PSAPLTPTTPNPDRFNSECVVCMELESQVIFLPCGHVCCCQTCSDALQSCPLCRGSISQRVR 710          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Zebrafish
Match: lrsam1 (leucine rich repeat and sterile alpha motif containing 1 [Source:ZFIN;Acc:ZDB-GENE-060526-97])

HSP 1 Score: 62.003 bits (149), Expect = 4.202e-10
Identity = 27/62 (43.55%), Postives = 36/62 (58.06%), Query Frame = 3
Query:  675 PSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVK 860
            PS    PT  +    N  C VCM    QVIFLPCGH+  C  CS+ +  CP+CR +I ++V+
Sbjct:  656 PSAPLTPTTPNPDRFNSECVVCMELESQVIFLPCGHVCCCQTCSDALQSCPLCRGSISQRVR 717          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Zebrafish
Match: lrsam1 (leucine rich repeat and sterile alpha motif containing 1 [Source:ZFIN;Acc:ZDB-GENE-060526-97])

HSP 1 Score: 62.003 bits (149), Expect = 4.434e-10
Identity = 27/62 (43.55%), Postives = 36/62 (58.06%), Query Frame = 3
Query:  675 PSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVK 860
            PS    PT  +    N  C VCM    QVIFLPCGH+  C  CS+ +  CP+CR +I ++V+
Sbjct:  656 PSAPLTPTTPNPDRFNSECVVCMELESQVIFLPCGHVCCCQTCSDALQSCPLCRGSISQRVR 717          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Zebrafish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 58.9214 bits (141), Expect = 4.615e-9
Identity = 28/92 (30.43%), Postives = 50/92 (54.35%), Query Frame = 3
Query:  603 RNYDSFYELFIDIKYNANNTQISLPSR--STVPTNSDL--ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            RN+    ++++  +  A   + + PS+  S +P    L  +     C VCM + V ++F+PCGHL++C  C+  +  CPICR  ++  V+ F
Sbjct:  554 RNWIKKNDVYLLRELMAQTNEAASPSQDLSDLPMEEQLRRLQEERTCKVCMDKEVNIVFIPCGHLVVCKECAPSLRKCPICRGMVKGTVRTF 645          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Zebrafish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 58.9214 bits (141), Expect = 4.615e-9
Identity = 28/92 (30.43%), Postives = 50/92 (54.35%), Query Frame = 3
Query:  603 RNYDSFYELFIDIKYNANNTQISLPSR--STVPTNSDL--ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            RN+    ++++  +  A   + + PS+  S +P    L  +     C VCM + V ++F+PCGHL++C  C+  +  CPICR  ++  V+ F
Sbjct:  554 RNWIKKNDVYLLRELMAQTNEAASPSQDLSDLPMEEQLRRLQEERTCKVCMDKEVNIVFIPCGHLVVCKECAPSLRKCPICRGMVKGTVRTF 645          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Xenopus
Match: fasn (fatty acid synthase [Source:Xenbase;Acc:XB-GENE-1002983])

HSP 1 Score: 68.9366 bits (167), Expect = 3.434e-12
Identity = 34/110 (30.91%), Postives = 56/110 (50.91%), Query Frame = 3
Query:  543 LGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDL--ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            +GFP E +K+++ +     G+NY    E   D+      T +  P    +     L  +     C VCM R + ++F+PCGHL+ C +C++ +  CPIC   +ER+ K F
Sbjct:  382 MGFPLEEIKKVMGQKLKTTGKNYTCVEEFVSDL-CAQKETVLEKPKEIEISLEEKLRQLEEEKICKVCMDRRISIVFIPCGHLVACAVCADVLDKCPICCTIVERRQKIF 490          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Xenopus
Match: LRSAM1 (leucine rich repeat and sterile alpha motif containing 1 [Source:NCBI gene;Acc:100124327])

HSP 1 Score: 59.6918 bits (143), Expect = 4.050e-9
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 3
Query:  669 SLPSRSTVPTNSDLILANH--FCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVK 860
            +LPS    P+  D  +AN    C VCM +   VIFLPCGH+  C  C + +  CP+CRR+I ++++
Sbjct:  613 ALPS-PMEPSAPDTEVANRNSECVVCMEQEAHVIFLPCGHVCCCTNCGDALRTCPLCRRDIGQRIR 677          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Xenopus
Match: LRSAM1 (leucine rich repeat and sterile alpha motif containing 1 [Source:NCBI gene;Acc:100124327])

HSP 1 Score: 59.6918 bits (143), Expect = 4.169e-9
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 3
Query:  669 SLPSRSTVPTNSDLILANH--FCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVK 860
            +LPS    P+  D  +AN    C VCM +   VIFLPCGH+  C  C + +  CP+CRR+I ++++
Sbjct:  648 ALPS-PMEPSAPDTEVANRNSECVVCMEQEAHVIFLPCGHVCCCTNCGDALRTCPLCRRDIGQRIR 712          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Xenopus
Match: arsa.1 (arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GENE-5959463])

HSP 1 Score: 58.151 bits (139), Expect = 7.218e-9
Identity = 35/127 (27.56%), Postives = 56/127 (44.09%), Query Frame = 3
Query:  543 LGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNA---NNTQISLPSRST--------------VPTNSDL--ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            +GF    V  ++   +++ G  Y S  EL  D+           +S+P   T              + T   L  +     C VCM  +V ++F+PCGHL++C  C+ ++  CPICR  I   V+ F
Sbjct:  239 VGFKRNRVSSLMINRFILTGSCYGSVSELVTDLIRAEEIHGTESVSVPRAPTQRERPEPPKEPAPPLSTEEQLRQLKEERMCKVCMDNDVSMVFVPCGHLVVCTECAPNLRHCPICRAAIRGSVRAF 365          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Xenopus
Match: arsa.1 (arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GENE-5959463])

HSP 1 Score: 58.151 bits (139), Expect = 8.791e-9
Identity = 35/127 (27.56%), Postives = 56/127 (44.09%), Query Frame = 3
Query:  543 LGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNA---NNTQISLPSRST--------------VPTNSDL--ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            +GF    V  ++   +++ G  Y S  EL  D+           +S+P   T              + T   L  +     C VCM  +V ++F+PCGHL++C  C+ ++  CPICR  I   V+ F
Sbjct:  257 VGFKRNRVSSLMINRFILTGSCYGSVSELVTDLIRAEEIHGTESVSVPRAPTQRERPEPPKEPAPPLSTEEQLRQLKEERMCKVCMDNDVSMVFVPCGHLVVCTECAPNLRHCPICRAAIRGSVRAF 383          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Mouse
Match: Birc3 (baculoviral IAP repeat-containing 3 [Source:MGI Symbol;Acc:MGI:1197007])

HSP 1 Score: 60.4622 bits (145), Expect = 1.358e-9
Identity = 22/48 (45.83%), Postives = 31/48 (64.58%), Query Frame = 3
Query:  723 HFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
              C VCM R V ++F+PCGHL++C  C+  +  CPICR  I+  V+ F
Sbjct:  553 RMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTF 600          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Mouse
Match: Birc2 (baculoviral IAP repeat-containing 2 [Source:MGI Symbol;Acc:MGI:1197009])

HSP 1 Score: 60.077 bits (144), Expect = 2.009e-9
Identity = 22/46 (47.83%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  729 CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            C VCM R V ++F+PCGHL++C  C+  +  CPICR  I+  V+ F
Sbjct:  565 CKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTF 610          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Mouse
Match: Birc2 (baculoviral IAP repeat-containing 2 [Source:MGI Symbol;Acc:MGI:1197009])

HSP 1 Score: 60.077 bits (144), Expect = 2.009e-9
Identity = 22/46 (47.83%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  729 CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            C VCM R V ++F+PCGHL++C  C+  +  CPICR  I+  V+ F
Sbjct:  565 CKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTF 610          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 58.9214 bits (141), Expect = 4.551e-9
Identity = 57/247 (23.08%), Postives = 103/247 (41.70%), Query Frame = 3
Query:  177 MYHFESDILNFDKFEIENREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVE-KLQLHLFHRFNCIVL---NG----NNLPIC---SQNKNKIEEFCTVEYVAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFID-IKYNANNT-----QISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            M  +E+ I+ F          T+ + ++ + LA+ G Y + +     +KC+ C   +   K  E   + H      C  L    G    NN+ +     ++  +  E         +D I +  + ++ +   +GF  + +K+ + +     G +Y S   L  D +    +NT     Q SL    +       +     C +CM RN+ ++F+PCGHL+ C  C+E +  CP+C   I  K K F
Sbjct:  261 MAEYEARIVTFG---------TWTSSVNKEQLARAGFYALGE--GDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPSLTKKIDDTIFQ--NPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIF 494          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 58.9214 bits (141), Expect = 4.551e-9
Identity = 57/247 (23.08%), Postives = 103/247 (41.70%), Query Frame = 3
Query:  177 MYHFESDILNFDKFEIENREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVE-KLQLHLFHRFNCIVL---NG----NNLPIC---SQNKNKIEEFCTVEYVAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFID-IKYNANNT-----QISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            M  +E+ I+ F          T+ + ++ + LA+ G Y + +     +KC+ C   +   K  E   + H      C  L    G    NN+ +     ++  +  E         +D I +  + ++ +   +GF  + +K+ + +     G +Y S   L  D +    +NT     Q SL    +       +     C +CM RN+ ++F+PCGHL+ C  C+E +  CP+C   I  K K F
Sbjct:  261 MAEYEARIVTFG---------TWTSSVNKEQLARAGFYALGE--GDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPSLTKKIDDTIFQ--NPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIF 494          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. UniProt/SwissProt
Match: sp|A5D8Q0|XIAP_XENLA (E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 3.231e-12
Identity = 35/110 (31.82%), Postives = 56/110 (50.91%), Query Frame = 3
Query:  543 LGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDL--ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            +GFP E +K+++ +     G NY    E   D+    + T    P +  +     L  +     C VCM R + ++F+PCGHL+ C +C++ +  CPIC   IER+ K F
Sbjct:  377 MGFPLEEIKKVMGQKLKTTGNNYTCVEEFVSDLLCAQSETIADKPMKREISIEEKLRQLEEEKVCKVCMDRRITIVFIPCGHLVACAVCADVLDKCPICCTIIERRQKIF 486          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. UniProt/SwissProt
Match: sp|Q5BKL8|XIAP_XENTR (E3 ubiquitin-protein ligase XIAP OS=Xenopus tropicalis OX=8364 GN=xiap PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.819e-11
Identity = 34/110 (30.91%), Postives = 56/110 (50.91%), Query Frame = 3
Query:  543 LGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDL--ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            +GFP E +K+++ +     G+NY    E   D+      T +  P    +     L  +     C VCM R + ++F+PCGHL+ C +C++ +  CPIC   +ER+ K F
Sbjct:  382 MGFPLEEIKKVMGQKLKTTGKNYTCVEEFVSDL-CAQKETVLEKPKEIEISLEEKLRQLEEEKICKVCMDRRISIVFIPCGHLVACAVCADVLDKCPICCTIVERRQKIF 490          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. UniProt/SwissProt
Match: sp|P98170|XIAP_HUMAN (E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 8.673e-11
Identity = 62/251 (24.70%), Postives = 104/251 (41.43%), Query Frame = 3
Query:  177 MYHFESDILNFDKFEIE-NREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVE-KLQLHLFHRFNCIVL---NG----NNLPICSQNKNKIEEFCTVEYVAQEDMIIRTLDS------LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI------KYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            M  +E+ I  F  +    N+EQ          LA+ G Y + +     +KC+ C   +   K  E   + H      C  L    G    NN+ +     + +EE C V    +   + R +D       ++ +   +GF  + +K+I+ +   + G NY S   L  D+           ++Q SL    +       +     C +CM RN+ ++F+PCGHL+ C  C+E +  CP+C   I  K K F
Sbjct:  262 MADYEARIFTFGTWIYSVNKEQ----------LARAGFYALGE--GDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHL----THSLEE-CLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIF 495          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. UniProt/SwissProt
Match: sp|Q8JHV9|BIR7A_XENLA (Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.368e-10
Identity = 36/128 (28.12%), Postives = 62/128 (48.44%), Query Frame = 3
Query:  543 LGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI------KYNANNTQIS-LPSR---STVPTNSDLILAN----------HFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            +GF    V  ++   +++ G +Y S  +L  D+       ++  +  +S  P+R   S  P  S   L+             C VCM ++V ++F+PCGHL++C  C+ ++  CPICR  I   V+ F
Sbjct:  272 MGFKQSLVASLIQSKFLLTGSSYSSVSDLVTDLLVAEEETHSTESVSVSRAPTRMERSEPPKESAPPLSTEEQLRRLKEERMCKVCMDKDVSMLFVPCGHLVVCTECAPNLRHCPICRAAIRGSVRAF 399          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. UniProt/SwissProt
Match: sp|Q96P09|BIRC8_HUMAN (Baculoviral IAP repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=BIRC8 PE=1 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 3.620e-10
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  516 DSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNT------QISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            + ++ +   +GF  + VK+I+ +     G NY +   L  D+     +T      Q SL    +       +     C +CM R++ V+F+PCGHL+ C  C+E +  CP+C   I+ K + F
Sbjct:  112 NPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVF 234          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. TrEMBL
Match: U3IU60 (X-linked inhibitor of apoptosis OS=Anas platyrhynchos platyrhynchos OX=8840 GN=XIAP PE=4 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.033e-10
Identity = 63/243 (25.93%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  204 NFDKFEIENREQTFDNHI---SIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVE-KLQLHLFHRFNCIVLNG-------NNLPICSQNKNKIEEFCTVEYVAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFID-IKYNANNTQISLPSRSTVPTNSDLILANHF--------CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRF 872
            N    E E R QTF N I   + + LA+ G Y I  +G H + C+ C   ++  K+ E     H      C  +         NN+ +    ++   E   V  + ++D +    + L+    ++GF    +K I+ K   + G +Y S  +L  D I     N +   P+ +  P   DL +            C +CM +++ V+ +PCGHL+ C  C+E + +CP+C  NI ++ K F +
Sbjct:  258 NPSMAEYERRIQTFLNWIYPVNKEQLAEAGFYSI-GNGDHVV-CFHCGGGLQEWKENEDPWDQHAKWFPGCRFVREEKGLEFINNVHLGGGCRDSTIEAAEVTVLPKDDHL---QNHLVQNAIHMGFSLSEIKSIMQKKLQMSGASYTSVEDLVADLISAQKENLKEETPNEN--PLEQDLSMEEKLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNVCPLCCTNILKRQKIFMY 493          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. TrEMBL
Match: A0A452J144 (X-linked inhibitor of apoptosis OS=Gopherus agassizii OX=38772 GN=XIAP PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.415e-10
Identity = 62/236 (26.27%), Postives = 105/236 (44.49%), Query Frame = 3
Query:  219 EIENREQTFDNHISIKY------LAQHGLYIIQKDGAHYLKCYACK---KDVEILKDVEKLQLHLFHRFNCIVLNGNNLPICSQNKNKIEEFCTVEYVAQEDMIIRTL--DSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKY-NANNTQISLPSRSTVPTNSDL------ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRF 872
            E E R +TF   ++ +Y      LA+ G Y I  +G H L C+ C    +D +  +D  +     F     ++       + S     +    T+E   +  ++I  L  + L+     +GF    +K I+ K    +G NY S   L  DI +    N Q  + S S+VP +         +     C +CM +++ V+F+PCGHL+ C  C+E +  CP+C   I ++ K F +
Sbjct:  266 EYEARIKTF---VTWRYSVVKEQLAEAGFYSI-GNGDHVL-CFHCGGGLQDWQQNEDPWEQHAKWFPGCKYLLQEKGQEFVNSVQLTPLWRDSTIEASEKTSLLIDDLLQNQLVQNAMRMGFSLSEIKNIMEKKLRTYGENYTSVELLVSDIIHAQKENVQEEVSSGSSVPKDLSTEEKLRRLQEEKMCKICMDKDISVVFIPCGHLVACKECAEAVDKCPVCCMVITKRQKIFMY 496          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. TrEMBL
Match: Q6J3R0 (X-linked inhibitor of apotosis protein (Fragment) OS=Canis lupus familiaris OX=9615 GN=XIAP PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.428e-10
Identity = 36/121 (29.75%), Postives = 58/121 (47.93%), Query Frame = 3
Query:  522 LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI------KYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            ++ +   +GF  + +K+I+ +     G NY S   L  D+           ++Q SL    +      L+     C +CM RN+ V+F+PCGHL+ C  C+E +  CP+C   I  K K F
Sbjct:    8 MLQEAIRMGFSFKDIKKIMEEKIQTSGSNYVSLEALVSDLVSAQKDHTQDESSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIF 128          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. TrEMBL
Match: S9XQG9 (Baculoviral IAP repeat-containing protein 4 OS=Camelus ferus OX=419612 GN=CB1_002472006 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.455e-10
Identity = 65/260 (25.00%), Postives = 108/260 (41.54%), Query Frame = 3
Query:  225 ENREQTFDN-----HISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVEK-LQLHLFHRFNCIVLNGNNL------------------------PICSQNKNKIEEFCTVEYVAQEDMIIRT----LDS------LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFID-IKYNANNTQ-----ISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            E R ++F N     H++ + LA+ GLY    D    ++C+ C   ++  +  ++    H  H  NC  + G N+                        P  +  + +I  F T  Y   ++ + R     LD       ++ +   +GF  + +K+I+ +     G NY S   L  D +    +NTQ      SL    +      L+     C +CM RN+ V+F+PCGHL+ C  C+E +  CP+C   I  K K F
Sbjct:  181 EARLKSFQNWPDYAHLTPRELARAGLYYTGID--DQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNFRSESDAVSSDRNFPNSTNPPRNPAMADYEARIITFGTWIYSVNKEQLARAGFYALDDTIFQNPMVQEAVRMGFNFKDIKKIMEEKIQTSGSNYKSLEVLVADLVSAQKDNTQDESSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIF 438          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. TrEMBL
Match: A0A226P7S5 (RING-type domain-containing protein OS=Colinus virginianus OX=9014 GN=H355_012293 PE=4 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.937e-10
Identity = 35/120 (29.17%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  540 YLGFPTEFVKQILTKHWVVFGRNYDSFYELFID-IKYNANNTQISLPSRSTVPTNSDL--------ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRF 872
            ++GF    ++ I+ K   + G +Y S  +L  D I     N +   P  S  P   DL        +     C +CM +++ V+ +PCGHL+ C  C+E +  CP+C  NI ++ K F +
Sbjct:   47 HMGFSLSEIRSIMEKKLQMSGESYTSVEDLVADLISAQKENIKGEPPKES--PLEQDLSIEEKLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNKCPLCCTNIIKRQKIFMY 164          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 66.2402 bits (160), Expect = 1.131e-11
Identity = 40/165 (24.24%), Postives = 68/165 (41.21%), Query Frame = 3
Query:  396 FNCIVLNGNNLPICSQNKNKIEEFCTVEYVAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDLILANHF--------CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            FN   ++G+  P         E         Q  ++   L  ++     +GF    V+ ++   +++ G +Y S  +L  D+       +    SR   P   +L              C VCM + V ++F+PCGHL++C  C+  +  CPICR  I   V+ F
Sbjct:  246 FNMSEMSGSQTPAAGNIPTGHEVLS-----GQSAVVAAMLSPVVQTALQMGFQRALVESLVQSRYLLTGHHYTSVSDLVADVLQAEEEERQGSQSR---PVTGNLSAEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCTDCAASLRHCPICRAVIRGSVRAF 402          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Cavefish
Match: lrsam1 (leucine rich repeat and sterile alpha motif containing 1 [Source:NCBI gene;Acc:103025730])

HSP 1 Score: 59.3066 bits (142), Expect = 2.780e-9
Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 3
Query:  675 PSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVK 860
            P   TVP+  D   ++  C VCM    QVI+LPCGH+  C +CS+ +  CP+CR +I ++++
Sbjct:  705 PLTPTVPSPMDGPSSSE-CVVCMEAESQVIYLPCGHVCCCQVCSDALYSCPLCRSDISQRIR 765          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 58.9214 bits (141), Expect = 2.808e-9
Identity = 41/184 (22.28%), Postives = 72/184 (39.13%), Query Frame = 3
Query:  396 FNCIVLNGNNLPICSQNKNKIEEFCTVEYVAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI-----------------------KYNANNTQISLPSRSTVPTNSDLIL----ANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            FN   ++G+  P         E         Q  ++   L  ++     +GF    V+ ++   +++ G +Y S  +L  D+                             TQ S+  + T   +++  L        C VCM + V ++F+PCGHL++C  C+  +  CPICR  I   V+ F
Sbjct:  246 FNMSEMSGSQTPAAGNIPTGHEVLS-----GQSAVVAAMLSPVVQTALQMGFQRALVESLVQSRYLLTGHHYTSVSDLVADVLQAEEEERQGSQSRPEPVVRQGGSTGEVRTQTSVGEKVTGNLSAEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCTDCAASLRHCPICRAVIRGSVRAF 424          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Cavefish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:NCBI gene;Acc:103025481])

HSP 1 Score: 58.151 bits (139), Expect = 6.035e-9
Identity = 28/92 (30.43%), Postives = 50/92 (54.35%), Query Frame = 3
Query:  603 RNYDSFYELFIDIKYNANNTQISLPSR--STVPTNSDL--ILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            RN+    ++++  +  A   + + PS+  S +P    L  +     C VCM + V ++F+PCGHL++C  C+  +  CPICR  ++  V+ F
Sbjct:  538 RNWIQKNDVYLLRELMAQTNEAASPSQDLSDLPMEEQLRRLQEERTCKVCMDKEVNIVFIPCGHLVVCKECAPSLRKCPICRGLVKGTVRTF 629          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Cavefish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:NCBI gene;Acc:103025481])

HSP 1 Score: 56.225 bits (134), Expect = 2.410e-8
Identity = 20/46 (43.48%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  729 CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            C VCM + V ++F+PCGHL++C  C+  +  CPICR  ++  V+ F
Sbjct:  570 CKVCMDKEVNIVFIPCGHLVVCKECAPSLRKCPICRGLVKGTVRTF 615          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Sea Lamprey
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 58.9214 bits (141), Expect = 6.334e-10
Identity = 22/48 (45.83%), Postives = 31/48 (64.58%), Query Frame = 3
Query:  723 HFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            H C VCM + V V+F+PCGHL++C  C+  +  CPICR  +   V+ F
Sbjct:  527 HTCKVCMDKEVSVVFIPCGHLVVCRDCASSLRKCPICRAVVRGTVRTF 574          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009710.1 (pep scaffold:Pmarinus_7.0:GL484213:64:2160:1 gene:ENSPMAG00000008775.1 transcript:ENSPMAT00000009710.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 1.578e-6
Identity = 17/54 (31.48%), Postives = 29/54 (53.70%), Query Frame = 3
Query:  726 FCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRFTIPKV 887
             C+ C   ++   F PCGH++ C  C+  +  CP+CR +++R    F    PK+
Sbjct:  121 LCSACCHGDIDAAFCPCGHMVCCRGCAARLRACPLCRCDVDRVQHVFLPVCPKL 174          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Sea Lamprey
Match: rffl (ring finger and FYVE-like domain containing E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-040426-2274])

HSP 1 Score: 46.9802 bits (110), Expect = 4.185e-6
Identity = 18/47 (38.30%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  729 CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFR 869
            C +CM   +  + L CGH++ C  C + ++ CPICR+ + R V  FR
Sbjct:  340 CKICMDAPIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFR 386          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Nematostella
Match: EDO30381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Y6])

HSP 1 Score: 56.6102 bits (135), Expect = 4.347e-9
Identity = 37/161 (22.98%), Postives = 60/161 (37.27%), Query Frame = 3
Query:  468 CTVEYVAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFI------DIKYNANNTQIS----------LPSRSTVPTNS------------DLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            C  +    ED  ++     +     +GF  E +     +     G  + S  EL        D     +N  I           +PS+S  P  +            + +     C +CM   V ++FLPCGHL  C  C+E + +CP+CR  I   ++ F
Sbjct:  170 CPEDIWEPEDKPVKPQGIYIQNALAMGFSREDIDAACARKLAESGSTFSSLQELTQALLDHEDPSSQPSNCAIHGNSRAFLDNLMPSQSLRPPGNLSLPSTNEKQKLERMQEERLCKICMDAEVGIVFLPCGHLSCCPGCAEGMELCPMCRAPIRETIRTF 330          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Nematostella
Match: EDO44591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV74])

HSP 1 Score: 50.8322 bits (120), Expect = 2.987e-7
Identity = 21/50 (42.00%), Postives = 31/50 (62.00%), Query Frame = 3
Query:  720 NHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFR 869
            +  C VCM   +  + L CGH++ C  CS+ +  CPICR+NI R V+ F+
Sbjct:  253 DESCKVCMDNLIDCVLLECGHMVACINCSKQLAECPICRQNISRIVRVFK 302          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Nematostella
Match: EDO41568 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Y5])

HSP 1 Score: 50.8322 bits (120), Expect = 3.868e-7
Identity = 23/80 (28.75%), Postives = 38/80 (47.50%), Query Frame = 3
Query:  651 ANNTQISLPSRSTVPTNSDLILANHF--------CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
             NN + + P    +  +SD  L            C VCM   +  + +PCGH++ C+ C+ ++  CP+CR  I+   K F
Sbjct:  343 TNNVREAEPPTHDLNASSDYSLQEKLSKLEDGLRCKVCMDEQINAVLIPCGHMVCCEQCAMNLEACPVCRGAIDHVQKAF 422          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Nematostella
Match: EDO43423 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU6])

HSP 1 Score: 49.6766 bits (117), Expect = 1.385e-6
Identity = 16/46 (34.78%), Postives = 29/46 (63.04%), Query Frame = 3
Query:  729 CAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            C +C+     V+ LPCGH+  C  C+  ++ CPICR+ + ++V+ +
Sbjct:  698 CVICLDNRSDVVMLPCGHVCCCSNCAGAVSACPICRQTLSQRVRMY 743          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Medaka
Match: ENSORLT00000012200.2 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 62.003 bits (149), Expect = 2.687e-10
Identity = 33/145 (22.76%), Postives = 62/145 (42.76%), Query Frame = 3
Query:  513 LDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI---------------------KYNANNTQISLPSRSTVPTNSD------LILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            L  ++  +  +GF    V+ ++   +++ G++Y S  +L  D+                       +A + +   P+R      +        +     C VCM + V ++F+PCGHL++C  C+  +  CPICR  I   V+ F
Sbjct:  217 LSPVVQTVLQMGFEDSLVQSLVQTKYLLTGQHYTSVSDLVTDVLQAEEEERQRGANSREPDIRRSSSAGDGRAQTPARERAVKEASPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSVRAF 361          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Medaka
Match: ENSORLT00000039931.1 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 62.003 bits (149), Expect = 2.687e-10
Identity = 33/145 (22.76%), Postives = 62/145 (42.76%), Query Frame = 3
Query:  513 LDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI---------------------KYNANNTQISLPSRSTVPTNSD------LILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            L  ++  +  +GF    V+ ++   +++ G++Y S  +L  D+                       +A + +   P+R      +        +     C VCM + V ++F+PCGHL++C  C+  +  CPICR  I   V+ F
Sbjct:  217 LSPVVQTVLQMGFEDSLVQSLVQTKYLLTGQHYTSVSDLVTDVLQAEEEERQRGANSREPDIRRSSSAGDGRAQTPARERAVKEASPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSVRAF 361          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Medaka
Match: ENSORLT00000034629.1 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 61.6178 bits (148), Expect = 3.274e-10
Identity = 33/145 (22.76%), Postives = 62/145 (42.76%), Query Frame = 3
Query:  513 LDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDI---------------------KYNANNTQISLPSRSTVPTNSD------LILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKF 866
            L  ++  +  +GF    V+ ++   +++ G++Y S  +L  D+                       +A + +   P+R      +        +     C VCM + V ++F+PCGHL++C  C+  +  CPICR  I   V+ F
Sbjct:  253 LSPVVQTVLQMGFEDSLVQSLVQTKYLLTGQHYTSVSDLVTDVLQAEEEERQRGANSREPDIRRSSSAGDGRAQTPARERAVKEASPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRAVIRGSVRAF 397          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Medaka
Match: lrsam1 (leucine rich repeat and sterile alpha motif containing 1 [Source:NCBI gene;Acc:101162496])

HSP 1 Score: 60.8474 bits (146), Expect = 1.039e-9
Identity = 24/64 (37.50%), Postives = 37/64 (57.81%), Query Frame = 3
Query:  675 PSRSTVPTNSDLI--LANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVK 860
            P     P+   L+    +  C VCM    +VIFLPCGH+  C +CS+ +  CP+CR NI ++++
Sbjct:  667 PGTPVTPSGPPLLEGPGSSECVVCMETGSKVIFLPCGHVCCCQVCSDAVQNCPLCRSNISQRIR 730          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Medaka
Match: lrsam1 (leucine rich repeat and sterile alpha motif containing 1 [Source:NCBI gene;Acc:101162496])

HSP 1 Score: 60.4622 bits (145), Expect = 1.062e-9
Identity = 24/64 (37.50%), Postives = 37/64 (57.81%), Query Frame = 3
Query:  675 PSRSTVPTNSDLI--LANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVK 860
            P     P+   L+    +  C VCM    +VIFLPCGH+  C +CS+ +  CP+CR NI ++++
Sbjct:  657 PGTPVTPSGPPLLEGPGSSECVVCMETGSKVIFLPCGHVCCCQVCSDAVQNCPLCRSNISQRIR 720          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Planmine SMEST
Match: SMESG000081055.1 (SMESG000081055.1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.361e-173
Identity = 233/237 (98.31%), Postives = 235/237 (99.16%), Query Frame = 3
Query:  177 MYHFESDILNFDKFEIENREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVEKLQLHLFHRFNCIVLNGNNLPICSQNKNKIEEFCTVEYVAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRFTIPKV 887
            MYHFESDILNFDKFEIENREQTFDNH SIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVEKLQLHLFHR NCIVLNGNNLPICSQNKNKIEEFCTVEY+AQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPT+SDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRFTIPKV
Sbjct:    1 MYHFESDILNFDKFEIENREQTFDNHKSIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVEKLQLHLFHRVNCIVLNGNNLPICSQNKNKIEEFCTVEYIAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTSSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRFTIPKV 237          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 116.701 bits (291), Expect = 3.727e-29
Identity = 66/230 (28.70%), Postives = 122/230 (53.04%), Query Frame = 3
Query:  192 SDILNFDKFEIENREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVEKLQLHLFHRFNCIVLNGNNL--PICSQNKNKIEEFCTVEYVAQEDMIIRTLDS-LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRF 872
            S+ +  DK +I+ RE+TF  + ++K+ A  G + I K  + Y++C  C  ++++LK +E L   + H+ NC   N  +L      + +   E+FC VE+    D I   +++  + ++   G+  + ++          G++++S YEL ++++ +  N      S        +  L    C VC+ + V+V+FLPCGHL  C  CS+ +  CP+CR  I+++VKKF+F
Sbjct:  148 SEKVEIDKLDIDYREKTFAEYPNLKHFALKGFFFIDKISSSYVQCSWCFIELDVLKGIENLGDSIIHKTNCKFNNIEDLLDKNIKEAQRSNEDFCDVEFSLVTDEIEARMETRFVSQLLSAGYDRKKLRATFEHQLKTKGKDFESLYELSLELRKDVQNNAGKRES-----FGQEFALTEFQCVVCLDKPVEVVFLPCGHLKTCVDCSDLMYNCPVCRVRIDKRVKKFKF 372          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 116.701 bits (291), Expect = 4.371e-29
Identity = 66/230 (28.70%), Postives = 122/230 (53.04%), Query Frame = 3
Query:  192 SDILNFDKFEIENREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVEKLQLHLFHRFNCIVLNGNNL--PICSQNKNKIEEFCTVEYVAQEDMIIRTLDS-LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRF 872
            S+ +  DK +I+ RE+TF  + ++K+ A  G + I K  + Y++C  C  ++++LK +E L   + H+ NC   N  +L      + +   E+FC VE+    D I   +++  + ++   G+  + ++          G++++S YEL ++++ +  N      S        +  L    C VC+ + V+V+FLPCGHL  C  CS+ +  CP+CR  I+++VKKF+F
Sbjct:  159 SEKVEIDKLDIDYREKTFAEYPNLKHFALKGFFFIDKISSSYVQCSWCFIELDVLKGIENLGDSIIHKTNCKFNNIEDLLDKNIKEAQRSNEDFCDVEFSLVTDEIEARMETRFVSQLLSAGYDRKKLRATFEHQLKTKGKDFESLYELSLELRKDVQNNAGKRES-----FGQEFALTEFQCVVCLDKPVEVVFLPCGHLKTCVDCSDLMYNCPVCRVRIDKRVKKFKF 383          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 115.546 bits (288), Expect = 8.347e-29
Identity = 65/224 (29.02%), Postives = 119/224 (53.12%), Query Frame = 3
Query:  210 DKFEIENREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVEKLQLHLFHRFNCIVLNGNNL--PICSQNKNKIEEFCTVEYVAQEDMIIRTLDS-LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRF 872
            DK +I+ RE+TF  + ++K+ A  G + I K  + Y++C  C  ++++LK +E L   + H+ NC   N  +L      + +   E+FC VE+    D I   +++  + ++   G+  + ++          G++++S YEL ++++ +  N      S        +  L    C VC+ + V+V+FLPCGHL  C  CS+ +  CP+CR  I+++VKKF+F
Sbjct:  171 DKLDIDYREKTFAEYPNLKHFALKGFFFIDKISSSYVQCSWCFIELDVLKGIENLGDSIIHKTNCKFNNIEDLLDKNIKEAQRSNEDFCDVEFSLVTDEIEARMETRFVSQLLSAGYDRKKLRATFEHQLKTKGKDFESLYELSLELRKDVQNNAGKRES-----FGQEFALTEFQCVVCLDKPVEVVFLPCGHLKTCVDCSDLMYNCPVCRVRIDKRVKKFKF 389          
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 115.161 bits (287), Expect = 9.987e-29
Identity = 65/224 (29.02%), Postives = 119/224 (53.12%), Query Frame = 3
Query:  210 DKFEIENREQTFDNHISIKYLAQHGLYIIQKDGAHYLKCYACKKDVEILKDVEKLQLHLFHRFNCIVLNGNNL--PICSQNKNKIEEFCTVEYVAQEDMIIRTLDS-LMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYELFIDIKYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPCGHLIICDICSEHITICPICRRNIERKVKKFRF 872
            DK +I+ RE+TF  + ++K+ A  G + I K  + Y++C  C  ++++LK +E L   + H+ NC   N  +L      + +   E+FC VE+    D I   +++  + ++   G+  + ++          G++++S YEL ++++ +  N      S        +  L    C VC+ + V+V+FLPCGHL  C  CS+ +  CP+CR  I+++VKKF+F
Sbjct:  182 DKLDIDYREKTFAEYPNLKHFALKGFFFIDKISSSYVQCSWCFIELDVLKGIENLGDSIIHKTNCKFNNIEDLLDKNIKEAQRSNEDFCDVEFSLVTDEIEARMETRFVSQLLSAGYDRKKLRATFEHQLKTKGKDFESLYELSLELRKDVQNNAGKRES-----FGQEFALTEFQCVVCLDKPVEVVFLPCGHLKTCVDCSDLMYNCPVCRVRIDKRVKKFKF 400          
The following BLAST results are available for this feature:
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XIAP1.806e-1124.70X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
XIAP1.806e-1124.70X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
XIAP1.806e-1124.70X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
BIRC38.503e-945.65baculoviral IAP repeat containing 3 [Source:HGNC S... [more]
BIRC38.702e-945.65baculoviral IAP repeat containing 3 [Source:HGNC S... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Diap24.537e-843.75gene:FBgn0015247 transcript:FBtr0087297[more]
Diap24.537e-843.75gene:FBgn0015247 transcript:FBtr0087296[more]
Diap11.142e-633.33gene:FBgn0260635 transcript:FBtr0075500[more]
Diap11.142e-633.33gene:FBgn0260635 transcript:FBtr0333618[more]
Diap11.142e-633.33gene:FBgn0260635 transcript:FBtr0075501[more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrsam14.186e-1043.55leucine rich repeat and sterile alpha motif contai... [more]
lrsam14.202e-1043.55leucine rich repeat and sterile alpha motif contai... [more]
lrsam14.434e-1043.55leucine rich repeat and sterile alpha motif contai... [more]
birc24.615e-930.43baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
birc24.615e-930.43baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fasn3.434e-1230.91fatty acid synthase [Source:Xenbase;Acc:XB-GENE-10... [more]
LRSAM14.050e-940.91leucine rich repeat and sterile alpha motif contai... [more]
LRSAM14.169e-940.91leucine rich repeat and sterile alpha motif contai... [more]
arsa.17.218e-927.56arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GEN... [more]
arsa.18.791e-927.56arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Birc31.358e-945.83baculoviral IAP repeat-containing 3 [Source:MGI Sy... [more]
Birc22.009e-947.83baculoviral IAP repeat-containing 2 [Source:MGI Sy... [more]
Birc22.009e-947.83baculoviral IAP repeat-containing 2 [Source:MGI Sy... [more]
Xiap4.551e-923.08X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Xiap4.551e-923.08X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5D8Q0|XIAP_XENLA3.231e-1231.82E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis... [more]
sp|Q5BKL8|XIAP_XENTR1.819e-1130.91E3 ubiquitin-protein ligase XIAP OS=Xenopus tropic... [more]
sp|P98170|XIAP_HUMAN8.673e-1124.70E3 ubiquitin-protein ligase XIAP OS=Homo sapiens O... [more]
sp|Q8JHV9|BIR7A_XENLA3.368e-1028.13Baculoviral IAP repeat-containing protein 7-A OS=X... [more]
sp|Q96P09|BIRC8_HUMAN3.620e-1027.64Baculoviral IAP repeat-containing protein 8 OS=Hom... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U3IU601.033e-1025.93X-linked inhibitor of apoptosis OS=Anas platyrhync... [more]
A0A452J1441.415e-1026.27X-linked inhibitor of apoptosis OS=Gopherus agassi... [more]
Q6J3R01.428e-1029.75X-linked inhibitor of apotosis protein (Fragment) ... [more]
S9XQG91.455e-1025.00Baculoviral IAP repeat-containing protein 4 OS=Cam... [more]
A0A226P7S51.937e-1029.17RING-type domain-containing protein OS=Colinus vir... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc71.131e-1124.24baculoviral IAP repeat-containing protein 7 [Sourc... [more]
lrsam12.780e-940.32leucine rich repeat and sterile alpha motif contai... [more]
birc72.808e-922.28baculoviral IAP repeat-containing protein 7 [Sourc... [more]
birc26.035e-930.43baculoviral IAP repeat containing 2 [Source:NCBI g... [more]
birc22.410e-843.48baculoviral IAP repeat containing 2 [Source:NCBI g... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
birc26.334e-1045.83baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
ENSPMAT00000009710.11.578e-631.48pep scaffold:Pmarinus_7.0:GL484213:64:2160:1 gene:... [more]
rffl4.185e-638.30ring finger and FYVE-like domain containing E3 ubi... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO303814.347e-922.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445912.987e-742.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415683.868e-728.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434231.385e-634.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000012200.22.687e-1022.76baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
ENSORLT00000039931.12.687e-1022.76baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
ENSORLT00000034629.13.274e-1022.76baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
lrsam11.039e-937.50leucine rich repeat and sterile alpha motif contai... [more]
lrsam11.062e-937.50leucine rich repeat and sterile alpha motif contai... [more]
back to top
BLAST of baculoviral IAP repeat-containing protein 3 isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081055.11.361e-17398.31SMESG000081055.1[more]
SMESG000023072.13.727e-2928.70SMESG000023072.1[more]
SMESG000023072.14.371e-2928.70SMESG000023072.1[more]
SMESG000023072.18.347e-2929.02SMESG000023072.1[more]
SMESG000023072.19.987e-2929.02SMESG000023072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029680 ID=SMED30029680|Name=baculoviral IAP repeat-containing protein 3 isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=1061bp
TTTTAAAATACTTCAAGATTACTAAACGAATTGTGAATGTGTAAAAGTCA
ATCAACGAAAAACATCAGTTTTTCATTAATTAGCATCAATAAACGATTAT
ATTTTAACACAATTTGTAATTTTCAGTTTTTGAGCCGTATAGATCAAACT
TGGAGCTATTCTTGAAGATCATTATAATGTATCATTTTGAATCCGATATT
TTAAATTTCGATAAATTCGAAATAGAAAATCGAGAGCAAACATTTGACAA
TCATATATCAATAAAATACCTAGCTCAACACGGATTGTATATTATCCAGA
AAGATGGCGCTCATTACCTCAAATGTTATGCATGCAAGAAAGATGTTGAA
ATTTTAAAGGATGTTGAAAAGTTGCAATTACATTTATTTCATCGTTTTAA
TTGTATTGTTTTAAACGGAAATAATTTGCCAATTTGCTCACAAAATAAAA
ACAAAATCGAGGAATTCTGTACTGTAGAATATGTTGCACAAGAAGATATG
ATAATTAGAACTTTAGATTCGTTGATGCCTAAGATTGCCTATCTCGGTTT
TCCAACTGAATTTGTTAAGCAAATTCTTACAAAACATTGGGTCGTGTTCG
GTCGAAATTATGACTCCTTTTATGAGTTATTTATTGATATTAAATACAAC
GCTAATAACACTCAAATCAGCCTTCCTTCAAGATCTACTGTTCCGACAAA
TTCAGATTTGATTTTGGCAAACCATTTTTGTGCAGTTTGCATGTTTCGAA
ATGTTCAAGTTATATTTCTTCCATGTGGCCATTTGATAATATGCGATATC
TGTTCCGAACATATTACGATATGTCCTATTTGCAGAAGAAACATCGAAAG
AAAAGTTAAAAAATTTAGATTTACGATACCAAAAGTTTAAGTGTTAAGTC
AGTCTTATCTGATTTGCTCACATAAAATTTAAACAAATTGTAATTATTGT
CAATTGTGAGTTGTATAAAGTTGAAATTATAAACATAGCGAATGAGATGA
GTGAGTGACGGTTCAAGATTATTAAATTATGATTTCCGTGGGAGAAACGT
CAAATTATTTG
back to top

protein sequence of SMED30029680-orf-1

>SMED30029680-orf-1 ID=SMED30029680-orf-1|Name=SMED30029680-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=238bp
MYHFESDILNFDKFEIENREQTFDNHISIKYLAQHGLYIIQKDGAHYLKC
YACKKDVEILKDVEKLQLHLFHRFNCIVLNGNNLPICSQNKNKIEEFCTV
EYVAQEDMIIRTLDSLMPKIAYLGFPTEFVKQILTKHWVVFGRNYDSFYE
LFIDIKYNANNTQISLPSRSTVPTNSDLILANHFCAVCMFRNVQVIFLPC
GHLIICDICSEHITICPICRRNIERKVKKFRFTIPKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR001370BIR_rpt
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 183..225
e-value: 8.7E-12
score: 44.7
NoneNo IPR availablePANTHERPTHR10044:SF139DEATH-ASSOCIATED INHIBITOR OF APOPTOSIS 2coord: 181..230
NoneNo IPR availablePANTHERPTHR10044INHIBITOR OF APOPTOSIScoord: 181..230
NoneNo IPR availableSUPERFAMILYSSF57924Inhibitor of apoptosis (IAP) repeatcoord: 10..206
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 166..230
e-value: 3.4E-14
score: 54.0
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 185..220
score: 10.468