Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30029677
Length (bp)3701
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30029677) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30029677) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30029677) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30029677) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029677

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029677SMESG000042292.1 SmedASXL_007451SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029677SMESG000042292.1 SmedASXL_007450SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029677SMESG000042292.1 dd_Smed_v6_19236_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 236.498 bits (602), Expect = 3.039e-63
Identity = 207/730 (28.36%), Postives = 353/730 (48.36%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   D D+  N  +   +LN              F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDN----------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKSLHTLVL 769          

HSP 2 Score: 113.235 bits (282), Expect = 1.352e-24
Identity = 107/412 (25.97%), Postives = 182/412 (44.17%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + F+  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +  I  + + D+        VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI--LNDNDNFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHAC2 (protocadherin alpha subfamily C, 2 [Source:HGNC Symbol;Acc:HGNC:8677])

HSP 1 Score: 233.802 bits (595), Expect = 5.376e-63
Identity = 184/691 (26.63%), Postives = 328/691 (47.47%), Query Frame = 2
Query:  242 EISFKLVENCSIGTIVGNIN--LSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI---QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSS-GADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDN-----FPKFSLASKRFE-VEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVD 2239
            ++ + + E  + G +VGN+   L  +L       L++              N  G       +++ +SG L     IDRE +C+    +R      L++++ N +    V +EI+DINDN+P F + +  + +SES    ++ ++E   D D        Y +   +H      P   +   L+L+L + +D E    + +VL A D G P+  G   + + + + ND SP F +S Y   + ED+  G +V+   A D D+G  GEL YS SS  +D  ++ FSID  TG++ +I    + + + ++  ++ATD+ P P+ G   + + +VDVN+++P +++  + S +      +T++            A ++V+D D G N + S  +++ +    LN F           + Y L+     D E    +++ +   D G PQ +++  +++ I D N+  P+F ++ Y IYI+EN  P   + TV+  D D          L +  I  L  P +++ SI+  SG++      DYEK ++    V A ++G    +S+   +VYV+D+ND+     +P  + +S  FE V       Y + K+ A D DS  N+ L Y+L  T+        +  LF++   TG I +   +  E    +++TV V D+G P LS      + VVD
Sbjct:   43 QLRYSVPEEQAPGALVGNVARALGLELRRLGPGCLRI--------------NHLGAPSPRYLELDLTSGALFVNERIDREALCE----QRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAPEVVLTDLYSPVPENATPNTIV------------AVLSVNDQDSGPNRKVSLGLEATL-PFRLNGFG----------NSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGL--PVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTANVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTS--------DLDLFKVELHTGEIRTTRKMGDESGSTFNLTVVVRDNGEPSLSASVAITVAVVD 682          

HSP 2 Score: 127.487 bits (319), Expect = 5.132e-29
Identity = 145/583 (24.87%), Postives = 251/583 (43.05%), Query Frame = 2
Query:  878 TVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQ-----ISIIKRFN----QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIY--IKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIV---LDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEEN-LKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLF-ELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISL---QNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEI-TFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDR 2560
             V + I + ND SP F R NY   ++E    G       A D D G      Y  S       ++F +D K  Q     + ++ R      Q       + A D       G   I + V+D N++SP        +F  S ++    +++ E++     +  +  SD D+G N      + S  +      F I       + S  ++      D EE   + + +   D G    +   K+ + I D N+  P  +  L ++Y  + EN +P T V  + V D+D   +R + L    +  F ++  G   T +V   LD E++   +  V A + GI   TS   + V + D+NDN P F   S    ++EN L G   +  + A D D + N+++ Y LL    E   + +    +  +N  +G +Y+  + DYE+   + +TV+  D G PPLS+     ++VVDMND+ P   YP   ++     +         ++T+V A+D+DS +   + Y L   +  D+F++   TGEI T +++  + G  T  L  +  ++     S S+ + +   DR
Sbjct:  133 AVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSP-----SEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSP--------AFDQSTYR----VQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSI-------DASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAP--EVVLTDLYSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGLEATLPFRLNGFGNSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVL-LCTVQATDPDEKENAEVTYSLL----EREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTANVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFKVELHTGEIRTTRKMGDESGS-TFNLTVVVRDNGEPSLSASVAITVAVVDR 683          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 236.113 bits (601), Expect = 1.029e-62
Identity = 207/730 (28.36%), Postives = 353/730 (48.36%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   D D+  N  +   +LN              F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDN----------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKSLHTLVL 769          

HSP 2 Score: 112.079 bits (279), Expect = 3.493e-24
Identity = 107/412 (25.97%), Postives = 182/412 (44.17%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + F+  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +  I  + + D+        VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI--LNDNDNFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 235.728 bits (600), Expect = 1.150e-62
Identity = 207/730 (28.36%), Postives = 353/730 (48.36%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   D D+  N  +   +LN              F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDN----------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKSLHTLVL 769          

HSP 2 Score: 112.079 bits (279), Expect = 3.355e-24
Identity = 107/412 (25.97%), Postives = 182/412 (44.17%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + F+  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +  I  + + D+        VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI--LNDNDNFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 235.728 bits (600), Expect = 1.251e-62
Identity = 207/730 (28.36%), Postives = 353/730 (48.36%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   D D+  N  +   +LN              F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDN----------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKSLHTLVL 769          

HSP 2 Score: 112.464 bits (280), Expect = 3.096e-24
Identity = 107/412 (25.97%), Postives = 182/412 (44.17%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + F+  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +  I  + + D+        VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI--LNDNDNFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 147.517 bits (371), Expect = 3.185e-35
Identity = 164/691 (23.73%), Postives = 301/691 (43.56%), Query Frame = 2
Query:  410 KNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERS--VDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP-TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQS----IINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIK---KLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND-----IFEINHLTGEI 2437
            +NLF ++  SG++     +DRE      L K     T  + V         V + ++D+ DN+P F + S    + E + + + +      DLDS +   I+Y +   +  N    L+ N    +++ +  +D E     ++ +IA D G P       V I + + ND +P+F   +Y   I E+  I  ++ + KA D+D G  G++ YS +S +       +ID  TG++++ +R +   +     I+A D A   L     + ++V+D+N+H+P ++                +I + EN  I  ++  +   D D G N      ++     II++D         +I+T      KLL     D E T  +SL +   D G P  +  T I + +KD N+  PTFD+  Y + I E     + + T+K  D D  Q     + +     FSI D G     + +  E  +   K+   + A ++G         V+V++ DVN + P F+      ++ E+    Y +  + A D D   N+++ Y + ++           + F ++P++G I  +  LD E+   +S+ V   D   PPL+   +  + + D+NDN P +   +       IS      +   +V A+D D     +V YFL+  +      +F ++  +G +
Sbjct:  210 QNLFTLDTMSGEIRLAKSMDREV-----LDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNL---LAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG--IGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAA------------QKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDS-------GLIKTT-----KLL-----DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-----------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSY---AATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTL 844          

HSP 2 Score: 142.895 bits (359), Expect = 6.567e-34
Identity = 182/744 (24.46%), Postives = 322/744 (43.28%), Query Frame = 2
Query:  281 TIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI---IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTV-IEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDL------TDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTT---GI--IYSNVTLDYE-ECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWK----YPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKR 2449
            TI+ NI + A   V + V+      EDF  +  + ++    S      I+ S+G++     ID +    +  + R ++     + S      + + I +IDIND+AP        I+L E+  +  ++     +D DS     I+Y ++        F + ++   +   + +D E    Y + + A D G PSL  + T+ + + + ND +P F +  Y   I+E+   G  +++ KA D D+ +  ++ Y       EV     I  +   +S+   +KR  Q  K +  I ATD+    L GR  + + + DVN+ +P              F +H   +++ E++ I + +  +   D D+G+N+R       + + D   +F+I       + S   +      D E+   FS+ +   DH  P  +  T+IE+ + D N+  P F  + Y   I E+    T+   V   D D+  + I+D       + P    F +D  SGT+     LD E+   +   + A +RG  S ++++ +++ + DVNDN P F   S    + EN      +G I A D D   N+ +++ +            + KLF++       G+  I +    DYE + + +   ++   SG+  LS+     IHV D+NDN P  K      N  DNV     Q  R   +  + A D D +    + YFL   ND+ E    TG+I  K+
Sbjct:  383 TILENITIPA---VIATVK---ATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNS-PITAVIRAKDGAQPALSST-----VPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELKR--QDHKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APY-------------FNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI------VYSIDSSQFFRI-------DPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFG--------GADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA-SSGQ--LSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNV-----QMARQ--IGFIPAFDPDQNA--TLEYFLE-ENDLIEAEKYTGKILVKQ 1056          

HSP 3 Score: 137.117 bits (344), Expect = 4.899e-32
Identity = 167/676 (24.70%), Postives = 296/676 (43.79%), Query Frame = 2
Query:  263 ENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLM-----WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKAT--DKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWK 2266
            E+  IGT V        L VF+     L++ E+ +  +SL       + KNL  IN  SG + T + +DRET   L+LI+       L +++ +K          V I ++D+NDNAP F   S ++++ E+  + + I   +  D D      + Y +          ++  +  ++ L   +D +N      V+ A D  +P+L     + IN+ + ND +P    +     + E+  IGE V    A D+D G  G ++YS     D     F ID+ +G I   K  ++ T  ++S+K T  D     L   T I + + D+N+++P             K  N T+ E      +P     IT+  +D  E+ +    I   I +     F I+++   ++ +I  +  +      + +   + I   D G  Q   +  + + I D N   P F+ + + + I E++     V T+K  D D   +  +  +   S +F ID  SG IS    LD E     S  V A +       +S ++ V + D+NDN P+F+ +S    + E++       ++ A D D   N  ++Y+L  ++S     S + +LF L+ T+G +  +  LD E+  +  + +   D G P LS      + + D+NDN P ++
Sbjct:  281 EDAPIGTTV--------LSVFAR---DLDSGENGEIEYSLGEG----NGKNLLAINAKSGVIQTAAPLDRET---LSLIR-------LDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIG-GLTIDYSTGEVTLRERIDAKNSP-ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPT---------FDKKEYNVTISE-----EMPRGSQIITLKAVDNDEDQK----ITYRIEEADREVFSILDI--GDQGAILSVSGELKRQDHKVR---VEISATDQGGLQGRCV--VNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSS-----SPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFE 893          

HSP 4 Score: 129.798 bits (325), Expect = 6.876e-30
Identity = 121/452 (26.77%), Postives = 200/452 (44.25%), Query Frame = 2
Query:  704 QPIQYRI---QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYL 2041
            QP+ Y +   Q     N  F+L     ++ L +S+D E    + + + A +   P++  + TV++++ +  D SP+F + +Y   I ED  IG  VLS  A D D G+ GE+EYS   G    K   +I+ K+G I      ++ T    +  + A+DK          + + VVDVN+++PV      DS+ ++  +N T         IP  +A +  +D D G N +    + S      L        +   ER           DA+ +   ++ I   D  +P  S+   + I++ D N++ PT       I ++EN +    V  V   D D   + I+  +  GS  F ID DSG I T  +LD E   + S  V A + G  S  +S  ++V + D+NDN P F        + E +    +I  + A D D +   K+ Y +
Sbjct:  195 QPLYYSMVAPQDSRSQNL-FTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNG--KNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFAS---DSYNVTILENIT---------IPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRER----------IDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED--QKITYRI 618          

HSP 5 Score: 104.375 bits (259), Expect = 4.714e-22
Identity = 93/363 (25.62%), Postives = 170/363 (46.83%), Query Frame = 2
Query: 1487 KSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT---DPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIW----KYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRL--NIKPGQLTLQLQAIDANSKNIHTSQSLIVYI 2545
            KS D E      L +  Y+  +P  SA T + +H+ D  +  P F+++ Y   I+E+    T V +V   D D  ++  ++ +     G    +I+  SG I T   LD E +  +  +V+A ++G     S+A V + V+DVNDN P F+  S    + EN+     I  + A DED   N K++Y + +++              ++ +TG +     +D +   + ++ ++  D  +P LS+     I+V+D+ND+ P      K   + +NV       I + V  RV A+D DS    ++ Y +    D F I+  +G I   +L       + +L++ A D  + +++TS ++ V +
Sbjct:  226 KSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG--------LTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVA------IGEEV-GRVYAIDEDSGPNGIIKYSMEGSED-FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVL 571          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 141.739 bits (356), Expect = 1.738e-33
Identity = 182/744 (24.46%), Postives = 322/744 (43.28%), Query Frame = 2
Query:  281 TIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI---IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTV-IEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDL------TDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTT---GI--IYSNVTLDYE-ECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWK----YPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKR 2449
            TI+ NI + A   V + V+      EDF  +  + ++    S      I+ S+G++     ID +    +  + R ++     + S      + + I +IDIND+AP        I+L E+  +  ++     +D DS     I+Y ++        F + ++   +   + +D E    Y + + A D G PSL  + T+ + + + ND +P F +  Y   I+E+   G  +++ KA D D+ +  ++ Y       EV     I  +   +S+   +KR  Q  K +  I ATD+    L GR  + + + DVN+ +P              F +H   +++ E++ I + +  +   D D+G+N+R       + + D   +F+I       + S   +      D E+   FS+ +   DH  P  +  T+IE+ + D N+  P F  + Y   I E+    T+   V   D D+  + I+D       + P    F +D  SGT+     LD E+   +   + A +RG  S ++++ +++ + DVNDN P F   S    + EN      +G I A D D   N+ +++ +            + KLF++       G+  I +    DYE + + +   ++   SG+  LS+     IHV D+NDN P  K      N  DNV     Q  R   +  + A D D +    + YFL   ND+ E    TG+I  K+
Sbjct:   24 TILENITIPA---VIATVK---ATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNS-PITAVIRAKDGAQPALSST-----VPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELKR--QDHKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APY-------------FNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI------VYSIDSSQFFRI-------DPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFG--------GADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA-SSGQ--LSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNV-----QMARQ--IGFIPAFDPDQNA--TLEYFLE-ENDLIEAEKYTGKILVKQ 697          

HSP 2 Score: 123.635 bits (309), Expect = 4.845e-28
Identity = 128/532 (24.06%), Postives = 234/532 (43.98%), Query Frame = 2
Query:  881 VIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP-TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQS----IINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIK---KLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND-----IFEINHLTGEI 2437
            V I + + ND +P+F   +Y   I E+  I  ++ + KA D+D G  G++ YS +S +       +ID  TG++++ +R +   +     I+A D A   L     + ++V+D+N+H+P ++                +I + EN  I  ++  +   D D G N      ++     II++D         +I+T      KLL     D E T  +SL +   D G P  +  T I + +KD N+  PTFD+  Y + I E     + + T+K  D D  Q     + +     FSI D G     + +  E  +   K+   + A ++G         V+V++ DVN + P F+      ++ E+    Y +  + A D D   N+++ Y + ++           + F ++P++G I  +  LD E+   +S+ V   D   PPL+   +  + + D+NDN P +   +       IS      +   +V A+D D     +V YFL+  +      +F ++  +G +
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG--IGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAA------------QKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDS-------GLIKTT-----KLL-----DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-----------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSY---AATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTL 485          

HSP 3 Score: 122.094 bits (305), Expect = 1.519e-27
Identity = 138/571 (24.17%), Postives = 250/571 (43.78%), Query Frame = 2
Query:  563 VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKAT--DKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWK 2266
            V I ++D+NDNAP F   S ++++ E+  + + I   +  D D      + Y +          ++  +  ++ L   +D +N      V+ A D  +P+L     + IN+ + ND +P    +     + E+  IGE V    A D+D G  G ++YS     D     F ID+ +G I   K  ++ T  ++S+K T  D     L   T I + + D+N+++P             K  N T+ E      +P     IT+  +D  E+ +    I   I +     F I+++   ++ +I  +  +      + +   + I   D G  Q   +  + + I D N   P F+ + + + I E++     V T+K  D D   +  +  +   S +F ID  SG IS    LD E     S  V A +       +S ++ V + D+NDN P+F+ +S    + E++       ++ A D D   N  ++Y+L  ++S     S + +LF L+ T+G +  +  LD E+  +  + +   D G P LS      + + D+NDN P ++
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIG-GLTIDYSTGEVTLRERIDAKNSP-ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPT---------FDKKEYNVTISE-----EMPRGSQIITLKAVDNDEDQK----ITYRIEEADREVFSILDI--GDQGAILSVSGELKRQDHKVR---VEISATDQGGLQGRCV--VNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSS-----SPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFE 534          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 130.183 bits (326), Expect = 6.627e-30
Identity = 156/656 (23.78%), Postives = 282/656 (42.99%), Query Frame = 2
Query:  371 HHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNY-TAIINEDTQIGEIVLSPKAFDKD-DGKFGELEYSFSS-GADEVKKYFSIDKKTGQISIIKRFNQ--PT---KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQ---LAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAE--ETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSR---ILDLTDPGSTWFSIDDS-------GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVV--DMNDNGP 2257
            H+ +     G   K+ F+I+  +G++    + DRE +    L     + ++  +   N      V ++I+  D+NDNAP+F +      + ES      +   +  DLD  +   ++Y +        PF +  +   + ++  +D+E    Y +VLIA D G+ +   N  V I+I + ND +P F +  Y T +I ED  I +++ +  A D D D K   + Y     GADEV   F I K +G I ++K  ++  P     + F ++A D   N L+G   + ++V D+N++SP+                  +    E NR P     + F+ V   D  + +  + +I+  I ++ L   + +  I+ N   I+ +   +S D E    + F + +   D G P       + I + D N+  P F++  YE  ++E       V +   +D D           L++    ++   D        G +  K  LDYE + +     L I        + A V V ++D ND+ P    A++   V E++     IG+  A D D+   ++            N +S  ++ F ++   G +    TLD E+  +Y++ ++  D+     +NI R  + V   D+NDNGP
Sbjct: 1256 HYRIVGEANGEETKH-FRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV---FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF--------------PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAM---RSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRI---------NRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNS----NNIGRQMVAVYLQDVNDNGP 1870          

HSP 2 Score: 102.834 bits (255), Expect = 1.201e-21
Identity = 148/574 (25.78%), Postives = 249/574 (43.38%), Query Frame = 2
Query:  905 NDESPMFYRSNYTAIINEDTQIGEIVLSPKA--FDK-DDGKF-GELEYSFSSGADEVK-KYFSIDKKTGQISIIK--RFNQPTKFKF-SIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENE------YQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST-----WFSIDD-SGTISTKIVLDYEKIKK----LSFNVLAINRG------IKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYE-----IGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSN--VTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL----------HNHNDIFE-INHLTGEITFKRLNIKPGQLTLQ 2482
            ++  P F +  Y   ++ED  +   V+  KA  F   +DG+  G + YS      E + K+F ID  TG I + +   F+ P   K   +K T +  N       + + + DVN++ P     P+              +V E+  +   +  +T  D D G+NSR +  +      D+ N+      I +N     K+  D     E    +  N+   DHGEP + + + + IHI+ EN       + PT   + Y  ++ E+    T V  ++  D D  +     +   G +      FSID+ +G +  +  +    + +    ++  V+  + G       K+ TS A + + + DVN+N P+F   +K  ++ + ++G Y+     I K+ A D+DS  N  + Y L  T SE      + K F ++  TG++  +  V  D E      +TVK  D G  PL    +F + VVD+NDN P ++ P+   +V     + +  SV+T V A DND+     + Y L           N  D FE +N  +GEIT     IKP  +  Q
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN-RESHVDLTIRIDDVNDNVPT-FTRPL-----------YTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV------DNHNF-----SINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM-IHIRTENTNDESAVFLPT---SQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSE------SRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSR--FEAVGTSVIT-VFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITL----IKPIPMKTQ 1056          

HSP 3 Score: 102.064 bits (253), Expect = 2.379e-21
Identity = 154/618 (24.92%), Postives = 256/618 (41.42%), Query Frame = 2
Query:  800 DYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSF---SSGADEVK---KYFS-IDKKTGQISIIKRFNQPT-KFKFSIKATDKA-PNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSII------NKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSP-----ETNVK---TVKVYDRDL------TQSRILDLTDPGST-WFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSS-------ARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-KYNVVHYFLHNH--NDIFEINHLTGEITF-KRLNIKP----GQLTLQLQAIDANSKNI 2515
            D E +    V + A D G   L G     + + + ND SP F R +Y   ++    +G  V++  AFD D     E+ YS    ++  +E +    +F  +++++G+I++IK     T KF F++ A D   P  L     + L+V+D    +P    +P     I      TV E  E N++  +   ++  D      SR S  I  +       NK   + F+  N  E N     +++  +  D E+   ++L +   D      S  T + + ++D N+  P F  +L+   I E  +P     +TN K   TVK  D D          RI+   +   T  F ID+ +G I      D EKI      V A +R + +   +        +V + + DVNDN P F        V+E+    +++  I A D D   +S L Y+L+               F +   +G I+    LD+E  D Y + +   D      +N+   +IH+ D+NDN P ++       V+   +   +  VL  V A D D D K + + Y L     +++F I   +G I   K L+  P          +QAID +   +
Sbjct:  938 DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGI------TVDENVELNKVILRCRAVSSGD------SRNSDVIYKLTASGGPGNKAE-SKFRQFNKFE-NGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGG-------GRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNV---YIHIEDVNDNAPQFEQQKYATTVIEEDVDIPK--VLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGL 1526          

HSP 4 Score: 91.6633 bits (226), Expect = 3.708e-18
Identity = 176/709 (24.82%), Postives = 282/709 (39.77%), Query Frame = 2
Query:  542 NKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-LKLILERSVDYENKKH--YQVVLIACDNGKP-SLCGNQTVIINITNENDESPMFY-RSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSF---SSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATD--KAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFK-----IINVIETNERS------IYKLLADKS----------------------FDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD------LTQSRILDLTDPGSTWFSID-------DSGTISTKIVLDYEKIKKLSFNVLAINRGI-KSFTSSARVSVYVIDVNDNFPKFSLA---SKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNP-TTGIIYSNVT----LDYEECDLYSITVKVID-SGRPPLSNIQRFFIHVVDMNDNGPIWK---YPNIHDNVM--NISLQNIRDSVLTRVRAVDNDSDK-YNVVHYFL-----HNHNDIFEINHLTGEI 2437
            N+   + + I I D+NDN P F +   +  + E   +   I     VD D+     I Y +      N  FS++ N  +   +    D  N++H  Y+  + A D+G+P SL  +  + I   N NDES +F   S YTA + ED Q G  V+  +A D D     E+ YSF   +  + +    FSID+ TG +          K +  + A D  +A NP+                +  ++V    S  +   + HT           +    I + D++  +     C   S I K     +K     I+ V  T++ S      +Y L   +S                      FD E      + +   D G+       +  + + D N+  P F++  YE  +    +  T+V TV  +D D      +T S  +D T        +D        SG I T I     K +K  FNV+A + GI ++  SSA+V++ V+D     PK+  +        V+EN++    I +  A       NS + Y L  T S         K  + N    G  +  V     LDYE+ + Y++T+   D + R  +++ + F + V D+ND  P +    +    D  M  N  L+      +  V+A+D DSD   N VHY +           F I+ LTGEI
Sbjct:  621 NRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD-----NHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQKMNLFSIDEHTGLV----------KLRHGVSAADLAEAENPI----------------NLTVIVQDDGSCCVYPSKTHT----------SYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEI-TLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKL--TASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSR--VASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEI 1280          

HSP 5 Score: 84.7297 bits (208), Expect = 3.743e-16
Identity = 144/601 (23.96%), Postives = 242/601 (40.27%), Query Frame = 2
Query:  680 VDLDSDQFQ-PIQYRI--QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCG-------NQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHL----NYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDP------------------GSTWFSID-DSGTISTKIVLDYEKIKKLSF--NVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEEC---DLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNI-RDSVLTRVRAVDNDS 2359
            +D DSD  Q  + YRI  +   +    F + +   ++      D E    Y + + A D    +L G       N  V I I + ND +P F    Y   + E    G  V++ KA D D  K   L Y    GA   +  F +   +G I + +   F    ++   + A+D   N     T +++H+ DVN+++P         F   K+   TVIE  E+  IP  L  +  +D DQ E S    +       D +     Y   I +++  +R     +   +F  +        ++ Y            ++++++D N+  P F + L+  YI+EN  P   + +  VY  D+ Q+R  D  DP                  G + F ID ++G I     LD E   +  F   V A +RG+ S    A V++ V D+NDN P F        VEE       +    AFD D E  +K N +    + E++   +         + G++     LDYE+    D + + ++V D      + +    + +VD ND+      P+IH    +   +++ R + + R  A D D+
Sbjct: 1244 IDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLI-GAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHN---ATTNVYIHIEDVNDNAP--------QFEQQKYAT-TVIE--EDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGY----------ADVQVNVRDINDNSPIFPERLFG-YIEENREP---IHSDGVYFMDV-QAR--DFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEE--AKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVH---VALVDRNDHA-----PHIHGATEHRVREDVPRGTSIGRYTATDRDA 1800          

HSP 6 Score: 81.2629 bits (199), Expect = 4.740e-15
Identity = 152/717 (21.20%), Postives = 297/717 (41.42%), Query Frame = 2
Query:  566 NIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI--------QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKP-SLCGNQTVIINITNENDESPMFYRS---NYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKY---------FSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDH-------GEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSID---DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEV-EENLKGFYEIGKIHAFDEDS-EINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEE---CDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIW-----------KYPNIHDNV--MNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRS 2563
            ++E++DINDN+P F + S   S+S    V + +      D D+     I Y +        +H +  +F   +++   ++ L + +  + +K +   +IA DNG P +L  +  V +N+ ++  ++P +  S        ++E+ ++ +++L  +A    D +  ++ Y  ++      K          F    +  ++ I++   + Q   +  ++ ATD        +T++ + V DVN+  P   V+     +  +   +  +E +    I    A  T SD   G  +     I    N +   +F+I       +    ++  ++ FD E+   + L +   D            N    K++I I D N+  P+F++  Y   +KE+     +V T+K +D D   +    L   G          DSGTI  K  LD+E   +    VL  + G  + T++  V +++ DVNDN P+F        V EE++     +  +HA D D  E +S++ Y L    +        +++F +   +G I     LD +       ++  V+ ID     L       ++V D+NDN PI+           + P   D V  M++  ++  D         +N + +Y +V   L N   +F I+  TG+I               ++++D   + I + +  I+ +  +DR 
Sbjct:  966 SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSD---GPQNEVHYRIVGEANGEETKHFRI-------DELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHL-VLIASDGRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGA--------DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPT------TENANIEYGIVRNKLINGESVFRIDQNTGKI-------------FAMRSLD---REISSEREFIIEVRANDRG 1637          

HSP 7 Score: 77.7962 bits (190), Expect = 5.111e-14
Identity = 125/560 (22.32%), Postives = 226/560 (40.36%), Query Frame = 2
Query:  353 SEDFKEHHSLSHNRFGRSLKNL-FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDL----------DSDQFQP---IQYRIQHLHKSNFPFSLSQNPLKLILERSVDYE---NKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQI---GEIVLSPKAFDKDDG-------KFGELEYSFSSGADEVKKYFSIDKKTGQI----SIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKY---FSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQS---RILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPK 1921
            + D  +H +L ++  G     + F +   SG +     +D E   Q +L+       I      N    +Y++IE  D+NDNAP F Q   + ++           +EE VD+          D+DQ +    I YR++    ++  F + +    + L +++D +       +  V+ A D+    L G   V +N+ + ND SP+F    +  I      I   G   +  +A D DD        ++G +     +G    +  F ID+ TG+I    S+ +  +   +F   ++A D+      G   + + V D+N+++P              F   T  E S     P   A ++ S  D  E ++ +     +   +  +YF +    ++ + S+  L   +  D E+      F L I   D    ++ A   + + + D N++ P       E  ++E+    T++      DRD   +   RI   +DP    F+ID  GT+     LD E I   +  + A +    +      V+VY+ DVNDN P+
Sbjct: 1359 AHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLV------LIASDGRHNATTNVYIHIE--DVNDNAPQFEQQKYATTV-----------IEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEG-QGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLING----ESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP--------------FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQL--SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHI-HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDP-KRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDN--SNNIGRQMVAVYLQDVNDNGPE 1871          

HSP 8 Score: 73.559 bits (179), Expect = 9.371e-13
Identity = 109/475 (22.95%), Postives = 182/475 (38.32%), Query Frame = 2
Query:  398 GRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEI--IDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYR-----------IQH------LHKSNFPFSLSQNPLKLILERSVDYE--NKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKD-DGKFGELEYSFSSGADEVKKYFSIDKKTGQISI-IKRFNQP---------TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIP--FQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKT--VKVYDRDLTQ 1714
            G+    +F+I   SG +  +  +DR+    +     + N  +  I      +  Y ++++   DINDN+P F +                    EP+  D   F  +Q R           I++      L      F + QN  K+   RS+D E  +++ + + + A D G PS  G   V I +T+ ND +P F ++ Y   + E   IG  V+S  AFD D + K     Y  S  +D    Y + DK + Q S+ + R  QP           F   I+ +D   +       + + +VD N+H+P I               H   E      +P    +   T +D D G+ +R   + QS    D    F I             L    + D E+   ++L I  YD+    N     + ++++D N+  P           +ENT P   + T  ++  DRD  +
Sbjct: 1479 GQGADEVFRIGKYSGTIELVKALDRDPPAGVP----SWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEEN----------REPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYF--YVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD---AEAAVHVALVDRNDHAPHI---------------HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQS----DPKRQFTI--------DQDGTLRVAHTLDREDIAVYNLIIEAYDNS--NNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENT-PVNQLGTCEIRATDRDTAE 1904          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 130.183 bits (326), Expect = 6.627e-30
Identity = 156/656 (23.78%), Postives = 282/656 (42.99%), Query Frame = 2
Query:  371 HHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNY-TAIINEDTQIGEIVLSPKAFDKD-DGKFGELEYSFSS-GADEVKKYFSIDKKTGQISIIKRFNQ--PT---KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQ---LAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAE--ETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSR---ILDLTDPGSTWFSIDDS-------GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVV--DMNDNGP 2257
            H+ +     G   K+ F+I+  +G++    + DRE +    L     + ++  +   N      V ++I+  D+NDNAP+F +      + ES      +   +  DLD  +   ++Y +        PF +  +   + ++  +D+E    Y +VLIA D G+ +   N  V I+I + ND +P F +  Y T +I ED  I +++ +  A D D D K   + Y     GADEV   F I K +G I ++K  ++  P     + F ++A D   N L+G   + ++V D+N++SP+                  +    E NR P     + F+ V   D  + +  + +I+  I ++ L   + +  I+ N   I+ +   +S D E    + F + +   D G P       + I + D N+  P F++  YE  ++E       V +   +D D           L++    ++   D        G +  K  LDYE + +     L I        + A V V ++D ND+ P    A++   V E++     IG+  A D D+   ++            N +S  ++ F ++   G +    TLD E+  +Y++ ++  D+     +NI R  + V   D+NDNGP
Sbjct: 1256 HYRIVGEANGEETKH-FRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV---FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF--------------PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAM---RSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRI---------NRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNS----NNIGRQMVAVYLQDVNDNGP 1870          

HSP 2 Score: 102.834 bits (255), Expect = 1.201e-21
Identity = 148/574 (25.78%), Postives = 249/574 (43.38%), Query Frame = 2
Query:  905 NDESPMFYRSNYTAIINEDTQIGEIVLSPKA--FDK-DDGKF-GELEYSFSSGADEVK-KYFSIDKKTGQISIIK--RFNQPTKFKF-SIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENE------YQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST-----WFSIDD-SGTISTKIVLDYEKIKK----LSFNVLAINRG------IKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYE-----IGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSN--VTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL----------HNHNDIFE-INHLTGEITFKRLNIKPGQLTLQ 2482
            ++  P F +  Y   ++ED  +   V+  KA  F   +DG+  G + YS      E + K+F ID  TG I + +   F+ P   K   +K T +  N       + + + DVN++ P     P+              +V E+  +   +  +T  D D G+NSR +  +      D+ N+      I +N     K+  D     E    +  N+   DHGEP + + + + IHI+ EN       + PT   + Y  ++ E+    T V  ++  D D  +     +   G +      FSID+ +G +  +  +    + +    ++  V+  + G       K+ TS A + + + DVN+N P+F   +K  ++ + ++G Y+     I K+ A D+DS  N  + Y L  T SE      + K F ++  TG++  +  V  D E      +TVK  D G  PL    +F + VVD+NDN P ++ P+   +V     + +  SV+T V A DND+     + Y L           N  D FE +N  +GEIT     IKP  +  Q
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN-RESHVDLTIRIDDVNDNVPT-FTRPL-----------YTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV------DNHNF-----SINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM-IHIRTENTNDESAVFLPT---SQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSE------SRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSR--FEAVGTSVIT-VFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITL----IKPIPMKTQ 1056          

HSP 3 Score: 102.064 bits (253), Expect = 2.379e-21
Identity = 154/618 (24.92%), Postives = 256/618 (41.42%), Query Frame = 2
Query:  800 DYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSF---SSGADEVK---KYFS-IDKKTGQISIIKRFNQPT-KFKFSIKATDKA-PNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSII------NKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSP-----ETNVK---TVKVYDRDL------TQSRILDLTDPGST-WFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSS-------ARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-KYNVVHYFLHNH--NDIFEINHLTGEITF-KRLNIKP----GQLTLQLQAIDANSKNI 2515
            D E +    V + A D G   L G     + + + ND SP F R +Y   ++    +G  V++  AFD D     E+ YS    ++  +E +    +F  +++++G+I++IK     T KF F++ A D   P  L     + L+V+D    +P    +P     I      TV E  E N++  +   ++  D      SR S  I  +       NK   + F+  N  E N     +++  +  D E+   ++L +   D      S  T + + ++D N+  P F  +L+   I E  +P     +TN K   TVK  D D          RI+   +   T  F ID+ +G I      D EKI      V A +R + +   +        +V + + DVNDN P F        V+E+    +++  I A D D   +S L Y+L+               F +   +G I+    LD+E  D Y + +   D      +N+   +IH+ D+NDN P ++       V+   +   +  VL  V A D D D K + + Y L     +++F I   +G I   K L+  P          +QAID +   +
Sbjct:  938 DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGI------TVDENVELNKVILRCRAVSSGD------SRNSDVIYKLTASGGPGNKAE-SKFRQFNKFE-NGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGG-------GRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNV---YIHIEDVNDNAPQFEQQKYATTVIEEDVDIPK--VLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGL 1526          

HSP 4 Score: 91.6633 bits (226), Expect = 3.708e-18
Identity = 176/709 (24.82%), Postives = 282/709 (39.77%), Query Frame = 2
Query:  542 NKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-LKLILERSVDYENKKH--YQVVLIACDNGKP-SLCGNQTVIINITNENDESPMFY-RSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSF---SSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATD--KAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFK-----IINVIETNERS------IYKLLADKS----------------------FDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD------LTQSRILDLTDPGSTWFSID-------DSGTISTKIVLDYEKIKKLSFNVLAINRGI-KSFTSSARVSVYVIDVNDNFPKFSLA---SKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNP-TTGIIYSNVT----LDYEECDLYSITVKVID-SGRPPLSNIQRFFIHVVDMNDNGPIWK---YPNIHDNVM--NISLQNIRDSVLTRVRAVDNDSDK-YNVVHYFL-----HNHNDIFEINHLTGEI 2437
            N+   + + I I D+NDN P F +   +  + E   +   I     VD D+     I Y +      N  FS++ N  +   +    D  N++H  Y+  + A D+G+P SL  +  + I   N NDES +F   S YTA + ED Q G  V+  +A D D     E+ YSF   +  + +    FSID+ TG +          K +  + A D  +A NP+                +  ++V    S  +   + HT           +    I + D++  +     C   S I K     +K     I+ V  T++ S      +Y L   +S                      FD E      + +   D G+       +  + + D N+  P F++  YE  +    +  T+V TV  +D D      +T S  +D T        +D        SG I T I     K +K  FNV+A + GI ++  SSA+V++ V+D     PK+  +        V+EN++    I +  A       NS + Y L  T S         K  + N    G  +  V     LDYE+ + Y++T+   D + R  +++ + F + V D+ND  P +    +    D  M  N  L+      +  V+A+D DSD   N VHY +           F I+ LTGEI
Sbjct:  621 NRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD-----NHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQKMNLFSIDEHTGLV----------KLRHGVSAADLAEAENPI----------------NLTVIVQDDGSCCVYPSKTHT----------SYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEI-TLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKL--TASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSR--VASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEI 1280          

HSP 5 Score: 84.7297 bits (208), Expect = 3.743e-16
Identity = 144/601 (23.96%), Postives = 242/601 (40.27%), Query Frame = 2
Query:  680 VDLDSDQFQ-PIQYRI--QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCG-------NQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHL----NYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDP------------------GSTWFSID-DSGTISTKIVLDYEKIKKLSF--NVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEEC---DLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNI-RDSVLTRVRAVDNDS 2359
            +D DSD  Q  + YRI  +   +    F + +   ++      D E    Y + + A D    +L G       N  V I I + ND +P F    Y   + E    G  V++ KA D D  K   L Y    GA   +  F +   +G I + +   F    ++   + A+D   N     T +++H+ DVN+++P         F   K+   TVIE  E+  IP  L  +  +D DQ E S    +       D +     Y   I +++  +R     +   +F  +        ++ Y            ++++++D N+  P F + L+  YI+EN  P   + +  VY  D+ Q+R  D  DP                  G + F ID ++G I     LD E   +  F   V A +RG+ S    A V++ V D+NDN P F        VEE       +    AFD D E  +K N +    + E++   +         + G++     LDYE+    D + + ++V D      + +    + +VD ND+      P+IH    +   +++ R + + R  A D D+
Sbjct: 1244 IDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLI-GAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHN---ATTNVYIHIEDVNDNAP--------QFEQQKYAT-TVIE--EDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGY----------ADVQVNVRDINDNSPIFPERLFG-YIEENREP---IHSDGVYFMDV-QAR--DFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEE--AKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVH---VALVDRNDHA-----PHIHGATEHRVREDVPRGTSIGRYTATDRDA 1800          

HSP 6 Score: 81.2629 bits (199), Expect = 4.740e-15
Identity = 152/717 (21.20%), Postives = 297/717 (41.42%), Query Frame = 2
Query:  566 NIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI--------QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKP-SLCGNQTVIINITNENDESPMFYRS---NYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKY---------FSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDH-------GEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSID---DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEV-EENLKGFYEIGKIHAFDEDS-EINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEE---CDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIW-----------KYPNIHDNV--MNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRS 2563
            ++E++DINDN+P F + S   S+S    V + +      D D+     I Y +        +H +  +F   +++   ++ L + +  + +K +   +IA DNG P +L  +  V +N+ ++  ++P +  S        ++E+ ++ +++L  +A    D +  ++ Y  ++      K          F    +  ++ I++   + Q   +  ++ ATD        +T++ + V DVN+  P   V+     +  +   +  +E +    I    A  T SD   G  +     I    N +   +F+I       +    ++  ++ FD E+   + L +   D            N    K++I I D N+  P+F++  Y   +KE+     +V T+K +D D   +    L   G          DSGTI  K  LD+E   +    VL  + G  + T++  V +++ DVNDN P+F        V EE++     +  +HA D D  E +S++ Y L    +        +++F +   +G I     LD +       ++  V+ ID     L       ++V D+NDN PI+           + P   D V  M++  ++  D         +N + +Y +V   L N   +F I+  TG+I               ++++D   + I + +  I+ +  +DR 
Sbjct:  966 SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSD---GPQNEVHYRIVGEANGEETKHFRI-------DELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHL-VLIASDGRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGA--------DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPT------TENANIEYGIVRNKLINGESVFRIDQNTGKI-------------FAMRSLD---REISSEREFIIEVRANDRG 1637          

HSP 7 Score: 77.7962 bits (190), Expect = 5.111e-14
Identity = 125/560 (22.32%), Postives = 226/560 (40.36%), Query Frame = 2
Query:  353 SEDFKEHHSLSHNRFGRSLKNL-FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDL----------DSDQFQP---IQYRIQHLHKSNFPFSLSQNPLKLILERSVDYE---NKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQI---GEIVLSPKAFDKDDG-------KFGELEYSFSSGADEVKKYFSIDKKTGQI----SIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKY---FSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQS---RILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPK 1921
            + D  +H +L ++  G     + F +   SG +     +D E   Q +L+       I      N    +Y++IE  D+NDNAP F Q   + ++           +EE VD+          D+DQ +    I YR++    ++  F + +    + L +++D +       +  V+ A D+    L G   V +N+ + ND SP+F    +  I      I   G   +  +A D DD        ++G +     +G    +  F ID+ TG+I    S+ +  +   +F   ++A D+      G   + + V D+N+++P              F   T  E S     P   A ++ S  D  E ++ +     +   +  +YF +    ++ + S+  L   +  D E+      F L I   D    ++ A   + + + D N++ P       E  ++E+    T++      DRD   +   RI   +DP    F+ID  GT+     LD E I   +  + A +    +      V+VY+ DVNDN P+
Sbjct: 1359 AHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLV------LIASDGRHNATTNVYIHIE--DVNDNAPQFEQQKYATTV-----------IEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEG-QGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLING----ESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP--------------FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQL--SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHI-HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDP-KRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDN--SNNIGRQMVAVYLQDVNDNGPE 1871          

HSP 8 Score: 73.559 bits (179), Expect = 9.371e-13
Identity = 109/475 (22.95%), Postives = 182/475 (38.32%), Query Frame = 2
Query:  398 GRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEI--IDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYR-----------IQH------LHKSNFPFSLSQNPLKLILERSVDYE--NKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKD-DGKFGELEYSFSSGADEVKKYFSIDKKTGQISI-IKRFNQP---------TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIP--FQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKT--VKVYDRDLTQ 1714
            G+    +F+I   SG +  +  +DR+    +     + N  +  I      +  Y ++++   DINDN+P F +                    EP+  D   F  +Q R           I++      L      F + QN  K+   RS+D E  +++ + + + A D G PS  G   V I +T+ ND +P F ++ Y   + E   IG  V+S  AFD D + K     Y  S  +D    Y + DK + Q S+ + R  QP           F   I+ +D   +       + + +VD N+H+P I               H   E      +P    +   T +D D G+ +R   + QS    D    F I             L    + D E+   ++L I  YD+    N     + ++++D N+  P           +ENT P   + T  ++  DRD  +
Sbjct: 1479 GQGADEVFRIGKYSGTIELVKALDRDPPAGVP----SWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEEN----------REPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYF--YVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD---AEAAVHVALVDRNDHAPHI---------------HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQS----DPKRQFTI--------DQDGTLRVAHTLDREDIAVYNLIIEAYDNS--NNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENT-PVNQLGTCEIRATDRDTAE 1904          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 127.487 bits (319), Expect = 3.617e-29
Identity = 176/675 (26.07%), Postives = 293/675 (43.41%), Query Frame = 2
Query:  683 DLDSDQFQPIQYRIQHLHKSNFPF-SLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEV-----------------------SENNRI----PFQLAF---ITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNS----------------------------------AITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGST--WFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAID 2497
            DLD  Q   + Y I   + S F   S + + L LI    +D E    +++++ A D G PSL     ++I++ + ND +P F  S+Y   I+E+++IG  ++   A DKD  K  EL+YS  S  DE+   F I+  TG I++  + N+    +F+F +K TD   +    +  + +HV D N++ P+I     D F+    ++  +I V                       SEN  I    P Q A    +TVSD D G  +           K    + + ++ +   E    +L   K+ + +  +Y S+   C DH E + S                                   ITK  I I D N+  P FDQ LY   + EN+ P+       V  RD+ + SR+      G     F + +SG I +   LD E   +    V AI+ G      +  V V V+D +DN P+FS      EV E+++    + ++ A D D   N +   + L+   E          F ++  TG+++ N +LD+E+   Y I VK+ D      +++   F++V D+NDN PI++ P      + IS +N   + + +  A D DS+    + Y +   +  F+I   TG ++  R  +    ++L++ A D
Sbjct: 1678 DLDEGQNGLVTYSILSGNTSLFAVNSTTGDILSLI---PLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKD--KDAELQYSLESN-DEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGEKS---SKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVRVTVSD-DAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKA-NGDSIRY-SIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKL---IGHVIARDIDRSSRVFYEIVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIF-HVEVPEDVRIGEPVIQLSASDADEHSNHR---FELDGGGEGIP-------FRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSL---FVNVKDVNDNAPIFEKP----EYLFISEEN--SAEIGQFHASDMDSENNGKIRYSV--TSPYFKIEPSTGVLSRFRQQLPQPLMSLKVTATD 2315          

HSP 2 Score: 85.5001 bits (210), Expect = 2.378e-16
Identity = 76/230 (33.04%), Postives = 109/230 (47.39%), Query Frame = 2
Query: 1772 GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLAS----KRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDI---FEINHLTGEIT 2440
            GTI T   LD+E IK   FN+ A         S+++V ++V D ND  P+F        K  E  + +     IG   A D D   N  + Y +L         S N  LF +N TTG I S + LD EE  L+ + ++  D+G P LS   +  IHV D+NDN P ++   +    + IS  +   S + R+ A D D D    + Y L ++++I   F IN  TG IT
Sbjct: 1605 GTIFTNSPLDFENIKTYRFNITA-------GKSTSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSIL---------SGNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFE---LSSYFIKISENSKIGSKIIRILATDKDKDAE--LQYSLESNDEITIPFRINVATGWIT 1813          

HSP 3 Score: 79.7221 bits (195), Expect = 1.455e-14
Identity = 86/334 (25.75%), Postives = 149/334 (44.61%), Query Frame = 2
Query:  563 VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQ 1558
              I+I+DINDN+P F Q     +++E+S  K    +   +  D D+   + Y I     +N  F ++++  ++   R +D E K  Y +++ A D+GKP   GN TVI+ + +E+D +P F R  +   + ED +IGE V+   A D D+       +    G + +   F +D+ TG + +     F +   ++  +K TD A    +  T +F++V DVN+++P+             F+    + +SE N    ++     SD+D   N +    + S        YFKI        R   +L              SL +   DHG P+
Sbjct: 2031 ATIKIVDINDNSPRFDQQLYRFNVTENSGPKL---IGHVIARDIDRSSRVFYEIVG-GDANHEFMVTESG-QIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRI-FHVEVPEDVRIGEPVIQLSASDADE--HSNHRFELDGGGEGIP--FRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGA---WLIETSLFVNVKDVNDNAPI-------------FEKPEYLFISEENSA--EIGQFHASDMDSENNGKIRYSVTS-------PYFKIEPSTGVLSRFRQQL---------PQPLMSLKVTATDHGVPR 2320          

HSP 4 Score: 65.4698 bits (158), Expect = 3.268e-10
Identity = 70/269 (26.02%), Postives = 127/269 (47.21%), Query Frame = 2
Query: 1475 LLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQ----NLYEIYIKENTSPETNVKTVKVYDRDLTQSRIL--DLTDPGSTWFSIDDS-GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPI 2260
            +  +   D E  K +  NI           + +++ IH+ DEN+  P F      NL  +   +  S    + +    D D  Q+ ++   +    ++ F+++ + G I + I LD E+       + A + GI S ++++++ ++V D+NDN P+F L+S   ++ EN K   +I +I A D+D +  ++L Y L      N+  +I    F +N  TG I     ++ EE + +   VKV D  +     ++   IHV D NDN P+
Sbjct: 1607 IFTNSPLDFENIKTYRFNITA-------GKSTSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKD--AELQYSL----ESNDEITIP---FRINVATGWITVAGKVNREENEEFRFFVKVTDGEKSSKVIVE---IHVEDFNDNHPM 1856          

HSP 5 Score: 64.3142 bits (155), Expect = 6.975e-10
Identity = 86/336 (25.60%), Postives = 157/336 (46.73%), Query Frame = 2
Query:  716 YRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYT--AIINEDTQIGE--IVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQI-SIIKRFNQPTKF-KFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD 1705
            +RIQ    +++ F++S     +     +D+EN K Y+  + A   GK +      VII++T+ENDE+P F   +     ++ E   +    I+ S  A D D+G+ G + YS  SG   +   F+++  TG I S+I    + +   +  I+A D     L   + I +HV D+N+++P         F +S +     I++SEN++I  ++  I  +D D+    + S       + D +     INV      + +  +A K  + EE + F   +   D GE  +  I  +EIH++D N+  P  +    +I++ + T     +  + V+D D
Sbjct: 1589 FRIQ---DNDYNFTISPFDGTIFTNSPLDFENIKTYRFNITA---GKST----SQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSL---FAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTP--------EFELSSY----FIKISENSKIGSKIIRILATDKDKDAELQYSLE-----SNDEITIPFRINV-----ATGWITVAGK-VNREENEEFRFFVKVTD-GEKSSKVI--VEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLD 1885          

HSP 6 Score: 63.929 bits (154), Expect = 8.255e-10
Identity = 94/366 (25.68%), Postives = 154/366 (42.08%), Query Frame = 2
Query: 1175 PLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPG-STWFSIDD-SGTISTKIVLDYEKIKKLSFNV-LAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPI 2260
            PL   T   + +VD+N++SP             +F Q      V+EN+  P  +  +   D+D     R S     I+  D  + F    V E+ +     + + +  D E    + L +   D G+P+    T + + + DE++  P F + ++ + + E+      V  +   D D   +   +L   G    F +D+ +G +     LD+E  KK S+ + + +  G     +S  V+V   DVNDN P F      F  EEN     EIG+ HA D DSE N K+ Y            S+    F++ P+TG++ S       +  L S+ V   D G P L   +    H+VD +  G I
Sbjct: 2024 PLSTITKATIKIVDINDNSP-------------RFDQQLYRFNVTENSG-PKLIGHVIARDID-----RSSRVFYEIVGGDANHEFM---VTESGQ-----IESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSR-IFHVEVPEDVRIGEPVIQLSASDADEHSNHRFELDGGGEGIPFRVDENTGMVFVNDSLDFE--KKQSYRIKVKLTDGAWLIETSLFVNVK--DVNDNAPIFEKPEYLFISEENSA---EIGQFHASDMDSENNGKIRY------------SVTSPYFKIEPSTGVL-SRFRQQLPQ-PLMSLKVTATDHGVPRLQ--KTVLAHLVDKSSFGKI 2338          

HSP 7 Score: 57.7658 bits (138), Expect = 6.371e-8
Identity = 51/180 (28.33%), Postives = 87/180 (48.33%), Query Frame = 2
Query: 1853 IKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYY-LLNTTSENNARSINEKLFELNPTTGIIYSNVT--LDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHY 2383
            I S  S   + + V+DVNDN P F +  +R E+ E     + +    A D D   N  +  Y L+++ +  +  S     F +  + G ++  VT  LD E  DLYS+ +  ID G P LS+     I ++D+NDN      PN     + ++   + ++ L  + A D DS++ +++ Y
Sbjct:   94 ITSPPSIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMS----PFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNP-----PNFGIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTY 264          

HSP 8 Score: 56.225 bits (134), Expect = 1.825e-7
Identity = 61/236 (25.85%), Postives = 109/236 (46.19%), Query Frame = 2
Query: 1514 YFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD-----LTQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEI-NSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYS--NVTLDYEECDLYSITVKVIDSGR 2194
            + +L +   +    Q S IT I   +K  N++ P     + EI++ EN    T    ++  D D     +   +IL  +D     F +D  SG++ +    D EK +  +F   A + G  S T++   ++++ DVNDN PKF   S+ +    + K    +  + A D D ++ N KL Y+LLN              F+L+  TG + +  +V + ++  ++ SI+   +DS R
Sbjct:  601 FVTLPVTLVNRNTTQTSIITLI---VKPLNQHSPIC--QITEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKF--GSRYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNY----------HDFFQLDKETGKVTTIQDVPMTWQRLNI-SISAVNMDSER 818          

HSP 9 Score: 55.0694 bits (131), Expect = 3.928e-7
Identity = 48/201 (23.88%), Postives = 96/201 (47.76%), Query Frame = 2
Query: 1982 GKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-KYNVVHYFLHNHNDIFEINHLTGEI-TFKRLNIKPGQLTLQLQAIDANSKNIHTSQS-LIVYIMGHDRSYLQF 2575
            G+I A DEDS ++  ++Y +L  + + +       +F L+ T+G + S    D E+   Y+   +  D G P  +      I + D+NDN      P         ++    +  +  V+A DND D K   + Y L N++D F+++  TG++ T + + +   +L + + A++ +S+    S++ L+V +    +  +Q 
Sbjct:  651 GRIQARDEDSGLSGVVSYKILTKSDDYDG------IFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDN-----VPKFGSRYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNYHDFFQLDKETGKVTTIQDVPMTWQRLNISISAVNMDSERFLQSKTFLLVTVTSSSKLAVQL 840          

HSP 10 Score: 55.0694 bits (131), Expect = 4.649e-7
Identity = 65/246 (26.42%), Postives = 107/246 (43.50%), Query Frame = 2
Query: 1196 IFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVY----DRDLTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFP 1918
            + +HV D N+ +P         F+     N  V+E  +    P  +      DLD+G+N   +  I S     + + F +         +   +L+    D EE+    L I   D G P  SA +KI IH+ D N+  P F+ + Y I I EN+  +   K +++     D+D      L+  D  +  F I+  +G I+    ++ E+ ++  F V  +  G KS  S   V ++V D NDN P
Sbjct: 1634 VIIHVTDENDEAP--------RFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILS----GNTSLFAV-------NSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENS--KIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFV-KVTDGEKS--SKVIVEIHVEDFNDNHP 1855          

HSP 11 Score: 53.1434 bits (126), Expect = 1.929e-6
Identity = 61/246 (24.80%), Postives = 107/246 (43.50%), Query Frame = 2
Query: 1565 AITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRIL---DLTDPGSTWFSIDDSGTISTKIVLDYEKIKKL--------SFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGF--YEIGKIHAFDEDSEINSKLNYYLL--NTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGP 2257
            +I  I I + D N+  P F  ++  + I E       V+     D D  ++  +   +L D  +T  ++   G + +   L  E   KL        S  + AI++G+   +SS  +++ ++D+NDN P F + S       N  G    ++  ++A D DS  NS L Y +L    TSE         +F ++    ++  N T   + C+     V+  DSG PPLS      +++   N++ P
Sbjct:   99 SIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTL----NWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSE---------MFSISDENILVTQNNTECLQRCEF---VVEARDSGVPPLSTTLNIVVNMEYGNEHEP 328          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 188.348 bits (477), Expect = 1.233e-47
Identity = 173/679 (25.48%), Postives = 294/679 (43.30%), Query Frame = 2
Query:  416 LFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPV---DLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND 2404
            +F+I++ SG + T S +DRET    +L+    +    Q  S  +     V ++++D NDN P F + + ++ + E     ++ N    +   D D      I+Y I   +  +  FS+      + L + +DYE+ + Y++V+ A D G PS      +++N+ + ND +P FY S +   + E+  +G  ++  +A+D D+G   E+ YS S   D      ++D +TG +  IK  ++    +F F + A D    P    + + + V DVN++ P                N    E +     P      TV+  D  E+SR    I +   +          +   N R +  +   +S D ++ K F L +   D G   ++A   + I+I D N + P F+   Y   + E+    T V  V   D D          L +  I  L  P    FSI+  +G I T   LD E        V A + G  S + +  V + V DVNDN P F     +  + E+      + ++ A D D  +N ++ Y L       + R I +  F ++PT+G I +N  LD E   ++ +T   +D G PPLS+     I + D+ND+ P +    I    + +   +   SV+  + A D D     VVHY +   +D
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQ--SERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS-QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF--------------NPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF------AITSQNGRGLITIA--QSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL-------SDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDD 1157          

HSP 2 Score: 167.548 bits (423), Expect = 3.123e-41
Identity = 181/715 (25.31%), Postives = 301/715 (42.10%), Query Frame = 2
Query:  398 GRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQ--ISIIKR--FNQPTKFKFSIKATDKAPNPLIGRT---WIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDL-TQSRI---LDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEEC-DLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV----LTRVRAVDND-SDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQ 2488
            G + ++ F I++ SGD+  +  +D E+V    L+ R ++       +  +L+     + +ID NDNAP F       S+ E+  V   I   +  D D      I Y I      NFP ++      +   + +D E +  +   ++A D G P    + +V+I + + ND  P F    Y A + ED   G  V +  A D D+     L Y  ++G    +  F+I  + G+  I+I +   + Q  +F  ++ ATD       GR+    + +++ D NN +P+    P  +             V E+  +   +  ++ +D D G N++    I   +N++ +N     +    N ++   ++ +   D E T  + L +   D G P  S  T +EI + D N+  P F   LY+  I E+    T+V  V   D D+    RI   L   D     F ID  SGTI T   LD E +       +A+++G    +S+  V + + DVND+ P F+       V EN      +G+IHA D D  +N+ ++Y ++     N    +     E       + +   LDYE     + + V+   +  PPL N     I V D+NDN P+ +          +   N RD      + R+ A D D SDK   +HY + + N+              RLN   G L L  Q
Sbjct:  625 GGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLL-----VNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTG--NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG-----GRSDTATVHINITDANNFAPIFENAPYSA------------SVFEDAPVGTTVLVVSATDSDVGVNAQ----ITYSLNEESINGLGSPDPFSINPQT-GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE----RAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRD-------FQVIFNNFRDHFPSGEIGRIPAFDADVSDK---LHYRILSGNN----------ANLLRLNSSSGGLVLSPQ 1280          

HSP 3 Score: 166.392 bits (420), Expect = 5.904e-41
Identity = 179/693 (25.83%), Postives = 296/693 (42.71%), Query Frame = 2
Query:  410 KNLFKINNSSGDLVTISEIDRE--------TVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILER--------SVDYENKKHYQVVLIACDNGKPS---LCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIG---EIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST--WFSI---DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN 2401
            ++LFK+++ +G + T + +DRE         V   +        T LQ             + ++D ND++P F       S+ E + V S +      D D  +   I+Y I+ +          + P+  I  R        S+D E    Y +++ A D             +V + + ++ND  P F    YT  + ED   G     V   +A D D G    + Y+   G    +  FSID  +G +S++K  +  +   ++  I+A D         T + ++V+D N+++P         F  S+FQ      V EN  + + +  +   D D+G N+  +    SI  +D  N+   ++      ++I      K  D EE   F+  ++  D G P  SA + + I ++D N+  P F+   YE  + E+  P T V TV   D D   SR+      G+T   F+I   +  G I+    LDY++ K+    V A + G +S   +A V + + D N+  P F  A     V E+      +  + A D D  +N+++ Y  LN  S N   S +   F +NP TG I +N  LD E    Y +TV   D G P LS+     I V D+NDN P +K P    +++  +L  +  SV+ +V A D D      + Y L + +
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQ-------------VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGG--NTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--------RFYTSQFQE----SVLENVPVGYNIIRVQAYDSDEGANAEIT---YSISERDD-NFPLAVDPRTGWVQTI------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYS-LNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL--VGTSVI-QVAASDPDVGLNGRIKYLLSDRD 1050          

HSP 4 Score: 121.709 bits (304), Expect = 2.684e-27
Identity = 149/585 (25.47%), Postives = 253/585 (43.25%), Query Frame = 2
Query:  794 SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEY---SFSSGA----DEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTW---IFLHVVDVNNHSPVILVNPIDSFLISKFQNHT-VIEVSENNRIPFQ---LAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT------------DPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTT--GIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN-------DIFEINHLTGEI 2437
            S+D E    +   ++A D+  P   G  T+ +N+ + ND SP F    + A I E   +G  V++ +A D+D GK  E+EY   + + GA    D+    F ID ++G IS     ++ T   +   + A D A      RT    + + V+D N++ P             +F   T  ++V E+     +   +A I  +D DQG N+       +II  +  + F I ++  + + S+ K L     D E  + + L I   D G P  S  T++ +++ D N+  P F  + ++  + EN     N+  V+ YD D   +  +  +            DP + W        + T   LD E+  + +F V+A + G+   ++S+ V + V DVNDN P F+       V E+      +  + A D D +  S+L+Y +  TT     R      F +      G+I    +LDY++   + +TV   DSG    S+     I++ D N+  PI++      +V   +   +  +VL  V A D+D      + Y L+  +       D F IN  TG I
Sbjct:  421 SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-------------QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR---YAIIGGNTQSQFSIDSM--SGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW--------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEI--TTGNTRGR------FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDA--PVGTTVLV-VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI 959          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 188.348 bits (477), Expect = 1.243e-47
Identity = 173/679 (25.48%), Postives = 293/679 (43.15%), Query Frame = 2
Query:  416 LFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPV---DLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND 2404
            +F+I++ SG + T S +DRET    +L+    +    Q  S  +     V ++++D NDN P F + + ++ + E     ++ N    +   D D      I+Y I     +   FS+      + L + +DYE+ + Y++V+ A D G PS      +++N+ + ND +P FY S +   + E+  +G  ++  +A+D D+G   E+ YS S   D      ++D +TG +  IK  ++    +F F + A D    P    + + + V DVN++ P                N    E +     P      TV+  D  E+SR    I +   +          +   N R +  +   +S D ++ K F L +   D G   ++A   + I+I D N + P F+   Y   + E+    T V  V   D D          L +  I  L  P    FSI+  +G I T   LD E        V A + G  S + +  V + V DVNDN P F     +  + E+      + ++ A D D  +N ++ Y L       + R I +  F ++PT+G I +N  LD E   ++ +T   +D G PPLS+     I + D+ND+ P +    I    + +   +   SV+  + A D D     VVHY +   +D
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQ--SERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF--------------NPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF------AITSQNGRGLITIA--QSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL-------SDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDD 1157          

HSP 2 Score: 167.548 bits (423), Expect = 3.150e-41
Identity = 181/715 (25.31%), Postives = 301/715 (42.10%), Query Frame = 2
Query:  398 GRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQ--ISIIKR--FNQPTKFKFSIKATDKAPNPLIGRT---WIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDL-TQSRI---LDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEEC-DLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV----LTRVRAVDND-SDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQ 2488
            G + ++ F I++ SGD+  +  +D E+V    L+ R ++       +  +L+     + +ID NDNAP F       S+ E+  V   I   +  D D      I Y I      NFP ++      +   + +D E +  +   ++A D G P    + +V+I + + ND  P F    Y A + ED   G  V +  A D D+     L Y  ++G    +  F+I  + G+  I+I +   + Q  +F  ++ ATD       GR+    + +++ D NN +P+    P  +             V E+  +   +  ++ +D D G N++    I   +N++ +N     +    N ++   ++ +   D E T  + L +   D G P  S  T +EI + D N+  P F   LY+  I E+    T+V  V   D D+    RI   L   D     F ID  SGTI T   LD E +       +A+++G    +S+  V + + DVND+ P F+       V EN      +G+IHA D D  +N+ ++Y ++     N    +     E       + +   LDYE     + + V+   +  PPL N     I V D+NDN P+ +          +   N RD      + R+ A D D SDK   +HY + + N+              RLN   G L L  Q
Sbjct:  625 GGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLL-----VNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTG--NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG-----GRSDTATVHINITDANNFAPIFENAPYSA------------SVFEDAPVGTTVLVVSATDSDVGVNAQ----ITYSLNEESINGLGSPDPFSINPQT-GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE----RAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRD-------FQVIFNNFRDHFPSGEIGRIPAFDADVSDK---LHYRILSGNN----------ANLLRLNSSSGGLVLSPQ 1280          

HSP 3 Score: 166.392 bits (420), Expect = 6.056e-41
Identity = 176/690 (25.51%), Postives = 300/690 (43.48%), Query Frame = 2
Query:  410 KNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVN-----KLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILER--------SVDYENKKHYQVVLIACDNGKPS---LCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIG---EIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST--WFSI---DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN 2401
            ++LFK+++ +G + T + +DRE +          +    ++V+ +     +     + + ++D ND++P F       S+ E + V S +      D D  +   I+Y I+ +          + P+  I  R        S+D E    Y +++ A D             +V + + ++ND  P F    YT  + ED   G     V   +A D D G    + Y+   G    +  FSID  +G +S++K  +  +   ++  I+A D         T + ++V+D N+++P         F  S+FQ      V EN  + + +  +   D D+G N+  +    SI  +D  N+   ++      ++I      K  D EE   F+  ++  D G P  SA + + I ++D N+  P F+   YE  + E+  P T V TV   D D   SR+      G+T   F+I   +  G I+    LDY++ K+    V A + G +S   +A V + + D N+  P F  A     V E+      +  + A D D  +N+++ Y  LN  S N   S +   F +NP TG I +N  LD E    Y +TV   D G P LS+     I V D+NDN P +K P    +++  +L  +  SV+ +V A D D      + Y L + +
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELM----------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGG--NTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--------RFYTSQFQE----SVLENVPVGYNIIRVQAYDSDEGANAEIT---YSISERDD-NFPLAVDPRTGWVQTI------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYS-LNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL--VGTSVI-QVAASDPDVGLNGRIKYLLSDRD 1050          

HSP 4 Score: 121.709 bits (304), Expect = 2.639e-27
Identity = 149/585 (25.47%), Postives = 253/585 (43.25%), Query Frame = 2
Query:  794 SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEY---SFSSGA----DEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTW---IFLHVVDVNNHSPVILVNPIDSFLISKFQNHT-VIEVSENNRIPFQ---LAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT------------DPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTT--GIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN-------DIFEINHLTGEI 2437
            S+D E    +   ++A D+  P   G  T+ +N+ + ND SP F    + A I E   +G  V++ +A D+D GK  E+EY   + + GA    D+    F ID ++G IS     ++ T   +   + A D A      RT    + + V+D N++ P             +F   T  ++V E+     +   +A I  +D DQG N+       +II  +  + F I ++  + + S+ K L     D E  + + L I   D G P  S  T++ +++ D N+  P F  + ++  + EN     N+  V+ YD D   +  +  +            DP + W        + T   LD E+  + +F V+A + G+   ++S+ V + V DVNDN P F+       V E+      +  + A D D +  S+L+Y +  TT     R      F +      G+I    +LDY++   + +TV   DSG    S+     I++ D N+  PI++      +V   +   +  +VL  V A D+D      + Y L+  +       D F IN  TG I
Sbjct:  421 SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-------------QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR---YAIIGGNTQSQFSIDSM--SGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW--------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEI--TTGNTRGR------FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDA--PVGTTVLV-VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI 959          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 188.348 bits (477), Expect = 1.243e-47
Identity = 173/679 (25.48%), Postives = 293/679 (43.15%), Query Frame = 2
Query:  416 LFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPV---DLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND 2404
            +F+I++ SG + T S +DRET    +L+    +    Q  S  +     V ++++D NDN P F + + ++ + E     ++ N    +   D D      I+Y I     +   FS+      + L + +DYE+ + Y++V+ A D G PS      +++N+ + ND +P FY S +   + E+  +G  ++  +A+D D+G   E+ YS S   D      ++D +TG +  IK  ++    +F F + A D    P    + + + V DVN++ P                N    E +     P      TV+  D  E+SR    I +   +          +   N R +  +   +S D ++ K F L +   D G   ++A   + I+I D N + P F+   Y   + E+    T V  V   D D          L +  I  L  P    FSI+  +G I T   LD E        V A + G  S + +  V + V DVNDN P F     +  + E+      + ++ A D D  +N ++ Y L       + R I +  F ++PT+G I +N  LD E   ++ +T   +D G PPLS+     I + D+ND+ P +    I    + +   +   SV+  + A D D     VVHY +   +D
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQ--SERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF--------------NPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF------AITSQNGRGLITIA--QSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL-------SDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDD 1157          

HSP 2 Score: 167.548 bits (423), Expect = 3.150e-41
Identity = 181/715 (25.31%), Postives = 301/715 (42.10%), Query Frame = 2
Query:  398 GRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQ--ISIIKR--FNQPTKFKFSIKATDKAPNPLIGRT---WIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDL-TQSRI---LDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEEC-DLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV----LTRVRAVDND-SDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQ 2488
            G + ++ F I++ SGD+  +  +D E+V    L+ R ++       +  +L+     + +ID NDNAP F       S+ E+  V   I   +  D D      I Y I      NFP ++      +   + +D E +  +   ++A D G P    + +V+I + + ND  P F    Y A + ED   G  V +  A D D+     L Y  ++G    +  F+I  + G+  I+I +   + Q  +F  ++ ATD       GR+    + +++ D NN +P+    P  +             V E+  +   +  ++ +D D G N++    I   +N++ +N     +    N ++   ++ +   D E T  + L +   D G P  S  T +EI + D N+  P F   LY+  I E+    T+V  V   D D+    RI   L   D     F ID  SGTI T   LD E +       +A+++G    +S+  V + + DVND+ P F+       V EN      +G+IHA D D  +N+ ++Y ++     N    +     E       + +   LDYE     + + V+   +  PPL N     I V D+NDN P+ +          +   N RD      + R+ A D D SDK   +HY + + N+              RLN   G L L  Q
Sbjct:  625 GGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLL-----VNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTG--NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG-----GRSDTATVHINITDANNFAPIFENAPYSA------------SVFEDAPVGTTVLVVSATDSDVGVNAQ----ITYSLNEESINGLGSPDPFSINPQT-GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE----RAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRD-------FQVIFNNFRDHFPSGEIGRIPAFDADVSDK---LHYRILSGNN----------ANLLRLNSSSGGLVLSPQ 1280          

HSP 3 Score: 166.392 bits (420), Expect = 6.056e-41
Identity = 176/690 (25.51%), Postives = 300/690 (43.48%), Query Frame = 2
Query:  410 KNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVN-----KLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILER--------SVDYENKKHYQVVLIACDNGKPS---LCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIG---EIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST--WFSI---DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN 2401
            ++LFK+++ +G + T + +DRE +          +    ++V+ +     +     + + ++D ND++P F       S+ E + V S +      D D  +   I+Y I+ +          + P+  I  R        S+D E    Y +++ A D             +V + + ++ND  P F    YT  + ED   G     V   +A D D G    + Y+   G    +  FSID  +G +S++K  +  +   ++  I+A D         T + ++V+D N+++P         F  S+FQ      V EN  + + +  +   D D+G N+  +    SI  +D  N+   ++      ++I      K  D EE   F+  ++  D G P  SA + + I ++D N+  P F+   YE  + E+  P T V TV   D D   SR+      G+T   F+I   +  G I+    LDY++ K+    V A + G +S   +A V + + D N+  P F  A     V E+      +  + A D D  +N+++ Y  LN  S N   S +   F +NP TG I +N  LD E    Y +TV   D G P LS+     I V D+NDN P +K P    +++  +L  +  SV+ +V A D D      + Y L + +
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELM----------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGG--NTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--------RFYTSQFQE----SVLENVPVGYNIIRVQAYDSDEGANAEIT---YSISERDD-NFPLAVDPRTGWVQTI------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYS-LNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL--VGTSVI-QVAASDPDVGLNGRIKYLLSDRD 1050          

HSP 4 Score: 121.709 bits (304), Expect = 2.639e-27
Identity = 149/585 (25.47%), Postives = 253/585 (43.25%), Query Frame = 2
Query:  794 SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEY---SFSSGA----DEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTW---IFLHVVDVNNHSPVILVNPIDSFLISKFQNHT-VIEVSENNRIPFQ---LAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT------------DPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTT--GIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN-------DIFEINHLTGEI 2437
            S+D E    +   ++A D+  P   G  T+ +N+ + ND SP F    + A I E   +G  V++ +A D+D GK  E+EY   + + GA    D+    F ID ++G IS     ++ T   +   + A D A      RT    + + V+D N++ P             +F   T  ++V E+     +   +A I  +D DQG N+       +II  +  + F I ++  + + S+ K L     D E  + + L I   D G P  S  T++ +++ D N+  P F  + ++  + EN     N+  V+ YD D   +  +  +            DP + W        + T   LD E+  + +F V+A + G+   ++S+ V + V DVNDN P F+       V E+      +  + A D D +  S+L+Y +  TT     R      F +      G+I    +LDY++   + +TV   DSG    S+     I++ D N+  PI++      +V   +   +  +VL  V A D+D      + Y L+  +       D F IN  TG I
Sbjct:  421 SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-------------QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR---YAIIGGNTQSQFSIDSM--SGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW--------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEI--TTGNTRGR------FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDA--PVGTTVLV-VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI 959          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 188.348 bits (477), Expect = 1.246e-47
Identity = 173/679 (25.48%), Postives = 293/679 (43.15%), Query Frame = 2
Query:  416 LFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPV---DLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND 2404
            +F+I++ SG + T S +DRET    +L+    +    Q  S  +     V ++++D NDN P F + + ++ + E     ++ N    +   D D      I+Y I     +   FS+      + L + +DYE+ + Y++V+ A D G PS      +++N+ + ND +P FY S +   + E+  +G  ++  +A+D D+G   E+ YS S   D      ++D +TG +  IK  ++    +F F + A D    P    + + + V DVN++ P                N    E +     P      TV+  D  E+SR    I +   +          +   N R +  +   +S D ++ K F L +   D G   ++A   + I+I D N + P F+   Y   + E+    T V  V   D D          L +  I  L  P    FSI+  +G I T   LD E        V A + G  S + +  V + V DVNDN P F     +  + E+      + ++ A D D  +N ++ Y L       + R I +  F ++PT+G I +N  LD E   ++ +T   +D G PPLS+     I + D+ND+ P +    I    + +   +   SV+  + A D D     VVHY +   +D
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQ--SERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF--------------NPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF------AITSQNGRGLITIA--QSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL-------SDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDD 1157          

HSP 2 Score: 167.548 bits (423), Expect = 3.182e-41
Identity = 181/715 (25.31%), Postives = 301/715 (42.10%), Query Frame = 2
Query:  398 GRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQ--ISIIKR--FNQPTKFKFSIKATDKAPNPLIGRT---WIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDL-TQSRI---LDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEEC-DLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV----LTRVRAVDND-SDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQ 2488
            G + ++ F I++ SGD+  +  +D E+V    L+ R ++       +  +L+     + +ID NDNAP F       S+ E+  V   I   +  D D      I Y I      NFP ++      +   + +D E +  +   ++A D G P    + +V+I + + ND  P F    Y A + ED   G  V +  A D D+     L Y  ++G    +  F+I  + G+  I+I +   + Q  +F  ++ ATD       GR+    + +++ D NN +P+    P  +             V E+  +   +  ++ +D D G N++    I   +N++ +N     +    N ++   ++ +   D E T  + L +   D G P  S  T +EI + D N+  P F   LY+  I E+    T+V  V   D D+    RI   L   D     F ID  SGTI T   LD E +       +A+++G    +S+  V + + DVND+ P F+       V EN      +G+IHA D D  +N+ ++Y ++     N    +     E       + +   LDYE     + + V+   +  PPL N     I V D+NDN P+ +          +   N RD      + R+ A D D SDK   +HY + + N+              RLN   G L L  Q
Sbjct:  625 GGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLL-----VNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTG--NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG-----GRSDTATVHINITDANNFAPIFENAPYSA------------SVFEDAPVGTTVLVVSATDSDVGVNAQ----ITYSLNEESINGLGSPDPFSINPQT-GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE----RAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRD-------FQVIFNNFRDHFPSGEIGRIPAFDADVSDK---LHYRILSGNN----------ANLLRLNSSSGGLVLSPQ 1280          

HSP 3 Score: 166.392 bits (420), Expect = 6.067e-41
Identity = 179/693 (25.83%), Postives = 296/693 (42.71%), Query Frame = 2
Query:  410 KNLFKINNSSGDLVTISEIDRE--------TVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILER--------SVDYENKKHYQVVLIACDNGKPS---LCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIG---EIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST--WFSI---DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN 2401
            ++LFK+++ +G + T + +DRE         V   +        T LQ             + ++D ND++P F       S+ E + V S +      D D  +   I+Y I+ +          + P+  I  R        S+D E    Y +++ A D             +V + + ++ND  P F    YT  + ED   G     V   +A D D G    + Y+   G    +  FSID  +G +S++K  +  +   ++  I+A D         T + ++V+D N+++P         F  S+FQ      V EN  + + +  +   D D+G N+  +    SI  +D  N+   ++      ++I      K  D EE   F+  ++  D G P  SA + + I ++D N+  P F+   YE  + E+  P T V TV   D D   SR+      G+T   F+I   +  G I+    LDY++ K+    V A + G +S   +A V + + D N+  P F  A     V E+      +  + A D D  +N+++ Y  LN  S N   S +   F +NP TG I +N  LD E    Y +TV   D G P LS+     I V D+NDN P +K P    +++  +L  +  SV+ +V A D D      + Y L + +
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQ-------------VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGG--NTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--------RFYTSQFQE----SVLENVPVGYNIIRVQAYDSDEGANAEIT---YSISERDD-NFPLAVDPRTGWVQTI------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYS-LNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL--VGTSVI-QVAASDPDVGLNGRIKYLLSDRD 1050          

HSP 4 Score: 121.709 bits (304), Expect = 2.688e-27
Identity = 149/585 (25.47%), Postives = 253/585 (43.25%), Query Frame = 2
Query:  794 SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEY---SFSSGA----DEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTW---IFLHVVDVNNHSPVILVNPIDSFLISKFQNHT-VIEVSENNRIPFQ---LAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT------------DPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTT--GIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN-------DIFEINHLTGEI 2437
            S+D E    +   ++A D+  P   G  T+ +N+ + ND SP F    + A I E   +G  V++ +A D+D GK  E+EY   + + GA    D+    F ID ++G IS     ++ T   +   + A D A      RT    + + V+D N++ P             +F   T  ++V E+     +   +A I  +D DQG N+       +II  +  + F I ++  + + S+ K L     D E  + + L I   D G P  S  T++ +++ D N+  P F  + ++  + EN     N+  V+ YD D   +  +  +            DP + W        + T   LD E+  + +F V+A + G+   ++S+ V + V DVNDN P F+       V E+      +  + A D D +  S+L+Y +  TT     R      F +      G+I    +LDY++   + +TV   DSG    S+     I++ D N+  PI++      +V   +   +  +VL  V A D+D      + Y L+  +       D F IN  TG I
Sbjct:  421 SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-------------QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR---YAIIGGNTQSQFSIDSM--SGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW--------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEI--TTGNTRGR------FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDA--PVGTTVLV-VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI 959          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 188.348 bits (477), Expect = 1.253e-47
Identity = 173/679 (25.48%), Postives = 293/679 (43.15%), Query Frame = 2
Query:  416 LFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPV---DLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND 2404
            +F+I++ SG + T S +DRET    +L+    +    Q  S  +     V ++++D NDN P F + + ++ + E     ++ N    +   D D      I+Y I     +   FS+      + L + +DYE+ + Y++V+ A D G PS      +++N+ + ND +P FY S +   + E+  +G  ++  +A+D D+G   E+ YS S   D      ++D +TG +  IK  ++    +F F + A D    P    + + + V DVN++ P                N    E +     P      TV+  D  E+SR    I +   +          +   N R +  +   +S D ++ K F L +   D G   ++A   + I+I D N + P F+   Y   + E+    T V  V   D D          L +  I  L  P    FSI+  +G I T   LD E        V A + G  S + +  V + V DVNDN P F     +  + E+      + ++ A D D  +N ++ Y L       + R I +  F ++PT+G I +N  LD E   ++ +T   +D G PPLS+     I + D+ND+ P +    I    + +   +   SV+  + A D D     VVHY +   +D
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQ--SERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF--------------NPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF------AITSQNGRGLITIA--QSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL-------SDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKI---TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDD 1157          

HSP 2 Score: 167.548 bits (423), Expect = 3.230e-41
Identity = 181/715 (25.31%), Postives = 301/715 (42.10%), Query Frame = 2
Query:  398 GRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQ--ISIIKR--FNQPTKFKFSIKATDKAPNPLIGRT---WIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDL-TQSRI---LDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEEC-DLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV----LTRVRAVDND-SDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQ 2488
            G + ++ F I++ SGD+  +  +D E+V    L+ R ++       +  +L+     + +ID NDNAP F       S+ E+  V   I   +  D D      I Y I      NFP ++      +   + +D E +  +   ++A D G P    + +V+I + + ND  P F    Y A + ED   G  V +  A D D+     L Y  ++G    +  F+I  + G+  I+I +   + Q  +F  ++ ATD       GR+    + +++ D NN +P+    P  +             V E+  +   +  ++ +D D G N++    I   +N++ +N     +    N ++   ++ +   D E T  + L +   D G P  S  T +EI + D N+  P F   LY+  I E+    T+V  V   D D+    RI   L   D     F ID  SGTI T   LD E +       +A+++G    +S+  V + + DVND+ P F+       V EN      +G+IHA D D  +N+ ++Y ++     N    +     E       + +   LDYE     + + V+   +  PPL N     I V D+NDN P+ +          +   N RD      + R+ A D D SDK   +HY + + N+              RLN   G L L  Q
Sbjct:  625 GGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLL-----VNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTG--NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG-----GRSDTATVHINITDANNFAPIFENAPYSA------------SVFEDAPVGTTVLVVSATDSDVGVNAQ----ITYSLNEESINGLGSPDPFSINPQT-GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE----RAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRD-------FQVIFNNFRDHFPSGEIGRIPAFDADVSDK---LHYRILSGNN----------ANLLRLNSSSGGLVLSPQ 1280          

HSP 3 Score: 166.392 bits (420), Expect = 6.263e-41
Identity = 179/693 (25.83%), Postives = 296/693 (42.71%), Query Frame = 2
Query:  410 KNLFKINNSSGDLVTISEIDRE--------TVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILER--------SVDYENKKHYQVVLIACDNGKPS---LCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIG---EIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST--WFSI---DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN 2401
            ++LFK+++ +G + T + +DRE         V   +        T LQ             + ++D ND++P F       S+ E + V S +      D D  +   I+Y I+ +          + P+  I  R        S+D E    Y +++ A D             +V + + ++ND  P F    YT  + ED   G     V   +A D D G    + Y+   G    +  FSID  +G +S++K  +  +   ++  I+A D         T + ++V+D N+++P         F  S+FQ      V EN  + + +  +   D D+G N+  +    SI  +D  N+   ++      ++I      K  D EE   F+  ++  D G P  SA + + I ++D N+  P F+   YE  + E+  P T V TV   D D   SR+      G+T   F+I   +  G I+    LDY++ K+    V A + G +S   +A V + + D N+  P F  A     V E+      +  + A D D  +N+++ Y  LN  S N   S +   F +NP TG I +N  LD E    Y +TV   D G P LS+     I V D+NDN P +K P    +++  +L  +  SV+ +V A D D      + Y L + +
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQ-------------VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGG--NTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--------RFYTSQFQE----SVLENVPVGYNIIRVQAYDSDEGANAEIT---YSISERDD-NFPLAVDPRTGWVQTI------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYS-LNEESINGLGSPDP--FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL--VGTSVI-QVAASDPDVGLNGRIKYLLSDRD 1050          

HSP 4 Score: 121.709 bits (304), Expect = 2.776e-27
Identity = 149/585 (25.47%), Postives = 253/585 (43.25%), Query Frame = 2
Query:  794 SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEY---SFSSGA----DEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTW---IFLHVVDVNNHSPVILVNPIDSFLISKFQNHT-VIEVSENNRIPFQ---LAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT------------DPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTT--GIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN-------DIFEINHLTGEI 2437
            S+D E    +   ++A D+  P   G  T+ +N+ + ND SP F    + A I E   +G  V++ +A D+D GK  E+EY   + + GA    D+    F ID ++G IS     ++ T   +   + A D A      RT    + + V+D N++ P             +F   T  ++V E+     +   +A I  +D DQG N+       +II  +  + F I ++  + + S+ K L     D E  + + L I   D G P  S  T++ +++ D N+  P F  + ++  + EN     N+  V+ YD D   +  +  +            DP + W        + T   LD E+  + +F V+A + G+   ++S+ V + V DVNDN P F+       V E+      +  + A D D +  S+L+Y +  TT     R      F +      G+I    +LDY++   + +TV   DSG    S+     I++ D N+  PI++      +V   +   +  +VL  V A D+D      + Y L+  +       D F IN  TG I
Sbjct:  421 SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-------------QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR---YAIIGGNTQSQFSIDSM--SGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW--------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEI--TTGNTRGR------FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDA--PVGTTVLV-VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI 959          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 239.195 bits (609), Expect = 1.972e-64
Identity = 206/729 (28.26%), Postives = 366/729 (50.21%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTKF--KFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L ++ +++G++ T S  IDRE +C     + +E    +++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+      +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  S     I E++ +G  V+  +A D D G   E++Y F +  +   ++ F+++  TG I++ +  ++      K ++ A+D + +P   R  I ++V DVN+++P I +     ++IS   N TV+ +SE + I  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK +   I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G ++  S A V V ++D NDN PKF+    +F V ENL  +  +G I   D D+  N+ +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  V+ +D+G PP S+  +  I+V+D+NDN PI  YP  + +   + L  I  SV+  V AVD D+      KY +V     N   +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLR----YIISP-TNGTVM-LSEKDPINTKIALITVSDKDTDVNGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILND-NEN---------FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVS---GNVRSLFRIDPVTGNITLEE---KPTIADIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 239.58 bits (610), Expect = 2.602e-64
Identity = 206/729 (28.26%), Postives = 366/729 (50.21%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L ++ +++G++ T S  IDRE +C     + +E    +++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+      +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  S     I E++ +G  V+  +A D D G   E++Y F +  +   ++ F+++  TG I++ +  +  +    K ++ A+D + +P   R  I ++V DVN+++P I +     ++IS   N TV+ +SE + I  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK +   I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G ++  S A V V ++D NDN PKF+    +F V ENL  +  +G I   D D+  N+ +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  V+ +D+G PP S+  +  I+V+D+NDN PI  YP  + +   + L  I  SV+  V AVD D+      KY +V     N   +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLR----YIISP-TNGTVM-LSEKDPINTKIALITVSDKDTDVNGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILND-NEN---------FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVS---GNVRSLFRIDPVTGNITLEE---KPTIADIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 238.81 bits (608), Expect = 3.278e-64
Identity = 206/729 (28.26%), Postives = 366/729 (50.21%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTKF--KFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L ++ +++G++ T S  IDRE +C     + +E    +++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+      +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  S     I E++ +G  V+  +A D D G   E++Y F +  +   ++ F+++  TG I++ +  ++      K ++ A+D + +P   R  I ++V DVN+++P I +     ++IS   N TV+ +SE + I  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK +   I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G ++  S A V V ++D NDN PKF+    +F V ENL  +  +G I   D D+  N+ +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  V+ +D+G PP S+  +  I+V+D+NDN PI  YP  + +   + L  I  SV+  V AVD D+      KY +V     N   +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLR----YIISP-TNGTVM-LSEKDPINTKIALITVSDKDTDVNGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILND-NEN---------FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVS---GNVRSLFRIDPVTGNITLEE---KPTIADIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 238.81 bits (608), Expect = 3.278e-64
Identity = 206/729 (28.26%), Postives = 366/729 (50.21%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTKF--KFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L ++ +++G++ T S  IDRE +C     + +E    +++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+      +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  S     I E++ +G  V+  +A D D G   E++Y F +  +   ++ F+++  TG I++ +  ++      K ++ A+D + +P   R  I ++V DVN+++P I +     ++IS   N TV+ +SE + I  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK +   I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G ++  S A V V ++D NDN PKF+    +F V ENL  +  +G I   D D+  N+ +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  V+ +D+G PP S+  +  I+V+D+NDN PI  YP  + +   + L  I  SV+  V AVD D+      KY +V     N   +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLR----YIISP-TNGTVM-LSEKDPINTKIALITVSDKDTDVNGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILND-NEN---------FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVS---GNVRSLFRIDPVTGNITLEE---KPTIADIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 238.039 bits (606), Expect = 5.076e-64
Identity = 197/703 (28.02%), Postives = 330/703 (46.94%), Query Frame = 2
Query:  419 FKINNSSGDLVTIS-EIDRETV--CQLNLIKRNENCTILQIVSVNKLM------WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSL------SQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITFKR 2449
             +++  +GD+ T    IDRET+  C+     + + C +   VSV  L+       I   IE+ DINDN P F    L++S+ E++ + +  ++    D D+++     Y +    ++   F L       +   +LI+  S+D E K  Y + + A D G P    +  + + I + ND +P F +S+Y A + E++ IG  VL  KA D D G  GE+EY+     D V K   ID+ +G I +    ++      KF + A DK P+P   +T++ + V D N+++P + +  I   L++   +  V  +SE+  +   +A + VSD D+GEN+  +C    ++  D     +  +    + +  Y L      D E  + + + I+  D G P  S+   +++ + D N+  P F   L+E+   E   P   V  V   D D      L  S I D +  G   F ID +SG +  +  LD E   +  F V A ++G+ S   +A V + V+D NDN PKF L+   F V EN+     +G +   D D   N+++   +     +          F +   TG I S+++ D E+   Y+  +K +D G PP S+     I+V+D NDN P+   P+ + + + +S     DSV+  V A D DS     + Y +   N  D+F I+   GEIT  +
Sbjct:   64 LRVDGKTGDIFTTEIPIDRETLKDCR----NKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIG--LVT--HSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC----VVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRG--LFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGK----------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPS-NSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTK 741          

HSP 2 Score: 51.9878 bits (123), Expect = 5.573e-6
Identity = 65/265 (24.53%), Postives = 114/265 (43.02%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIY-----VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILER-SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIG--EIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKA 1168
            S + LF+I+ +SG++   S +DRE          +++    ++ + +K +  +     V I+++D NDN P F     S S+ E+    S + +    D+D  +   +Q  ++     +    + QN    IL   S D E +  Y   L A D G P       V IN+ +END +P+  + + ++ I          +V   +A D D G   EL YS + G       F I    G+I++ K   +      +  IK +D+ 
Sbjct:  513 STRGLFEIDPNSGEVRARSPLDRE----------HKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVE----PDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGG--NPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRG 761          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 257.684 bits (657), Expect = 2.829e-70
Identity = 212/750 (28.27%), Postives = 359/750 (47.87%), Query Frame = 2
Query:  419 FKINNSSGDLVTI-SEIDRETVCQLNLIKRNENCTILQIVSVNKLM-----WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLS------QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI---IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTW-FSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYP-NIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITFKRLNIKP--GQLTLQLQAIDANSKNIH-------------TSQSLIVYIMGH 2554
             +++  +GD+ T  + IDRE++ +   ++  E C +   VS+  LM      +   IEI+DINDN P F    +++S+ E++ +     +    D DS       Y +    ++   F L       +   +LI+   +D E +  Y + +   D G P+   +  + I+I + ND +P F +  Y A + E++ +G  VL  KA D D G   E++YSF   +D V++   +D+ TG I++   I R +  T  KFS+ A DK  NP   RT + + + D N++ PVI    I  F +   Q   V  +SE+  +   +A + VSD+D+G N+  +C    ++  D     K ++   ++ +  Y L    + D E  K +++ I+  D G P  S+   +++ + D N+  P F Q+L E+   EN      V  V   D D   +  L    L DP +   FSI+ DSG I    VLD E+ +   F+V+A+++GI S   +A V + V+D NDN PKF L    F V EN+     +G +   D D   N+ ++  +   + E          F +   TG I S+++ D E    Y+  +K +D G PP S+     I+V+D NDN P+   P NI  +   ++ Q    + +  VRA D D+     + Y + + N  ++F+I+H  GE+T ++  I+   G   L ++  D    + H             T+Q+L+  ++GH
Sbjct:  108 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVI---EIRGFGLVTHQG-GVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----------FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNI--SYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGH 836          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 258.07 bits (658), Expect = 3.039e-70
Identity = 212/750 (28.27%), Postives = 357/750 (47.60%), Query Frame = 2
Query:  419 FKINNSSGDLVTI-SEIDRETVCQLNLIKRNENCTILQIVSVNKLM-----WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI------QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI---IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTW-FSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYP-NIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITFKRLNIKP--GQLTLQLQAIDANSKNIH-------------TSQSLIVYIMGH 2554
             +++  +GD+ T  + IDRE++ +   ++  E C +   VS+  LM      +   IEI+DINDN P F    +++S+ E++ +     +    D DS       Y +      Q L          +   +LI+   +D E +  Y + +   D G P+   +  + I+I + ND +P F +  Y A + E++ +G  VL  KA D D G   E++YSF   +D V++   +D+ TG I++   I R +  T  KFS+ A DK  NP   RT + + + D N++ PVI    I  F +   Q   V  +SE+  +   +A + VSD+D+G N+  +C    ++  D     K ++   ++ +  Y L    + D E  K +++ I+  D G P  S+   +++ + D N+  P F Q+L E+   EN      V  V   D D   +  L    L DP +   FSI+ DSG I    VLD E+ +   F+V+A+++GI S   +A V + V+D NDN PKF L    F V EN+     +G +   D D   N+ ++  +   + E          F +   TG I S+++ D E    Y+  +K +D G PP S+     I+V+D NDN P+   P NI  +   ++ Q    + +  VRA D D+     + Y + + N  ++F+I+H  GE+T ++  I+   G   L ++  D    + H             T+Q+L+  ++GH
Sbjct:  108 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVI---EIRGFGLVTHQG-GVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----------FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNI--SYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGH 836          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 258.07 bits (658), Expect = 5.824e-70
Identity = 212/750 (28.27%), Postives = 359/750 (47.87%), Query Frame = 2
Query:  419 FKINNSSGDLVTI-SEIDRETVCQLNLIKRNENCTILQIVSVNKLM-----WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLS------QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI---IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTW-FSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYP-NIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITFKRLNIKP--GQLTLQLQAIDANSKNIH-------------TSQSLIVYIMGH 2554
             +++  +GD+ T  + IDRE++ +   ++  E C +   VS+  LM      +   IEI+DINDN P F    +++S+ E++ +     +    D DS       Y +    ++   F L       +   +LI+   +D E +  Y + +   D G P+   +  + I+I + ND +P F +  Y A + E++ +G  VL  KA D D G   E++YSF   +D V++   +D+ TG I++   I R +  T  KFS+ A DK  NP   RT + + + D N++ PVI    I  F +   Q   V  +SE+  +   +A + VSD+D+G N+  +C    ++  D     K ++   ++ +  Y L    + D E  K +++ I+  D G P  S+   +++ + D N+  P F Q+L E+   EN      V  V   D D   +  L    L DP +   FSI+ DSG I    VLD E+ +   F+V+A+++GI S   +A V + V+D NDN PKF L    F V EN+     +G +   D D   N+ ++  +   + E          F +   TG I S+++ D E    Y+  +K +D G PP S+     I+V+D NDN P+   P NI  +   ++ Q    + +  VRA D D+     + Y + + N  ++F+I+H  GE+T ++  I+   G   L ++  D    + H             T+Q+L+  ++GH
Sbjct:  108 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIE---IRGFGLVTHQG-GVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----------FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNI--SYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGH 836          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 258.455 bits (659), Expect = 6.605e-70
Identity = 212/752 (28.19%), Postives = 360/752 (47.87%), Query Frame = 2
Query:  419 FKINNSSGDLVTI-SEIDRETVCQLNLIKRNENCTILQIVSVNKLM-----WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLS------QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI---IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTW-FSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYP-NIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITFKRLNIKP--GQLTLQLQAIDANSKNIH-------------TSQSLIVYIMGHDR 2560
             +++  +GD+ T  + IDRE++ +   ++  E C +   VS+  LM      +   IEI+DINDN P F    +++S+ E++ +     +    D DS       Y +    ++   F L       +   +LI+   +D E +  Y + +   D G P+   +  + I+I + ND +P F +  Y A + E++ +G  VL  KA D D G   E++YSF   +D V++   +D+ TG I++   I R +  T  KFS+ A DK  NP   RT + + + D N++ PVI    I  F +   Q   V  +SE+  +   +A + VSD+D+G N+  +C    ++  D     K ++   ++ +  Y L    + D E  K +++ I+  D G P  S+   +++ + D N+  P F Q+L E+   EN      V  V   D D   +  L    L DP +   FSI+ DSG I    VLD E+ +   F+V+A+++GI S   +A V + V+D NDN PKF L    F V EN+     +G +   D D   N+ ++  +   + E          F +   TG I S+++ D E    Y+  +K +D G PP S+     I+V+D NDN P+   P NI  +   ++ Q    + +  VRA D D+     + Y + + N  ++F+I+H  GE+T ++  I+   G   L ++  D    + H             T+Q+L+  ++GH +
Sbjct:  100 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIE---IRGFGLVTHQG-GVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----------FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNI--SYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGHSQ 830          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 258.07 bits (658), Expect = 8.897e-70
Identity = 212/752 (28.19%), Postives = 358/752 (47.61%), Query Frame = 2
Query:  419 FKINNSSGDLVTI-SEIDRETVCQLNLIKRNENCTILQIVSVNKLM-----WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI------QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI---IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTW-FSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYP-NIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITFKRLNIKP--GQLTLQLQAIDANSKNIH-------------TSQSLIVYIMGHDR 2560
             +++  +GD+ T  + IDRE++ +   ++  E C +   VS+  LM      +   IEI+DINDN P F    +++S+ E++ +     +    D DS       Y +      Q L          +   +LI+   +D E +  Y + +   D G P+   +  + I+I + ND +P F +  Y A + E++ +G  VL  KA D D G   E++YSF   +D V++   +D+ TG I++   I R +  T  KFS+ A DK  NP   RT + + + D N++ PVI    I  F +   Q   V  +SE+  +   +A + VSD+D+G N+  +C    ++  D     K ++   ++ +  Y L    + D E  K +++ I+  D G P  S+   +++ + D N+  P F Q+L E+   EN      V  V   D D   +  L    L DP +   FSI+ DSG I    VLD E+ +   F+V+A+++GI S   +A V + V+D NDN PKF L    F V EN+     +G +   D D   N+ ++  +   + E          F +   TG I S+++ D E    Y+  +K +D G PP S+     I+V+D NDN P+   P NI  +   ++ Q    + +  VRA D D+     + Y + + N  ++F+I+H  GE+T ++  I+   G   L ++  D    + H             T+Q+L+  ++GH +
Sbjct:  108 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGT-LKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIE---IRGFGLVTHQG-GVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE----------FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNI--SYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGHSQ 838          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 235.728 bits (600), Expect = 8.319e-64
Identity = 211/735 (28.71%), Postives = 358/735 (48.71%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDAN------SKNIHTSQSLIVYI 2545
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  +  +    K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V + E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   DED+  N  +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N       K +HT   + +Y+
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND-NEN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYV 774          

HSP 2 Score: 114.39 bits (285), Expect = 3.826e-25
Identity = 111/414 (26.81%), Postives = 185/414 (44.69%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYF--KIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + FN  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +    SI+N D+ N+       VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTL---SILN-DNENFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 235.728 bits (600), Expect = 1.157e-62
Identity = 211/735 (28.71%), Postives = 358/735 (48.71%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDAN------SKNIHTSQSLIVYI 2545
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V + E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   DED+  N  +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N       K +HT   + +Y+
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND-NEN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYV 774          

HSP 2 Score: 112.849 bits (281), Expect = 1.440e-24
Identity = 111/414 (26.81%), Postives = 185/414 (44.69%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYF--KIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + FN  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +    SI+N D+ N+       VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTL---SILN-DNENFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 235.728 bits (600), Expect = 1.157e-62
Identity = 211/735 (28.71%), Postives = 358/735 (48.71%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDAN------SKNIHTSQSLIVYI 2545
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V + E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   DED+  N  +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N       K +HT   + +Y+
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND-NEN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYV 774          

HSP 2 Score: 112.849 bits (281), Expect = 1.440e-24
Identity = 111/414 (26.81%), Postives = 185/414 (44.69%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYF--KIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + FN  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +    SI+N D+ N+       VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTL---SILN-DNENFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 235.343 bits (599), Expect = 1.191e-62
Identity = 211/735 (28.71%), Postives = 358/735 (48.71%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDAN------SKNIHTSQSLIVYI 2545
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V + E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   DED+  N  +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N       K +HT   + +Y+
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND-NEN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYV 774          

HSP 2 Score: 113.235 bits (282), Expect = 1.162e-24
Identity = 111/414 (26.81%), Postives = 185/414 (44.69%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYF--KIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + FN  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +    SI+N D+ N+       VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTL---SILN-DNENFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 235.343 bits (599), Expect = 1.261e-62
Identity = 211/735 (28.71%), Postives = 358/735 (48.71%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDAN------SKNIHTSQSLIVYI 2545
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V + E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   DED+  N  +   +LN  +EN         F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N       K +HT   + +Y+
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND-NEN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYV 774          

HSP 2 Score: 113.235 bits (282), Expect = 1.281e-24
Identity = 111/414 (26.81%), Postives = 185/414 (44.69%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYF--KIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + FN  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +    SI+N D+ N+       VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTL---SILN-DNENFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 236.113 bits (601), Expect = 4.940e-62
Identity = 207/730 (28.36%), Postives = 353/730 (48.36%), Query Frame = 2
Query:  416 LFKINNSSGDLVTIS-EIDRETVCQ-LNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            L K+++S+G++ T S  IDRE +C   +  + NE    L++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+  F  +Q+      +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +++ ND  P+F        I E+  +G  V+   A D D G   E+ Y F +  A   K+ F+++  TG I++ +  ++      K ++ A+D +  P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + +  ++A ITVSD D   N +  C I+  +       F +  V +      Y L      D E TK FS  I+  D G+P  +    + + ++DEN+  P F+Q + E+ + EN      + T+   D D  + + I+    P +++F +D  +G ++   V D E+ ++  F V A + G     S A V V V+D NDN PKF+    +F V ENL  +  +G I   D D+  N  +   +LN              F L+P +G+I SNV+ D E+   Y+  VK  D G+PP S+  +  I+V+D+NDN P+   P  + +   + L  I  SV+  V AVD D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:   75 LVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR----YIISPI-NGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVP------FHLKAVYDNQ----YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDN----------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDVGLHRLVVNISDLGYPKSLHTLVL 769          

HSP 2 Score: 112.079 bits (279), Expect = 1.677e-23
Identity = 107/412 (25.97%), Postives = 182/412 (44.17%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAP--AFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQ---NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQP 1615
            + K LF +NN++G +     +DRE              T+L     +      V I + D+NDN P    R I   I+ +     K  +N +  +   SD+   +  ++    +   PF L     N   L     +DYE  K +   ++A D+GKPSL     V + + +END  P+F +      ++E+ + G  + +  A D+D GK  ++ Y     A     +F +D+KTG ++  + F+  +  +F F++ A D    PL  +  + + V+D N++SP             KF  NH    VSEN      +  ITV+D D GEN   +  I  + + D+        VI++N           SFD E+   ++ ++   D G+P  S+  K+ I++ D N+  P
Sbjct:  298 ATKRLFALNNTTGLITVQRSLDREETAI-------HKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA----SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------------KFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSI--LNDNDNFVLDPYSGVIKSN----------VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP 673          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9Y5I4|PCDC2_HUMAN (Protocadherin alpha-C2 OS=Homo sapiens OX=9606 GN=PCDHAC2 PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.649e-61
Identity = 184/691 (26.63%), Postives = 328/691 (47.47%), Query Frame = 2
Query:  242 EISFKLVENCSIGTIVGNIN--LSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI---QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSS-GADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDN-----FPKFSLASKRFE-VEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVD 2239
            ++ + + E  + G +VGN+   L  +L       L++              N  G       +++ +SG L     IDRE +C+    +R      L++++ N +    V +EI+DINDN+P F + +  + +SES    ++ ++E   D D        Y +   +H      P   +   L+L+L + +D E    + +VL A D G P+  G   + + + + ND SP F +S Y   + ED+  G +V+   A D D+G  GEL YS SS  +D  ++ FSID  TG++ +I    + + + ++  ++ATD+ P P+ G   + + +VDVN+++P +++  + S +      +T++            A ++V+D D G N + S  +++ +    LN F           + Y L+     D E    +++ +   D G PQ +++  +++ I D N+  P+F ++ Y IYI+EN  P   + TV+  D D          L +  I  L  P +++ SI+  SG++      DYEK ++    V A ++G    +S+   +VYV+D+ND+     +P  + +S  FE V       Y + K+ A D DS  N+ L Y+L  T+        +  LF++   TG I +   +  E    +++TV V D+G P LS      + VVD
Sbjct:   43 QLRYSVPEEQAPGALVGNVARALGLELRRLGPGCLRI--------------NHLGAPSPRYLELDLTSGALFVNERIDREALCE----QRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAPEVVLTDLYSPVPENATPNTIV------------AVLSVNDQDSGPNRKVSLGLEATL-PFRLNGFG----------NSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGL--PVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTANVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTS--------DLDLFKVELHTGEIRTTRKMGDESGSTFNLTVVVRDNGEPSLSASVAITVAVVD 682          

HSP 2 Score: 125.176 bits (313), Expect = 1.322e-27
Identity = 145/583 (24.87%), Postives = 251/583 (43.05%), Query Frame = 2
Query:  878 TVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQ-----ISIIKRFN----QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIY--IKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIV---LDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEEN-LKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLF-ELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISL---QNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEI-TFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDR 2560
             V + I + ND SP F R NY   ++E    G       A D D G      Y  S       ++F +D K  Q     + ++ R      Q       + A D       G   I + V+D N++SP        +F  S ++    +++ E++     +  +  SD D+G N      + S  +      F I       + S  ++      D EE   + + +   D G    +   K+ + I D N+  P  +  L ++Y  + EN +P T V  + V D+D   +R + L    +  F ++  G   T +V   LD E++   +  V A + GI   TS   + V + D+NDN P F   S    ++EN L G   +  + A D D + N+++ Y LL    E   + +    +  +N  +G +Y+  + DYE+   + +TV+  D G PPLS+     ++VVDMND+ P   YP   ++     +         ++T+V A+D+DS +   + Y L   +  D+F++   TGEI T +++  + G  T  L  +  ++     S S+ + +   DR
Sbjct:  133 AVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSP-----SEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSP--------AFDQSTYR----VQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSI-------DASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAP--EVVLTDLYSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGLEATLPFRLNGFGNSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVL-LCTVQATDPDEKENAEVTYSLL----EREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGSPPLSSTVTANVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFKVELHTGEIRTTRKMGDESGS-TFNLTVVVRDNGEPSLSASVAITVAVVDR 683          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q5DRE5|PCDA7_PANTR (Protocadherin alpha-7 OS=Pan troglodytes OX=9598 GN=PCDHA7 PE=3 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 3.402e-61
Identity = 194/707 (27.44%), Postives = 328/707 (46.39%), Query Frame = 2
Query:  194 LVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTI-LQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQ--HLHKSNFPFSLSQ-NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSI-DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKF-------SLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVD 2239
            L+L + +L + +A   ++ + + E    G  VG I   AQ        L LE +E       +     G    +L ++N  +G L   S IDRE +C      R+  C+I L+++    L   +V++E+ DINDN P F     ++ ++ES  + S+  LE   D D  +   + YR+        + P S  Q  PL L+L + +D E      ++L A D GKP L G   ++I + + ND +P+F R+ YT  + E+  IG +V+ P A D D+G  G++ YSFSS  + ++K  F +D  +G I++I    F +    K  ++A DK   PL G   + + VVDVN+++P + +  +   +    Q  TVI              I+V D D G N + +C +   +       FK+++      ++ Y L+ D++ D E    + L +   D G P   A   + + + D N+  P F Q  Y +++KEN  P  ++ TV   D D          L + R+ +     S++ S+  +SG +     LD+E+++ L F V A + G+    S+  + V+V+D NDN P         +  + R  V  ++   + + K+ A D DS  N+ L+Y L    +     SI    F +   TG I +   LD  +   + + V V D G P L+      + +V+
Sbjct:   14 LLLFIIILAAWEAGRGQLHYSVPEEAKHGNFVGRI---AQ-------DLGLELAELVPRLFRVVCKFRG----DLLEVNLQNGILFVNSRIDREELC-----GRSAECSIHLEVIVERPLQVFHVDVEVKDINDNPPVFPATQRNLFIAESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPVFDRTLYTVKLPENVSIGTLVIHPNASDLDEGLNGDIIYSFSSDVSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTVLVEVVDVNDNAPQLTLTSLSLPIPEDAQPGTVI------------TLISVFDRDFGVNGQVTCSLTPHVP------FKLVSTF----KNYYSLVLDRALDRESVSAYELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAGDADAQKNALVSYSLVERRVGERAL--SSYISVHAESGKVYVLQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRVGGTGGAVRELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPVAA---GASIP---FRVGLYTGEISTTRALDETDAPRHRLLVLVKDHGEPSLTATATVLVSLVE 671          

HSP 2 Score: 113.62 bits (283), Expect = 4.674e-24
Identity = 140/563 (24.87%), Postives = 222/563 (39.43%), Query Frame = 2
Query:  881 VIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSID--------KKTGQI--SIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGEN--------SRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFE----LNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDN---VMNISLQNIRDS-VLTRVRAVDNDSDKYNVVHYFLH----NHNDIFEINHLTGEITFKR 2449
            V + + + ND  P+F  +     I E   +        A D D G+   L Y  S       +YF +D        K  G +   ++ R   P +    + ATD     L G   + + V+D N+++PV      D  L +       +++ EN  I   +     SDLD+G N        S  S  I+S  + D L+    I VI                D EE++   + +   D G P  +    + + + D N+  P        + I E+  P T +  + V+DRD          LT      L      ++S+           LD E +      V A + G  S  ++A VSV V DVNDN P F+       V+EN      I  + A D D++ N+ ++Y L+        R + E+       ++  +G +Y    LD+EE +L    V   D+G PPL +     + V+D NDN P    P +      V  +  +++    V+ +VRAVD DS     + Y L       +  F +   TGEI+  R
Sbjct:  119 VDVEVKDINDNPPVFPATQRNLFIAESRPLDSRFPLEGASDADIGENALLTYRLSP-----NEYFFLDVPTSNQQVKPLGLVLRKLLDREETP-ELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPVF-----DRTLYT-------VKLPENVSIGTLVIHPNASDLDEGLNGDIIYSFSSDVSPDIKSKFHMDPLS--GAITVI-------------GHMDFEESRAHKIPVEAVDKGFPPLAGHCTVLVEVVDVNDNAPQLTLTSLSLPIPEDAQPGTVITLISVFDRDFGVNGQVTCSLTPHVPFKLVSTFKNYYSL------VLDRALDRESVSAYELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAGDADAQKNALVSYSLVE-------RRVGERALSSYISVHAESGKVYVLQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRVGGTGGAVRELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPVAAGASIPFRVGLYTGEISTTR 635          

HSP 3 Score: 93.9745 bits (232), Expect = 5.821e-18
Identity = 116/501 (23.15%), Postives = 209/501 (41.72%), Query Frame = 2
Query:  248 SFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEID----RETVCQLNLIKRN-----ENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLS---QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSS---GADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIE-VSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVY 1696
            + KL EN SIGT+V + N S            L+   +    +S S +     +K+ F ++  SG +  I  +D    R     +  + +       +CT+L              +E++D+NDNAP     SLS+ + E ++  + I L    D D      +  ++      + PF L    +N   L+L+R++D E+   Y++V+ A D G PSL    +V + + + ND +P F +  YT  + E+   G  + +  A D D  K   + YS      G   +  Y S+  ++G++ +++  +  +    +F + A D    PL     + + V+D N+++P +L   +            V E V  +      +A +   D D G N+  S  +Q +     +  F++   + T E S  + L     D  +     L +L  DHGEP  +A   + + + +  +      +    I       PET +  V VY
Sbjct:  248 TVKLPENVSIGTLVIHPNAS-----------DLDEGLNGDIIYSFSSD-VSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTVL--------------VEVVDVNDNAPQLTLTSLSLPIPEDAQPGTVITLISVFDRDFG----VNGQVTCSLTPHVPFKLVSTFKNYYSLVLDRALDRESVSAYELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAGDADAQKNALVSYSLVERRVGERALSSYISVHAESGKVYVLQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRVGG------TGGAVRELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPVAAGASIP-FRV--GLYTGEISTTRAL-----DETDAPRHRLLVLVKDHGEPSLTATATVLVSLVESGQAPKASSRASLGI-----AGPETELVDVNVY 699          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9UN72|PCDA7_HUMAN (Protocadherin alpha-7 OS=Homo sapiens OX=9606 GN=PCDHA7 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 5.607e-61
Identity = 193/709 (27.22%), Postives = 329/709 (46.40%), Query Frame = 2
Query:  194 LVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSL----KNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTI-LQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQ--HLHKSNFPFSLSQ-NPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT--------DPGSTWFSI-DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKF-------SLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVD 2239
            L+L + +L + +A   ++ + + E    G  VG I   AQ        L LE +E           R  R++     +L ++N  +G L   S IDRE +C      R+  C+I L+++    L   +V++E+ DINDN P F     ++ ++ES  + S+  LE   D D  +   + YR+        + P S  Q  PL L+L + +D E      ++L A D GKP L G   ++I + + ND +P+F R+ YT  + E+  IG +V+ P A D D+G  G++ YSFSS  + ++K  F +D  +G I++I    F +    K  ++A DK   PL G   + + VVDVN+++P + +  +   +    Q  TVI              I+V D D G N + +C +   +       FK+++      ++ Y L+ D + D E    + L +   D G P   A   + + + D N+  P F Q  Y +++KEN  P  ++ TV   D D  ++ ++  +           S++ S+  +SG +     LD+E+++ L F V A + G+    S+  + V+V+D NDN P         +  + R  V  ++   + + K+ A D DS  N+ L+Y L    +     SI    F +   TG I +   LD  +   + + V V D G P L+      + +V+
Sbjct:   14 LLLFIIILAAWEAGRGQLHYSVPEEAKHGNFVGRI---AQ-------DLGLELAELVP--------RLFRAVCKFRGDLLEVNLQNGILFVNSRIDREELC-----GRSAECSIHLEVIVERPLQVFHVDVEVKDINDNPPVFPATQRNLFIAESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPVFDRTLYTVKLPENVSIGTLVIHPNASDLDEGLNGDIIYSFSSDVSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTVLVEVVDVNDNAPQLTLTSLSLPIPEDAQPGTVI------------TLISVFDRDFGVNGQVTCSLTPRVP------FKLVSTF----KNYYSLVLDSALDRESVSAYELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAGDADAQKNALVSYSLVELRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRVGGTGGAVRELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPVAA---GASIP---FRVGLYTGEISTTRALDETDAPRHRLLVLVKDHGEPSLTATATVLVSLVE 671          

HSP 2 Score: 115.931 bits (289), Expect = 9.935e-25
Identity = 142/560 (25.36%), Postives = 223/560 (39.82%), Query Frame = 2
Query:  881 VIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSID--------KKTGQI--SIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGEN--------SRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFS-IDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDN---VMNISLQNIRDS-VLTRVRAVDNDSDKYNVVHYFLH----NHNDIFEINHLTGEITFKR 2449
            V + + + ND  P+F  +     I E   +        A D D G+   L Y  S       +YF +D        K  G +   ++ R   P +    + ATD     L G   + + V+D N+++PV      D  L +       +++ EN  I   +     SDLD+G N        S  S  I+S  + D L+    I VI                D EE++   + +   D G P  +    + + + D N+  P        + I E+  P T +  + V+DRD          LT      L      ++S + DS        LD E +      V A + G  S  ++A VSV V DVNDN P F+       V+EN      I  + A D D++ N+ ++Y L+       A S       ++  +G +Y+   LD+EE +L    V   D+G PPL +     + V+D NDN P    P +      V  +  +++    V+ +VRAVD DS     + Y L       +  F +   TGEI+  R
Sbjct:  119 VDVEVKDINDNPPVFPATQRNLFIAESRPLDSRFPLEGASDADIGENALLTYRLSP-----NEYFFLDVPTSNQQVKPLGLVLRKLLDREETP-ELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPVF-----DRTLYT-------VKLPENVSIGTLVIHPNASDLDEGLNGDIIYSFSSDVSPDIKSKFHMDPLS--GAITVI-------------GHMDFEESRAHKIPVEAVDKGFPPLAGHCTVLVEVVDVNDNAPQLTLTSLSLPIPEDAQPGTVITLISVFDRDFGVNGQVTCSLTPRVPFKLVSTFKNYYSLVLDS-------ALDRESVSAYELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAGDADAQKNALVSYSLVELRVGERALS---SYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRVGGTGGAVRELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPVAAGASIPFRVGLYTGEISTTR 635          

HSP 3 Score: 89.7373 bits (221), Expect = 1.148e-16
Identity = 115/501 (22.95%), Postives = 206/501 (41.12%), Query Frame = 2
Query:  248 SFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEID----RETVCQLNLIKRN-----ENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLS---QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSS---GADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIE-VSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVY 1696
            + KL EN SIGT+V + N S            L+   +    +S S +     +K+ F ++  SG +  I  +D    R     +  + +       +CT+L              +E++D+NDNAP     SLS+ + E ++  + I L    D D      +  ++        PF L    +N   L+L+ ++D E+   Y++V+ A D G PSL    +V + + + ND +P F +  YT  + E+   G  + +  A D D  K   + YS      G   +  Y S+  ++G++  ++  +  +    +F + A D    PL     + + V+D N+++P +L   +            V E V  +      +A +   D D G N+  S  +Q +     +  F++   + T E S  + L     D  +     L +L  DHGEP  +A   + + + +  +      +    I       PET +  V VY
Sbjct:  248 TVKLPENVSIGTLVIHPNAS-----------DLDEGLNGDIIYSFSSD-VSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTVL--------------VEVVDVNDNAPQLTLTSLSLPIPEDAQPGTVITLISVFDRDFG----VNGQVTCSLTPRVPFKLVSTFKNYYSLVLDSALDRESVSAYELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAGDADAQKNALVSYSLVELRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLAPRVGG------TGGAVRELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPVAAGASIP-FRV--GLYTGEISTTRAL-----DETDAPRHRLLVLVKDHGEPSLTATATVLVSLVESGQAPKASSRASLGI-----AGPETELVDVNVY 699          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q5DRE1|PCDC2_PANTR (Protocadherin alpha-C2 OS=Pan troglodytes OX=9598 GN=PCDHAC2 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 7.804e-61
Identity = 183/691 (26.48%), Postives = 328/691 (47.47%), Query Frame = 2
Query:  242 EISFKLVENCSIGTIVGNIN--LSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI---QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSS-GADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDN-----FPKFSLASKRFEV-EENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVD 2239
            ++ + + E  + G +VGN+   L  +L       L++              N  G       +++ +SG L     IDRE +C+    +R      L++++ N +    V +EI+DINDN+P F + +  + +SES    ++ ++E   D D        Y +   +H      P   +   L+L+L + +D E    + +VL A D G P+  G   + + + + ND SP F +S Y   + ED+  G +V+   A D D+G  GEL YS SS  +D  ++ FSID  TG++ +I    + + + ++  ++ATD+ P P+ G   + + +VDVN+++P +++  + S +      +T++            A ++V+D D G N + S  +++ +    LN F           + Y L+     D E    +++ +   D G PQ +++  +++ I D N+  P+F ++ Y IYI+EN  P   + TV+  D D          L +  I  L  P +++ SI+  SG++      DYEK ++    V A ++G    +S+   +VYV+D+ND+     +P  + +S  FE+        Y + K+ A D DS  N+ L Y+L  T+        +  LF++   TG I +   +  E    +++TV V D+G P LS      + VVD
Sbjct:   43 QLRYSVPEEQAPGALVGNVARALGLELRRLGPGCLRI--------------NHLGAPSPRYLELDLTSGALFVNERIDREALCE----QRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAPEVVLTDLYSPVPENATPNTIV------------AVLSVNDQDSGPNRKVSLGLEATL-PFRLNGFG----------NSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGL--PVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGNPPLSSTGTANVYVVDMNDHAPHILYPSSTNSSAAFEMGPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTS--------DLDLFKVELHTGEIRTTRKMGDESGSTFNLTVVVRDNGEPSLSASVAITVAVVD 682          

HSP 2 Score: 125.561 bits (314), Expect = 1.014e-27
Identity = 146/584 (25.00%), Postives = 254/584 (43.49%), Query Frame = 2
Query:  878 TVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQ-----ISIIKRFN----QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIY--IKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIV---LDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEEN-LKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLF-ELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDS----VLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEI-TFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDR 2560
             V + I + ND SP F R NY   ++E    G       A D D G      Y  S       ++F +D K  Q     + ++ R      Q       + A D       G   I + V+D N++SP        +F  S ++    +++ E++     +  +  SD D+G N      + S  +      F I       + S  ++      D EE   + + +   D G    +   K+ + I D N+  P  +  L ++Y  + EN +P T V  + V D+D   +R + L    +  F ++  G   T +V   LD E++   +  V A + GI   TS   + V + D+NDN P F   S    ++EN L G   +  + A D D + N+++ Y LL    E   + +    +  +N  +G +Y+  + DYE+   + +TV+  D G PPLS+     ++VVDMND+ P   YP+  ++     +   R +    ++T+V A+D+DS +   + Y L   +  D+F++   TGEI T +++  + G  T  L  +  ++     S S+ + +   DR
Sbjct:  133 AVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSP-----SEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSP--------AFDQSTYR----VQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSI-------DASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAP--EVVLTDLYSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGLEATLPFRLNGFGNSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVL-LCTVQATDPDEKENAEVTYSLL----EREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGNPPLSSTGTANVYVVDMNDHAPHILYPSSTNSSAAFEM-GPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFKVELHTGEIRTTRKMGDESGS-TFNLTVVVRDNGEPSLSASVAITVAVVDR 683          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A210PLF4 (Protocadherin-9 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12664 PE=4 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 2.257e-78
Identity = 230/776 (29.64%), Postives = 378/776 (48.71%), Query Frame = 2
Query:  176 MWIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMW-IYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSL-------SQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSS-GADEVKKYFSIDKKTGQISIIKRF--NQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD--LTQSRILDLTDPGS--TWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITFKR 2449
            M  +  LVL+L L  +S     EI + + E       +GN+   AQL   +  +++L         +SL     G     LF IN  +  L T S +DR+ +CQ        N  +  I  +N     I V++ +IDINDN P F +  +++ +SE+S       LE   D DS Q     Y+I+    +N PF+L        +  L+L++++ +D E +  Y V + A D G     G  T+ I IT+ ND  P F ++ Y   I ED     ++L+  A D D+ + G + Y  SS  +DE+++ F +   TG++S+I      + T ++  ++A+D A  PLI +  +++ V D +N++P I VN +     +        EVSE+  I   LA I+V D D G+N   +C I         N F+++     +    Y  + D+  D E T++ ++ + C D+G P+ +  ++I + + D N+  P F + +Y + + EN +P + +  V+  D D  +  S    LT P    T+F I+ +SG I+  I LD E   +++F V A + G  S T SA V V VID NDN PKF+  S  F + EN      +GK+ A D D+  N ++++ L + T       I      L    G I    TLD E    Y+ TV   D G  PL++     + + D+NDN PI  +P+I  +++ +S   + ++++  ++A DND D    + YF  N N   +F +N  TG+++  R
Sbjct:    1 MDCITPLVLMLVLTVTS---CYEIVYNIAEEQGQDLYLGNVASDAQLITGNGSKIEL--------RYSLLTQ--GNRDALLFHINERTSSLYTASVLDRDDLCQFTSSDCILNLEVTAISPINDFFEKIKVHVRLIDINDNEPTFPESQITMEISENSGQGKSFPLEGATDEDSGQNAVQGYKIE---TANVPFTLETTDFAGGRALLRLVVDQELDRETRSKYTVTIAATDGGTEPKTGTVTLHITITDVNDNPPKFPKAVYNRTIPEDIVPNNVILTFNATDPDENENGRVLYRLSSHQSDEIRRLFKVGLTTGELSVISSLIDERSTSYRIIVEASDNASQPLISQAQVYVSVQDTHNNAPEITVNVLSQSYYA--------EVSESAAIGTVLAIISVKDPDSGQNGVVTCSIND-------NNFRLV----VDSPYEYNFVLDQILDREMTEWHTVVVECRDYGTPRLNTSSRILVRVLDINDNPPQFTKAIYYVNVPENDAPNSGILQVQATDSDSIVPSSYNYSLTLPEEYKTFFRINKNSGVITAIISLDREATPRITFGVFAEDGGSPSLTGSALVEVNVIDRNDNSPKFTPTSFEFVIPENQVPNVSVGKLTAHDSDAGNNGEVSFSLTSNT------DIYLPFDVLR--NGTILGTRTLDRELIAKYNFTVIAYDHGSSPLTSTADVTVIIQDINDNAPIITFPSISGDLLYVSSDTLPNTIIATIKAYDNDDDVNAKLSYFAENSNMTRLFSVNKFTGQLSLSR 733          

HSP 2 Score: 112.079 bits (279), Expect = 4.418e-21
Identity = 146/626 (23.32%), Postives = 269/626 (42.97%), Query Frame = 2
Query:  446 LVTISEIDRETVCQLNL-IKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSN-----FPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMF----YRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYS-----FSSGADEVKKY-FSIDKKTGQISIIKRFNQPTKF-KFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST----WFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKF---SLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDN 2251
            LV   E+DRET  +  + I   +  T        K   + ++I I D+NDN P F +   + ++ E     + I      D D ++   + YR+   H+S+     F   L+   L +I   S+  E    Y++++ A DN    L     V +++ + ++ +P         +Y A ++E   IG ++      D D G+ G +  S     F    D   +Y F +D+      I+ R  + T++    ++  D     L   + I + V+D+N++ P         F  + +     + V EN+     +  +  +D D    S  S +    + +++  +F+I      N   I  ++   S D E T   +  +   D G P  +    +E+++ D N+  P F    +E  I EN  P  +V  +  +D D   +  +  +   +T     F +  +GTI     LD E I K +F V+A + G    TS+A V+V + D+NDN P     S++     V  +      I  I A+D D ++N+KL+Y+     +EN+  +   +LF +N  TG +  +  + + +   Y +++ V D  +PP S  +   + + D + N
Sbjct:  194 LVVDQELDRETRSKYTVTIAATDGGT------EPKTGTVTLHITITDVNDNPPKFPKAVYNRTIPEDIVPNNVILTFNATDPDENENGRVLYRLSS-HQSDEIRRLFKVGLTTGELSVI--SSLIDERSTSYRIIVEASDNASQPLISQAQVYVSVQDTHNNAPEITVNVLSQSYYAEVSESAAIGTVLAIISVKDPDSGQNGVVTCSINDNNFRLVVDSPYEYNFVLDQ------ILDR--EMTEWHTVVVECRDYGTPRLNTSSRILVRVLDINDNPP--------QFTKAIY----YVNVPENDAPNSGILQVQATDSDSIVPS--SYNYSLTLPEEYKTFFRI----NKNSGVITAII---SLDREATPRITFGVFAEDGGSPSLTGSALVEVNVIDRNDNSPKFTPTSFEFVIPENQVPNVSVGKLTAHDSDAGNNGEVSFSLTSNTDIYLPFDVLRNGTILGTRTLDRELIAKYNFTVIAYDHGSSPLTSTADVTVIIQDINDNAPIITFPSISGDLLYVSSDTLPNTIIATIKAYDNDDDVNAKLSYF-----AENSNMT---RLFSVNKFTGQLSLSRQVSHSDIGTYDLSILVQDGAKPPRSRFRTLTVIITDSSRN 773          
BLAST of Protocadherin-9 vs. TrEMBL
Match: V4AB09 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_105112 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 3.337e-78
Identity = 227/764 (29.71%), Postives = 382/764 (50.00%), Query Frame = 2
Query:  242 EISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMW-----IYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSL-------SQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGAD-EVKKYFSIDKKTGQISIIK--RFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSR--CSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRI----LDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND--IFEINHLTGEITF-KRLNI 2458
            E SF LVE+    TIVGNI  ++++    N+   L  SE F        N    S+ +LF IN  + D+ T+ +IDRE VC+         C I   + ++ L+      + V I I D+NDN P F ++ +++ + E+    S   +    DLD  Q   +Q   + +  +N  F L         + L+++++  +D E K +Y+  ++A D G+P L GN TV +NIT+END SP F    Y   + E+T I  ++    A D+D    G++ Y FS+  + +++K F+++  +G I++    ++    +F+  ++A D+   P +G+  + L ++DV N+ P+I VNP+   +        +I + E  RI   +A + + D DQG N    CSC  +         YF +  +    E   Y +   K  D E      + ++C D G P+ SA TK  I + DEN+  P F + +YE  ++EN   +  +  V   D DL ++ I    L L D G   F I+ ++G I    V + E I ++SF VLAI+ G    T +A V V +ID NDN PKFS A+  F V E+ +   E+G +HA D D   N+ + Y ++ +       S+   +F    + G+I ++  LD+E    ++  +   D G PP +      ++V D ND+ P+  +P  ++N + I       +V++RV A D+D+ +  V+ +++++ N+  +F I   TGEI   KR+ I
Sbjct:    2 EASFHLVESEPPETIVGNI--ASKI----NIARGLSKSE-FNSLRYSFLNPNDDSIASLFNINPENSDVSTVEKIDREKVCEFT-----SECVITFDIKISSLVTSFFEIVTVKIIIDDLNDNPPKFPELEITVFIPENVNPGSTYRINGATDLDRGQNNSVQL-YEMVSSANL-FDLKVDKKLDGTSDLRIVVKNVIDREKKHYYRFFIVAKDGGRPPLSGNVTVNVNITDENDNSPEFTEEIYDVSVTENTPIYSVIAKIHAIDRDSDSNGKVSYRFSTLKNPDIEKLFALNPLSGDITVKNELQYQSGKQFETIVEAFDQGTPPQVGQAKLILRIIDVGNNPPIITVNPVSDVV------GDMILLPEGARIGTVVAHVNIDDKDQGPNGDVLCSCLHE---------YFSVHKL----EGRGYIVQVKKPLDRELVDELKVTVVCRDSGTPRLSARTKFRIKLTDENDNPPIFTKRVYETTLEENNVIDRPLIRVSAVDDDLGRNAIVHYRLKLDDQG--MFKINTNTGEIVANDVFNRETISEMSFTVLAIDEGTPPMTGTAEVLVRIIDQNDNSPKFSPAALIFSVREDTRAGGEVGMLHATDADFNFNADIEYTMIVS-----GDSLPFVVF----SNGVIRTDRELDFESQKRFTFKIIAKDKGSPPRNTTATVTVYVSDSNDHSPVIVFPTDNNNTVTIRSDIEPGTVISRVVASDSDAGENAVLSFYINSGNEQNMFHIGTKTGEIVLAKRIRI 721          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A2H5BFB8 (Pcd11x OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.538e-75
Identity = 227/771 (29.44%), Postives = 372/771 (48.25%), Query Frame = 2
Query:  197 VLILNLLFSSKAMLK--EISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENC-TILQIVSVNK-----LMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLS-------QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGA-DEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDL---TDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDND-SDKYNVVHYFLH-NHNDIFEINHLTGEIT 2440
            V+++ L+ S+ A     E+++ ++E    GT VGN        V  + ++Q   S+           RF    +  F IN S+G + T   IDR+ +C      R + C  IL +V+        L  I V + I DINDN P F    +S  + ES+       +   +D DS QF    Y    L  S+  F LS          ++LIL+ S+D E+   YQV ++A D G P   G+  V I + + ND  PMF  + Y   I E+   G  +    A DKD G +G++ YSFSS   D     F I   TG+I +    +  T   +   + A D+  + +     + + V+DVN+++P+I VN +            V EV EN      +A +TV+D D G+N + +C +    N D     +  +       S YK++  K  D E    ++L++LC D G+    AI +++I + D+N++ P F Q+ YE  + EN      +  V   D+D  ++ ++D     D G  +     +GT+S + VLD E+ +++ F V+A +RG    + +A V V V DVND  P F+ ++  F V EN      +G +HA D D++  ++  Y +L   S  N+       F ++P TG I +   LD E+  +Y + +   D G PP+S+     I+V D NDN P++++P+  +N ++IS Q  +  ++T+V+A+D D     N+ +Y    NH + F ++ + G IT
Sbjct:   16 VMVVALMRSAMAQDSQLELTYSILEEDMEGTFVGN--------VLRDSRIQDRYSKSILTQLEF---RFIAKPRVPFLINKSTGVIRTDGRIDRDALC-----PRQDTCRVILDVVAFTPGQTQFLEIIKVKVNIEDINDNWPHFPDARISHQILESAVPGYGFVIPTAIDPDSGQFSVRDYE---LVSSSDKFELSVKTKLDGSTDVRLILKDSLDREDVDFYQVRVVAYDGGNPPKSGSVDVNIIVQDANDNDPMFTNATYEVTIAENAAPGTTLTKVHASDKDAGLYGQIRYSFSSRTQDTHGAVFGIKNTTGEIYVKGEVDYETSPVYHLVVLADDRGSDTIPAEATVIVRVLDVNDNAPLITVNTLTQ------AGTEVAEVVENADPETFVAHLTVTDPDNGKNGKFNCSL----NDDSFRLQQFFD-------SEYKIVTRKKLDRETHDKYNLSVLCQDFGDEPLVAIKRLQIIVTDDNDHAPVFSQSTYEASLTENNHIGVFITRVNATDKDSGENGLIDYKLHPDAGGDFHVDGLTGTVSARAVLDREQTQQIRFRVIASDRGQPRKSGTATVIVNVQDVNDEKPMFAQSAYSFGVYENEPEGTSVGTVHAVDPDTDPYNQFQYSILPGHSAENS-------FAIDPHTGKITTTTVLDREDKPVYYLLIMASDKGVPPMSSTATVSIYVADKNDNPPVFEFPSDTNNTISISNQVPKGYLVTKVKAIDRDIGGNANLTYYISRGNHLNFFHMDPIFGVIT 743          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A210PLD8 (Protocadherin-11 X-linked OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12667 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 2.432e-74
Identity = 231/780 (29.62%), Postives = 385/780 (49.36%), Query Frame = 2
Query:  173 FMWIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIY----VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQN-------PLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRF-NQPTK-FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDH--LNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSR--ILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITFKR 2449
            F+ +  FL+ +L          K++++ L E       +GN+   A L   +     L NS  +    + S+N    SL +LF IN     L T  ++DRE +C+     ++E    L++++ +    +Y    V+I ++DINDN+P+F   S++  +SE S     I +E   D D+  F  IQY I  L   + PF++           ++++L+  +D E    Y+V +IA D G+P   G   VIIN+ + ND  P F    Y   +NED  +   + +  A D D G+ G + Y  S   A+++   F+ID+ +G + I+     +P K +   ++A+D A  PLI ++ +F+HV+DV+N+ P I ++P+         N    E+ EN  +   +A IT+ D D G+N   +C   S++N D   L  F +           YK++  ++ + E    + + + C+D G PQ +A     +H+ D N+  P F Q  Y + ++EN S  ++V  V   D D  ++   +  L   G  +F I + SG I+   VLD E + ++SF+V A ++G  S T SA+V + V DVNDN P+F   +  + +EEN      IG + A D+D   NS++ Y +      N    I    F + P   I+ + V +D E    Y  TV   D G P L N     + V+D+NDN P + +PN H+N + IS Q   +++++ V   D D    + V YF+ + N   IF++N+L+G I   +
Sbjct:    6 FLSLDLFLICVLCTCMVPGVGAKDVAYFLAEEEQANFYLGNVAADADLASEATNPADL-NSMKYS-FLTQSNNNEENSLVSLFHINERQSSLYTAQQLDRENLCEY----KDECVLELEVIARSTSGSLYKKIKVSITLLDINDNSPSFSVPSITRDISEGSLTGFYIPIEAAKDADTGNFS-IQYYI--LEPPSSPFTVGYQEFVDGTYSVRIVLDGQLDRETTSSYKVNVIARDGGEPPKTGVLEVIINVLDINDNRPRFNTQMYNVTVNEDVAVNTTITTVFADDPDQGENGRVTYKLSPNQAEKIPTLFTIDESSGDVIIVGSLIYEPGKSYTIIVEASDNALQPLISQSKVFIHVLDVHNNPPEISIDPL--------SNTEDSEILENAILDTAVAHITIFDPDTGKNGIVNC---SVVNSDKFTLQRFAVHE---------YKVVLSQALNREIKDRYEVTVHCHDIGTPQLNASAMFVVHVMDINDNTPKFTQQQYFVSVQENKSLTSSVMQVAANDFDNGKNAEVMFSLDSEGQKYFRISETSGVITVNSVLDRETVSQISFSVFAADKGSPSLTGSAQVRMIVTDVNDNKPEFMEDTFEYNLEENNHVNINIGVLVANDKDDGNNSQITYSI----HPNYHAGIP---FAIMPNGSILATQV-IDREAKARYDFTVIAEDMGNPSLRNSAHVTVFVLDVNDNNPEFVFPNAHNNTVVISYQTPVNTIVSTVETRDIDEGMNSRVTYFMKDKNFSHIFKLNNLSGRIVLDK 748          

HSP 2 Score: 112.079 bits (279), Expect = 4.506e-21
Identity = 136/609 (22.33%), Postives = 257/609 (42.20%), Query Frame = 2
Query:  446 LVTISEIDRETVC--QLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFP--FSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKA------FDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD-LTQSRILDLTDP---GSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKR-------FEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPP 2200
            +V   ++DRET    ++N+I R+            K   + V I ++DINDN P F     +++++E   V + I      D D  +   + Y++        P  F++ ++   +I+  S+ YE  K Y +++ A DN    L     V I++ + ++  P       +    ED++I E  +   A      FD D GK G +  S  +      + F++ +   ++ + +  N+  K  ++ ++   D     L       +HV+D+N+++P             KF Q    + V EN  +   +  +  +D D G+N+     + S   K    YF+I         +   +  +   D E     S ++   D G P  +   ++ + + D N+ +P F ++ +E  ++EN     N+  +   D+D    S+I     P       F+I  +G+I    V+D E   +  F V+A + G  S  +SA V+V+V+DVNDN P+F   +         ++   N      +  +   D D  +NS++ Y++ +    +        +F+LN  +G I  +  L   +   Y+  +   D G PP
Sbjct:  210 IVLDGQLDRETTSSYKVNVIARDGG-------EPPKTGVLEVIINVLDINDNRPRFNTQMYNVTVNEDVAVNTTITTVFADDPDQGENGRVTYKLSPNQAEKIPTLFTIDESSGDVIIVGSLIYEPGKSYTIIVEASDNALQPLISQSKVFIHVLDVHNNPPEISIDPLSN--TEDSEILENAILDTAVAHITIFDPDTGKNGIVNCSVVNSDKFTLQRFAVHEY--KVVLSQALNREIKDRYEVTVHCHDIGTPQLNASAMFVVHVMDINDNTP-------------KFTQQQYFVSVQENKSLTSSVMQVAANDFDNGKNAEVMFSLDSEGQK----YFRI-------SETSGVITVNSVLDRETVSQISFSVFAADKGSPSLTGSAQVRMIVTDVNDNKPEFMEDTFEYNLEENNHVNINIGVLVANDKDDGNNSQITYSIHPNYHAGIPFAIMPNGSILATQVIDREAKARYDFTVIAEDMGNPSLRNSAHVTVFVLDVNDNNPEFVFPNAHNNTVVISYQTPVNTI----VSTVETRDIDEGMNSRVTYFMKDKNFSH--------IFKLNNLSGRIVLDKALTVADAKKYTFGIIAQDKGTPP 771          
BLAST of Protocadherin-9 vs. TrEMBL
Match: V4ACR2 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_139015 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 8.518e-74
Identity = 225/769 (29.26%), Postives = 381/769 (49.54%), Query Frame = 2
Query:  194 LVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTI--SEIDRETVCQLNLIKRNENCTI-LQIVSVNKL--MWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQ-YRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGAD-EVKKYFSIDKKTGQISIIKRF-NQPTK-FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLT-QSRI-LDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDI--FEINHLTGEI 2437
            ++++L++ +  +    ++++ + E   + T++G+I     L   +N+Q  +++ +    H   +    G ++ +LF +++ +G L     S +D ET+C        E C I L +V  + L  ++  V+I++I  D+NDN P F   ++++ +SE+  V + I LE   D D  +   +Q Y I+  + + F  S  +N      L L+++  +D+E    Y + ++A D G P L G  TV + IT+ ND  P F + NY+  ++E+     +++  +A D+D G+ G++ Y  SS  D ++   F ID ++G IS+     N+ T+ +   ++A D A  P   ++ + + V DV N  P + VN +    IS++ N           I   +A + V + D+G N   SC ++      +  YF +    +  +   YK++  +  DAE     +++I+C D G P  S     EI I DEN+  P F + LY   IKEN     +V TV+  D D     R+   L    +  F I  D G I + +  DYE  K  +F V+A ++G    ++S  VS+ + D+ND  P+FS      EV E  K    +  I AFD +S  N  L Y+LLN T      SI   +F      G +  +  LDYE+   Y   V  +D G PPL+      I V+D NDN PI  +PN+   ++N++  + + +V+TR+R +D DS     +HY + + ND   FEIN  TGE+
Sbjct:   11 ILVVLSIFY--QVHCTDLTYTIPEEQPVNTVIGHI-----LNDTANLQGAIQDKD--VPHLKFTFLSEGNAVTSLFALDSQTGQLAVGPDSTLDSETICPFY-----EKCHIKLDVVIQSPLNDLFRKVSIKVILEDVNDNPPTFPNDAITVDVSEAVLVGASIPLEGASDRDMGKNNSLQSYEIEPRNDA-FGLSFRKNLDGTSYLNLVVQGELDHEKVSSYSLRVVAKDGGDPQLQGVMTVNVTITDVNDNVPKFKKDNYSVSVDENVTQNSVIIQVQAVDRDSGENGQISYKLSSHQDTKITTLFKIDPESGDISVKSDLQNEATEIYNIIVEAIDHALQPFTSQSVVTVTVRDVINSPPKLTVNMLSGATISEYAN-----------IGAAVAHVAVKESDRGRNGIVSCDLK------NTTYFNL----QGFDLDEYKIIVAQPLDAELVTSLNIDIVCEDAGSPPLSVTHSFEITITDENDNSPIFVKPLYTGTIKENNREGQSVVTVRASDEDAGLNGRVKYSLGSDATDNFRISQDGGVIRSNVPFDYETQKFANFTVVAYDQGTPKRSASTIVSIKIEDINDEAPRFSKEQFSVEVSEYAKPGEFVAVIKAFDFESGKNGDLMYFLLNKTP-----SIPFTMF----VNGSMVLDEALDYEKKQAYEFKVMAVDKGEPPLNTTTNVVIQVLDENDNKPIISFPNVPKYLVNVTFSDKKSTVITRLRVIDLDSGLNGQLHYVITSRNDSGRFEINAKTGEL 734          

HSP 2 Score: 142.124 bits (357), Expect = 1.990e-30
Identity = 164/669 (24.51%), Postives = 293/669 (43.80%), Query Frame = 2
Query:  296 INLSAQLFVFSNVQLQLENSEDFKEHHSLS-------HNRFGRSL-KNLFKINNSSGDLVTISEIDRETVCQ--LNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKH--YQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYT-AIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLAS-KRFEVEENL--KGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMN 2245
            +++S  + V +++ L+  +  D  +++SL        ++ FG S  KNL     S  +LV   E+D E V    L ++ ++     LQ V       + VN+ I D+NDN P F++ + S+S+ E+    S I   + VD DS +   I Y++     +        +P    +    D +N+    Y +++ A D+          V + + +  +  P    +  + A I+E   IG  V      + D G+ G +     +      + F +D+    ++        T     I   D    PL       + + D N++SP I V P+ +  I            ENNR    +  +  SD D G N R    + S    D  + F+I     + +  + +  ++  FD E  K+ +  ++ YD G P+ SA T + I I+D N+  P F +  + + + E   P   V  +K +D +  ++  L    L    S  F++  +G++     LDYEK +   F V+A+++G     ++  V + V+D NDN P  S  +  ++ V      K    I ++   D DS +N +L+Y +   TS N++       FE+N  TG +++  + DYE+ DLY + + V D+G PP ++    FI +   N
Sbjct:  148 VDVSEAVLVGASIPLEGASDRDMGKNNSLQSYEIEPRNDAFGLSFRKNLD--GTSYLNLVVQGELDHEKVSSYSLRVVAKDGGDPQLQGV-------MTVNVTITDVNDNVPKFKKDNYSVSVDENVTQNSVIIQVQAVDRDSGENGQISYKLSSHQDTKITTLFKIDPESGDISVKSDLQNEATEIYNIIVEAIDHALQPFTSQSVVTVTVRDVINSPPKLTVNMLSGATISEYANIGAAVAHVAVKESDRGRNGIVSCDLKNTTYFNLQGFDLDEYKIIVAQPLDAELVTSLNIDIVCEDAGSPPLSVTHSFEITITDENDNSP-IFVKPLYTGTIK-----------ENNREGQSVVTVRASDEDAGLNGRVKYSLGS----DATDNFRI-----SQDGGVIR--SNVPFDYETQKFANFTVVAYDQGTPKRSASTIVSIKIEDINDEAPRFSKEQFSVEVSEYAKPGEFVAVIKAFDFESGKNGDLMYFLLNKTPSIPFTMFVNGSMVLDEALDYEKKQAYEFKVMAVDKGEPPLNTTTNVVIQVLDENDNKPIISFPNVPKYLVNVTFSDKKSTVITRLRVIDLDSGLNGQLHYVI---TSRNDSGR-----FEINAKTGELFTTKSYDYEDIDLYRLVITVKDNGAPPFADHTTVFIKLSQGN 776          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh7a (protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-1])

HSP 1 Score: 254.988 bits (650), Expect = 1.137e-69
Identity = 219/791 (27.69%), Postives = 348/791 (43.99%), Query Frame = 2
Query:  230 AMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISE-IDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVN-----IEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLD---------------SDQFQPIQY------------RIQHLHKSNFPFSLS-------------QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPG-STWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITF 2443
            A+   I+ +   +  IG +  ++ LS       +V   LE+  +F                  FKI+N +G+L T S  IDRE + Q  +I     C +   VSV   +  +V+     I + D+NDN P+F    L++S+ E+  + +   L    D D                DQ +P               R +     + P   S             Q   +LI++  +D E +  Y++VL   D G P       + + IT+ ND SP F R+ Y A + E+T  G  VL  +A D+D G  G++EY F +  + V++   +D+ +G +S++ R ++   ++ +F++ A D+   P   R  + L+V D N++ PV+ +  I   L+          V EN  +   +A + VSD DQGEN   +C +   +       F +    E   +  + L      D E T+ +++ I+  D G P  S+ + + + + D N++ PTF Q+L E++  EN +P   V TV   D D  + + I    DP  +  F ID D+G I     LD E+ ++  F V+A ++G  S   SA V V V D NDN PKF      F V+ENL     +G +   D D   N++L  ++     E  A    ++LF +   TG I+S  + D E    Y+  V+ +D G PP S      + V D NDN P    P      +       R  V T V A D D+     + Y L   N   +FEI   +G IT 
Sbjct:   33 ALRYRIAEEGPPDVRIGNVAADLGLSTSGIGTGDVTFALESGAEF------------------FKIDNVTGELTTSSRRIDREKLPQCQMIFDENECFLDFEVSVIGPLQSWVDLFEGRIVVTDVNDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQDSRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEYVFGAATESVRRLLRLDEASGWLSVLHRIDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILV----RDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVP------FTLKPAGENRNKKKFFLHTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADSGKNAEIAYSLDPSVNGAFYIDADNGDIRATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANESYTLLPPASGARTVVRT-VMASDGDAGSNADLRYALVGGNPFQLFEIGPSSGVITL 794          

HSP 2 Score: 121.324 bits (303), Expect = 2.157e-27
Identity = 149/650 (22.92%), Postives = 268/650 (41.23%), Query Frame = 2
Query:  563 VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKS-NFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINED--TQIGEIVL--SPKAF----DKDDGK--------FGELEYSFS-SGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDL--------TDPGST---WFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSL-ASKRFEVEENLKGFYEIGK-IHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPI--WKYPNIHDNVMNISLQNIRD-SVLTRV--RAVDNDSDKYNVVHYFLHNHN 2401
            + + I D+NDN+P F +      + E++   + +      D D      ++Y      +S      L +    L +   +D E     +  + A D G+P      TVI+N+ +END  P+        I+  D    + E VL  +P A     D+D G+         G++ ++   +G +  KK F +       S +  +     +  +I A D     L   + + + VVD+N+H+P        +F  S  + H     +ENN    ++  +  +D D G+N+  +  +   +N     Y    N           + A  + D E+ + +   ++  D G P       + + + D N+  P F Q ++  Y+KEN    + V  V V D D  ++  L L         + G      FSI++ +GTI +    D E     +F V A++ G    +++A VS++V D NDN P  +  A++ + +     G   + + + A D D+  N+ L Y L+             +LFE+ P++G+I     L+     L+ + V+V DSG P L       + + +   N  +   +  ++H          +RD +VL+ V  R  D  S     V+  +H HN
Sbjct:  278 LRVAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEYVFGAATESVRRLLRLDEASGWLSVLHRIDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTLKPAGENRNKKKFFL-----HTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAP--------TFAQSLVEVH----FAENNAPGERVVTVVAADADSGKNAEIAYSLDPSVNGAF--YIDADN---------GDIRATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANESYTLLPPASGARTVVRTVMASDGDAGSNADLRYALVGGNPF--------QLFEIGPSSGVITLAEPLERRHRGLHRLVVRVNDSGVPSLCATALVHVFINESLTNATLVDAQCEHVHQRTGTQRCIVVRDGTVLSEVASRYSDRKSPCCRPVNLLIHIHN 891          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 247.284 bits (630), Expect = 3.770e-67
Identity = 206/739 (27.88%), Postives = 349/739 (47.23%), Query Frame = 2
Query:  419 FKINNSSGDLVTIS-EIDRETV--CQLNLIKRNENCTILQIVSVNKLM------WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSL------SQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHT--VIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITF-KRLNIKPGQL-TLQLQAIDANSKNIHTSQSLIVYI 2545
             +++  +G++ T    IDRET+  C++    + + C +   VSV  L+       I   IE+ DINDN P F    L++S+ E++ + +   + +  D D+++   ++Y +    +++  FSL       +   +LI+  ++D E K  Y + + A D G PS   +  + + IT+ ND +P F +S+Y A ++E++ +G  VL  KA D D G  GE+EY+    +D V K   I++ TG IS+    ++   + FKF + A DK P+P    T++ + V D N+++P + +  I        + H+  V  +SE+  +   +A + VSD D+GEN+  +C    ++  D     +       + +  Y L      D E  + + + I+  D G P  S+   + + + D N+  P F   L+E+   E   P   V  V   D D      L  S I D +  G   F ID  SG +  +  LD E  ++  F V A ++G+ S   +A V + V+D NDN PKF L+S  F V EN+     +G +   D D   N+++   +                F +   TG I S+++ D E+   Y+  +K +D G PP S+     I+V+D NDN P+   P+ + +   +S     DSV+  V A D D      + Y +   N  ++F I+   GEI   K L  K G L  L ++  D    + H    + +Y+
Sbjct:   64 LRVDGKTGEIFTTEIPIDRETLKDCRI----KGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGI------GLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC----VVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRG--LFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGN----------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPS-NSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 775          

HSP 2 Score: 54.6842 bits (130), Expect = 7.115e-7
Identity = 66/256 (25.78%), Postives = 108/256 (42.19%), Query Frame = 2
Query:  404 SLKNLFKINNSSGDLVTISEIDRE---------TVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILER-SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAI-----INEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQ 1126
            S + LF+I+ SSG++   S +DRE         T     +       T++              I+++D NDN P F   S S S+ E+    S + +   +D+D  +   +Q  ++     NF   + QN    IL   S D E +  Y   L A D G+P       V IN+ +END +P+  + + ++      +     + E+V   +A D D G   EL YS + G     + F I    G+I + K   +
Sbjct:  513 STRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVV--------------IKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEP-DVGNF---VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVV---EAEDIDYGSNAELVYSIAGG--NPHELFYISPSDGEIKLTKELTR 745          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 248.44 bits (633), Expect = 6.881e-67
Identity = 222/827 (26.84%), Postives = 381/827 (46.07%), Query Frame = 2
Query:  158 TGINVFM-WIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTIS-EIDRETV--CQLNLIKRNENCTILQIVSVNKLM------WIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSL------SQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHT--VIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEITF-KRLNIKPGQL-TLQLQAIDANSKNIHTSQSLIVYI 2545
            +G+   M + VG+ +L   L+ S  + L  I + + E     T++G++  + Q    S    +LE    +                   +++  +G++ T    IDRET+  C++    + + C +   VSV  L+       I   IE+ DINDN P F    L++S+ E++ + +   + +  D D+++   ++Y +    +++  FSL       +   +LI+  ++D E K  Y + + A D G PS   +  + + IT+ ND +P F +S+Y A ++E++ +G  VL  KA D D G  GE+EY+    +D V K   I++ TG IS+    ++   + FKF + A DK P+P    T++ + V D N+++P + +  I        + H+  V  +SE+  +   +A + VSD D+GEN+  +C    ++  D     +       + +  Y L      D E  + + + I+  D G P  S+   + + + D N+  P F   L+E+   E   P   V  V   D D      L  S I D +  G   F ID  SG +  +  LD E  ++  F V A ++G+ S   +A V + V+D NDN PKF L+S  F V EN+     +G +   D D   N+++   +                F +   TG I S+++ D E+   Y+  +K +D G PP S+     I+V+D NDN P+   P+ + +   +S     DSV+  V A D D      + Y +   N  ++F I+   GEI   K L  K G L  L ++  D    + H    + +Y+
Sbjct:   31 SGLGGVMDFSVGWFLLFALLVDSINSALGGILYHVREEQPPNTLIGSL-AADQGLPDSGHLYKLEVGAPY------------------LRVDGKTGEIFTTEIPIDRETLKDCRI----KGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGI------GLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC----VVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRG--LFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGN----------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPS-NSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 811          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 241.891 bits (616), Expect = 2.835e-65
Identity = 220/805 (27.33%), Postives = 391/805 (48.57%), Query Frame = 2
Query:  191 FLVLILNLLFSSKAMLKEISF----KLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND--IFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
             L  ++  L+   A+ +E+ +    +L EN  IG I  ++N+S       N      N+  ++       N   R + N       +G++ T S  IDRE +C     + +E    +++V +    +  + I+I+  D NDNAP F    ++IS+ E++ + S+  +    D D       +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  S     I E + +G  V+  +A D D G   E++Y F +  +   ++ F+++  TG I++ +  +  +    K S+ A+D + +    R  + ++V DVN+++P I +     ++IS   N TV+ +SE + +  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK +   I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E  ++  F V A + G ++  S A V V ++D NDN PKF+    +F V ENL  +  +G I   D D+  N+ ++  +LN  +EN         F L+P TG+I SNV+ D E+   Y+  V+ +DSG PP S+  +  I+V+D+NDN PI  YP  + +   + L  I  SV+  V AVD D+     + Y + N N+  +F I+ +TG IT +    KP +    L  +  N  ++   +SL   ++
Sbjct:    8 LLATLVACLWLDPAIAQELIYPIREELQENVLIGNIPKDLNISHM-----NTATGASNNLVYRLVSKAGDNPLLRVMSN-------TGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSS--ARATVTINVTDVNDNAPNIDLR----YIISP-TNGTVL-LSEKDPVNTKIALITVSDKDTDVNGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILND-NEN---------FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEE---KPTEADSGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 242.276 bits (617), Expect = 2.945e-65
Identity = 220/805 (27.33%), Postives = 391/805 (48.57%), Query Frame = 2
Query:  191 FLVLILNLLFSSKAMLKEISF----KLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND--IFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
             L  ++  L+   A+ +E+ +    +L EN  IG I  ++N+S       N      N+  ++       N   R + N       +G++ T S  IDRE +C     + +E    +++V +    +  + I+I+  D NDNAP F    ++IS+ E++ + S+  +    D D       +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  S     I E + +G  V+  +A D D G   E++Y F +  +   ++ F+++  TG I++ +  +  +    K S+ A+D + +    R  + ++V DVN+++P I +     ++IS   N TV+ +SE + +  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK +   I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E  ++  F V A + G ++  S A V V ++D NDN PKF+    +F V ENL  +  +G I   D D+  N+ ++  +LN  +EN         F L+P TG+I SNV+ D E+   Y+  V+ +DSG PP S+  +  I+V+D+NDN PI  YP  + +   + L  I  SV+  V AVD D+     + Y + N N+  +F I+ +TG IT +    KP +    L  +  N  ++   +SL   ++
Sbjct:    8 LLATLVACLWLDPAIAQELIYPIREELQENVLIGNIPKDLNISHM-----NTATGASNNLVYRLVSKAGDNPLLRVMSN-------TGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSS--ARATVTINVTDVNDNAPNIDLR----YIISP-TNGTVL-LSEKDPVNTKIALITVSDKDTDVNGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILND-NEN---------FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEE---KPTEADSGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 239.965 bits (611), Expect = 1.350e-65
Identity = 217/775 (28.00%), Postives = 372/775 (48.00%), Query Frame = 2
Query:  242 EISFKLVENCSIGTIVGNINLSAQLFVFS---NVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTI---LQIVSVN-----KLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI---QHLHKSNFPFSLSQ--NPLK---LILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEV------KKYFSIDKKTGQISI---IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVI----LVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSR--ILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITF 2443
            ++S+++ E    G  +GN ++  +L  ++     ++ L  +ED              +   L ++N  +G+L     ++DRE +C        + C +   + ++ V      KL+ + +N+E  DINDNAPAF    L++S+ E++    +  ++   D DS+     +Y +        S F  S+++  N  K   L++ +S+D E ++ Y++ L A D G P   G+  + IN+T+ ND SP+F ++     I E++ +G  V+   A D+D G   E+ Y   +           K+ F +D+ +G +++   + R   P  ++  I ATDK P P+     + + V DVN++SP I    +V P++           VI +SE + +   +A ITVSD D G N   +C+I +         F++  +   N+   Y L   ++ D E    + + I   D G    S    + I + D N+  P F +  Y++ + EN     ++ TV   DRD+ ++   +  L     T F +D ++G IS    LD EK    SF +LA ++GI     +A V V V+DVNDN P+FSLA   F V EN+     +G +   D D   N ++   +L T         N +LF ++P +G+I SNV  D E+   Y + V+  D G P  S+  +  IHV+D+NDN PI   P  +     +  + +  +++T V AVDND++     +Y++V    HN   +F I+ + G IT 
Sbjct:   38 KVSYRVAEELREGAFIGNPSVDLRLADYNLELTYKVMLSKAED--------------AAPPLVRVNPRTGELFAAGRKMDREALCGGQ--DPGDECHVDVQVGVLPVQPGPFFKLIEVRINVE--DINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPV-YRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNG----------VIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVP-----FQLKKLTYPNQ---YLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTD--------NRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHN---LFHIDPVIGNITL 764          

HSP 2 Score: 61.6178 bits (148), Expect = 1.187e-9
Identity = 78/353 (22.10%), Postives = 155/353 (43.91%), Query Frame = 2
Query: 1568 ITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRI----LDLTDPGS-TWFSIDDSGTISTKIV--------LDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNI---HDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLT----------GEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            + ++ I+++D N+  P F   +  + + EN             D D   + +    L  +DP + + F +  + T + + V        LD E+ +    N+ A++ G    + SA + + V D NDN P F  A    E+ EN      + ++HA D D+  N+++ Y L  +T    +    ++LF L+  +G++  N  L+ EE  +Y I +   D G  P+       + V D+NDN P  +  +I    + V+ IS  +  +  +  +   D D      V  +++N    F++  LT            + ++  N    +  +Q++A DA + ++  + S+ + ++
Sbjct:  136 LIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKN----EYVVQIKAADAGATSLSRTMSVTIKLL 484          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 230.72 bits (587), Expect = 5.332e-63
Identity = 189/699 (27.04%), Postives = 322/699 (46.07%), Query Frame = 2
Query:  245 ISFKLVENCSIGTIVGNI--NLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLN---LIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLK---LILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGAD-EVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD----------LTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKR-----FEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSN---VTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDN 2251
            + + L E    GT+VG +  +L  ++    +   +L   +DF                +L  +  + G +     IDRE  C      +I+ +  CT+ + +       ++  +E++DIND+AP F +  + + +SES  + +++ LE   DLD        Y +    +         +  K   L+++  +D E +  Y + L A D G P   G   V I + + ND SP+F +++    + ED   G ++L+  A D D+G  GE+ YSFSS  D EV++ F +D KTG++S+  + +    ++++ SI+A D  P+ +     + +HV D+N+++P I ++      I + +  TV  VSE       +  +TVSD+D  EN   +CH+     + H  +FK++       R  Y ++ + S D E+   + L +   D G P   A  +  + + DEN+ +P F ++ YE  + EN SP   V TV  +D D          + +S +   +   ST+ SI+  SG I     LDYE +  L+F V A + G+    ++A VSV ++D NDN P  +    R       +  +    Y +  + A D DSE N +L+Y ++     N        LF +N   G +++N   VT        +S+ V V D G P LS      I V    D 
Sbjct:   31 VKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDF----------------SLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGL----FQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLD-----FIMQSRGDTVF-VSEGAAYESFVGLVTVSDIDSAENGLVACHL-----RGH-PHFKLLPY-----RDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASV--STYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERN--------LFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDG 682          

HSP 2 Score: 127.102 bits (318), Expect = 6.477e-30
Identity = 131/535 (24.49%), Postives = 228/535 (42.62%), Query Frame = 2
Query:  905 NDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKY-FSIDKKT-----GQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLY------EIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSI---DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEV-EENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVL----TRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEI 2437
            ND +P F RS     I+E   +G  V    A D D G      Y      DE +++  ++  +T      ++ +  R +  Q  ++   + A D    P  G T + + V+D N++SPV              Q    + V E+      L  +  +D+D+G N        S ++ +    F++       +    KL      D E    + ++I   D G     A  K+ +H++D N+  P    +         +++ E  + E+ V  V V D D  ++ ++     G   F +    D   + T   LD E++      + A + G     ++ + +V ++D NDN P+F  ++    + E N  G Y +  + A+D D+E N  + Y ++   SE    S++     +NP++G IY+   LDYE     +  V+  D G PPL       + +VD NDN P+  +P + +    + L   RD+ L    T VRA D+DS+    + Y +   N  ++F IN L GE+
Sbjct:  130 NDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHL----DENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFA------------QTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQL-------DPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAY-VTTVTAWDADAEHNGMIAYNVVE--SEVAGASVS-TYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLP--RDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEV 635          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 4.122e-41
Identity = 192/756 (25.40%), Postives = 327/756 (43.25%), Query Frame = 2
Query:  248 SFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVC--QLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSN----FPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQ--------PTKFKFSIKATDKA-PNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQS---RILDLTDPGSTWFSIDDS-GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKL-FELNPTTGIIYSNVTLDYE-ECDLYSITVKVIDSGRP---PLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND--IFEINHLTGEI 2437
            SF + EN + GT+VG+++ S  L + +NV   + + +                 +  F I  S G + T + IDRE     QL ++  +        VSV           + D+N++AP F + S  +S++E   V S+       D DS +   ++Y I   +       FP        +L +   +D E ++ Y + + A D G   L  + TV + + + ND  P+F  S+Y     E+ ++G +V + +A D D G  G + YSF    ++ +  F +D +TG+I+ ++ F++           F FS+ ATD   P PL  R  + + V DVN++ P         F  S +Q      VSE+     QL  +T SD+D+G N      I      +    F +       + S  ++    S D EET  ++L +   D G    +A   + + + DEN+  P F ++L  +   E+T     + T+   D D   S   R   +       F+ID S G++     LD+E  +    NV A + G    +S+  + V+V D NDN P F        + EN+     +  + A D D+++N +L+Y +        AR       F ++P +G I +   +D E    L+ +TV+  D   P     S ++   + V D NDN P +  P     ++   L+    SV+  ++A D D  +   V Y +   +   +F ++  TG I
Sbjct:  664 SFVVFENVAPGTLVGSVSAS-TLDLNANVTYLIVSGDQ----------------RGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSV----------LVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDG------QLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF----EKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPP--------QFAKSVYQ----ASVSESASNLTQLLRVTASDVDEGVNGALRYAIN---EGNEGGKFTV-------DASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSI--------ARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTA---ILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGII 1349          

HSP 2 Score: 150.984 bits (380), Expect = 6.106e-37
Identity = 170/684 (24.85%), Postives = 295/684 (43.13%), Query Frame = 2
Query:  563 VNIEIIDINDNAPAFRQXXXXXXX-XXXXXXXXQINLEEPVDLD--SDQFQPIQYRIQHLHKSNF---PFSLSQNP-LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQG-ENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEP-QNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLT-----QSRILDLTDPGSTWFSIDDS-GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLAS-KRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDI-FEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHD 2557
            V + + D+NDNAP+F +  +      E + V  Q+ L+  VD D   +      Y+I   ++      P  +++   L L     +D E    Y + + A D G P   G   V + + + ND  P F +  Y A + ED+ +G  +      D      G L   F             D KTG +S  +   F    ++  S++A D    PL GR    + ++DVN++ P I       +L    ++ +V E +    +    A +TV+D D    N   S    SI+  +   +F +++        + K+ +    D E    ++L IL  D+G+P   SA   + +++ D N++ P F  + Y   + E     + VK V   D D       +  I+   D G  WFS+D+S G ++T   +D E    +  N+ A ++G +  T+   ++V ++DVND  P F+        VE +L G + +  + A D D   N  + Y       + +  +   ++F L+  TG + +  +LD EE + Y + V+  D G PPL +  +  + V D+NDN P++ YP  +    +I       + +T V A D D      V Y L   +   F++N +TG ++ +    +  +   QLQ    +  ++      IV I   D
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALR-----DLLHRGRGPLAVPF-------------DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRF----VYLPPAARSASVDESAAPGTV---AALVTVTDADSPTANGELSV---SIVGGNERGHF-VLHAPGVPGLRVLKVAS--QLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG--WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVV-SVSAADSDLGENGTVRYNF-----DPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPVQY--FASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVAD 650          

HSP 3 Score: 143.28 bits (360), Expect = 1.444e-34
Identity = 175/734 (23.84%), Postives = 311/734 (42.37%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQ--LNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFP--FSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATD----KAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDL---TDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEE------CDLYSITVKVIDSGRP-PLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDI--FEINHLTGEIT-FKRLNI-KPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            F ++ S+G + T  ++DRE      LN+  +++           K  +  + + ++D+ND  P F Q     +  E+S     +      D D  +   ++Y       + +   F L     K+   +S+D E  + Y +V+ A D G P L     V + + + ND  P+FY   Y A I E+   G  V +  A D D G  G + Y  ++G D  +  F ++  TG +S     ++  +  ++  + A D    +A +P I    + + V D  +  P       D +    F+N     V+    +      ++ S LD   N         I++ D    F I       E S  ++    + D EE  ++ L ++    G    ++++   + + D N + P FD+  YE+ I E+    +   +V+  D+D  ++  +        G   F I   G +  +  LD E  ++ S  V A++ G++  +SS  V+V V+DVNDN P F+ +S  F   E  +    +G + A D D+  N  + Y             +N   FEL+  TG I S    D E          +S +V   D GRP PL +     + V D+NDN P +   +++   ++ S  N+  + L RV A D D      + Y ++  N+   F ++  TG+IT    L+  +    TL + A D+ +  +  S ++ V ++
Sbjct:  389 FSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQ-------PKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAG-DAAR--FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAI----VTITVADAQDTPPTFAR---DDYSFVVFEN-----VAPGTLV----GSVSASTLDLNANV-----TYLIVSGDQRGSFSI-------EWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVS---VLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-------EKPQVN---FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAK-SVYQASVSESASNL--TQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVL 1068          

HSP 4 Score: 128.257 bits (321), Expect = 5.819e-30
Identity = 134/596 (22.48%), Postives = 246/596 (41.28%), Query Frame = 2
Query:  563 VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQ---------IGEIVLSPKAFDKDDGKFGELEYSF--SSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVI-EVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYD---HGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTW---------FSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWK 2266
            V I + D+NDN P F    + + + E++     I      D D  Q   + Y +  L  S   F +      L   R +D E +  Y + + A D    +   +  + + + + ND SP F R  Y+  + ED           IG ++    A D D G FGE+ Y+   S  +D     F +   TG +++ +  ++ ++  + ++A       L     ++++V+D N+++P +             QN ++  EV E+      L  I+ +D D+G N+     I S    D    F + N          +L   ++ D E   +++L +   D   H   + S+  ++ + + D N+  P F  +       E++     V TV+  D D  ++  ++    TD              F+++  +G +     LD E  +  +  VLA+++G    TS+A ++V V D NDN P+F        + E+     E+ ++ A+D D   N +L Y + +     +        F L+P  G +     LD E    Y + V+  D G P  S+     + + D+ND  P ++
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV--LSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVL----AGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSV-------------QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISS---GDPEGRFAVGN--------DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF-TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD--------FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQ 2055          

HSP 5 Score: 126.331 bits (316), Expect = 2.108e-29
Identity = 136/547 (24.86%), Postives = 238/547 (43.51%), Query Frame = 2
Query:  779 LILERSVDYENKKHYQVVLIACDNGKP-SLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQ--PTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRIL--DLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN 2401
            L +   +D E    Y + ++A DNGKP +     ++++ + + ND +P F  S Y A ++E    G  V    A D D G   +L YS  SG D    +FS+D+ TG ++   + ++   +    +I A D+   P    T + + ++DVN+  P+        F  +K+    V    EN+     +  ++ +D D GEN     +    +   +   F++ ++         K+   KS D EE + + L +   D G P   +  K+ + + D N+  P F    Y   I EN    T V TV   D D   +  +   LT   +  F ++  +G +ST++ LD E+       V A++ G     S A V++ V D  D  P F+     F V EN+     +G + A   D  +N+ + Y +++     +        F +  + G I++   +D EE   Y + V V +SG   ++      + V D+N++ P++   +     ++I+     +S    VRA D DS K   V Y +   N
Sbjct:  292 LKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGND--LGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPL--------FTQTKY----VATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTG-------KVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQRGS--------FSIEWSGGRIFTANAIDREEQAFYQLRV-VANSGG--VAGEASVSVLVHDVNNHAPVFDRASYE---VSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGN 801          

HSP 6 Score: 121.324 bits (303), Expect = 8.749e-28
Identity = 131/569 (23.02%), Postives = 234/569 (41.12%), Query Frame = 2
Query:  410 KNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXX-----XXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFP---FSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNP---LIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFK---------IINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRIL--DLTDPGSTW-FSIDDS-GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKG-FYEIGKIHAFDEDSEINSKLNY 2035
            +  F ++ +SG L     +DRE      L  R  + T              +++ + D NDN+P F + +        +  +    ++ I      D DS  F  + Y +     S++    F L      L + R +D E++  Y +   A D G   L     + +N+ + ND +P     +  A + ED   G  +L   A D D+G   ELE+S SSG  E +  F++    GQ+S+ +  ++  +  +   ++ +D+A +P   L     + L + DVN+++P              F +       E++ +   +A +   D D G NS    +++  +  D                +N +    R + +L      D E  + ++L +L  D G P  ++   + + + D N+  P F +  YE  I E+  P T V  +  +D D   +  L  D+     T  F +D   GT++    LD E+       V A + G  + + +A V V + DVND  P F L+       EN +G    I ++ A D+D   + ++ Y
Sbjct: 1560 EGAFVVDAASGVLRASRRLDREERASYLLTVRASDGT--------HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR--FAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPA-------------FTSPRSALAPEDSPVGAVVATVQAVDPDSGRNS----YVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVREL------DREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 7 Score: 102.834 bits (255), Expect = 3.594e-22
Identity = 152/651 (23.35%), Postives = 264/651 (40.55%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYE-NKKHYQVVLIACDNGKP-----SLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKF-KFSIKA-----------TDKAPNPLIGRTWIFLHVVDV---NNHSPVILVN----PIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHG-----EPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRIL--DLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYE-----IGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGP 2257
            F I+ S+G +     +D ET     L    E+       S   L+     + + D NDN PAF    +  S+ E+  + +++      D D+D    + Y I         F++     ++     +D E     ++V + A D   P     S   N TV++  T+END +P F       +       G +V + +A D D+ +   + Y+ + G  +    F +D++TG I      ++ +    F+++            T +A N +I  +  F H +     +  SP+ L+     P+ S  +  F  H +    E      QL F T               +   + + H     +IN ++   R  + L A   F      + SL     D+G      P  S+  ++EI ++D N+  P F     E+ ++ENT     + T+   D D  Q+ ++   +       F +D  SG +     LD E  ++ S+ +L +     +  + AR+SV V D NDN P+FS  +  F+V E+     +     IG + A D DS    ++ Y L  +   + A    +  F L+P TG +     LD E    Y +  +  D G   L+   R +++V+D NDN P
Sbjct: 1125 FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILV-----VHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLV--TDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGG--DAAILFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQDYESPINLLQGQTIPMPSSYL--FLRHHLDWEPEG-----QLVFFT---------------LLLGVTRGH----GVINPLDAPWRVSFDLTARCMF----IVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDRE--ERASY-LLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWA----DGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAP 1727          

HSP 8 Score: 90.5077 bits (223), Expect = 2.094e-18
Identity = 115/496 (23.19%), Postives = 200/496 (40.32%), Query Frame = 2
Query: 1196 IFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETN-----VKTVKVYDRD----------LTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGR-PP--LSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDS----VLTRVRAVDNDSDKYNVVHYFLHN-----------HNDIFEINHLTGEITFKR-LNIKPGQ-LTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQFP 2578
            + + V DVN++ PV        F + + +    +EV EN      +  ++ +D DQG+N+  +  + S         F +       + +   L A +  D EE   + L +   D     ++   ++ + ++D N+  P F ++ Y   + E+ +P+       + TV   D D          L  S   D  D       +  +G ++    LD E          A + G     ++AR+ V V+D NDN P     S   EV E+      + +I A D+D  +N++L + + +   E      N+         G +     LD E    Y++ V+V D  R PP  LS+  R  + + D+NDN P +  P         S     DS    V+  V+AVD DS + + V Y L                 F +N +TGE+   R L+ +  Q   L + A+D     + ++ +L V +   + +  +FP
Sbjct: 1502 VEISVEDVNDNPPV--------FAVPEME----LEVEENTGEGEVIFTLSATDADQGQNALVTYSVLS----GSEGAFVV-------DAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPV--TGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGND---------GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPR--------SALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFP 1950          

HSP 9 Score: 63.929 bits (154), Expect = 2.275e-10
Identity = 61/235 (25.96%), Postives = 98/235 (41.70%), Query Frame = 2
Query: 1877 RVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTR-----VRAVDNDSDKYNVVHYFLHNHND------IFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            +V + V DVNDN P F++     EVEEN      I  + A D D   N+ + Y +L         S +E  F ++  +G++ ++  LD EE   Y +TV+  D      +   R  + V D NDN P +     H    +++     D   TR     V A D DS  +  V Y L    D       F ++ +TG +   R   +  +    L+A   +   +  +  L V ++
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVL---------SGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSR---HAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVL 1720          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 5.096e-41
Identity = 177/742 (23.85%), Postives = 310/742 (41.78%), Query Frame = 2
Query:  413 NLFKINNSSGDLVTISEIDRETVC--QLNLIKRNENCTILQIVSVNK------LMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNF---PFSLSQNPLK-------------------LILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAI-INEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEV--KKYFSIDKKTGQISI-----IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTF--------DQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT-------DPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASK------RFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHD---NVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKR 2449
            +L  +N  SG+L     +DRE +C  + +  +       +Q+ ++ K      L  + V + + DIND+APAFR   L++S+SES  V  ++ L   +D D+       YRI           PFSL ++                      L L   +D E    Y+++L   D G P L G+  + I + + ND +P+F       + I E +++G  V+  +A D D G  G + YSF +    +  +    +D  TG +++     + R   P   +  + A D           + + + D N+++PV  V      L  ++     +++ EN      +  I+VSD D G +      ++     +  +  K+  +++T           +  D EE + +++++L  D G P+ S +  + I + D N+  P F        D  +YE+ ++EN    T V  +   D D   +  +  T       +  +  FS++  +G ++    LD EK  +   +V A + G     + A V V V+D NDN P F   S       +F VEE       +G +   D D   N+++   L+     +      +         G++ + V LD E+   Y ++V+ +DSGRP LS   R  I V D NDN P+   PN +D   +V   S   +   V      +D   +   +      N   IF +N  +G ++  R
Sbjct:   72 SLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVH-RLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEV----IALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTT----------RLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDT------PGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLAR 792          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.221 bits (391), Expect = 3.327e-38
Identity = 146/549 (26.59%), Postives = 227/549 (41.35%), Query Frame = 2
Query:  851 GKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNP-LIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTW--FSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRF--EVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV-----LTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITF-KRLN 2455
            G+P L G  TV + + +END  P F  +   A + ED  IG  V    A D D G    + Y    G      +FS++  TGQI      ++  +  +   + A D  P P L     + + V DVN+H+P  L  P  ++  S     T +              +T  D D G N      ++  ++      F +        R +  + A ++         +L +   D G P  SA+T + +  +D  E+ P F         +E+  P T +  V              L   G+    F++D  SG +S    LD+E        V A + G   F++  ++ V V+D+NDN P+FS  S RF  +V EN      I  + A D+DS IN +++Y +++    N        +F +NP +G I S  TLD E    Y +TVK  D G P      +  I V D NDN P +           I   ++R+       + RV  +D D      + + L + +  F I+  TGEIT  +RLN
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG----DGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFA------------VTARDADAGPNG----DLRFSLSGSASAGFSV-----DPRRGV--IHAARALQGPRDD-LTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFS--SSRFWAKVPENTP-PRTIVVLTAVDKDSGINGQVDYSIIDGNIGN--------VFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF---------TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLN 501          

HSP 2 Score: 150.214 bits (378), Expect = 1.163e-36
Identity = 168/694 (24.21%), Postives = 290/694 (41.79%), Query Frame = 2
Query:  386 HNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF-QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPG---STWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWK----YPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHN-HNDIFEINHLTGEIT 2440
            H   G +L ++F ++  SG++     +D E      L+    +       +  KL      ++++DINDNAP F        + E++  ++ + L   VD DS     + Y I   +  N  F ++ N  ++    ++D EN   Y++ + A D G P+      V+I++T+END SP F +  ++A + ED  +G  VL     D D+G    + +S      +    FSI   TG+I++ +R N+  +  +++K     P   +  T + + V DVN+++P             +F Q    IE  E +     +A ++ SD D G N +    ++S    ++    +    I +     Y+  A     A   KY S  +   D G P  S+   + I+I   N   P F +  Y   +       T +  +   D D   +  +  +  G   S  F +D  G +  +  L  +     S  V A +RG    +S A   + V + N   P+F+       + EN      + ++ A D D+ +N  + Y +        A      LF+++  +G +     LDYE   LY+++V   D G    +      I V D+NDN P+      YP I +N  + +   + D       AVD DS    V  Y L +   D+F +N  TG +T
Sbjct:  268 HLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKL-----EVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTA-VDKDSGINGQVDYSIIDGNIGNV-FRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL----DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTV-STDVTIVVDDVNDNAP-------------RFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRS--QTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKY-SFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSI--------ASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMD-------AVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLT 917          

HSP 3 Score: 144.821 bits (364), Expect = 5.056e-35
Identity = 166/684 (24.27%), Postives = 284/684 (41.52%), Query Frame = 2
Query:  563 VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGK-PSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT-KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT----DPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQFPLSSSLT 2596
            V + + D NDN P F    L  ++ E + + S + L    D D+     I YR   L   +  FS++ +  ++I   S+D E ++ Y + + A D G  P L  + T+++ +T+ ND +P F  + Y A        G  V +  A D D G  G+L +S S  A      FS+D + G I   +    P      +++ +D    P    T + +   D     P     P  SF   + Q             P       V+          S H+ S  N    + F +    ++ E S+++ L     D E   ++ L +   D G P  SA  K+E+ + D N+  P F  + +   + ENT P T V    V D+D   +  +D +    + G+ +    +SG I +   LD E +      V A +RG  +   + +V + V D NDN P+F+        E+   GF  + ++   D D   N+ + + LL+ +            F ++P+TG I  +  L+ E+   Y++ V+  D   P  +      I V D+NDN P +     +   +     +  ++++ RV A D D      V +F+ +  + F +   +GEI     +++P  L  +  A   +  N++   S +V  M   R     PLSS  T
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYR---LRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSA---SAGFSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGP-RSFSFREDQ-------------PPGTTITVVAARSSRRAGPVSYHLASGGNLG--DVFAVDP--QSGEVSVHRAL-----DHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAV-DKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVL-RVSTLDADEGPNAAITFSLLDPSLP----------FSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYY---IEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIH----SVRP--LRYRDPAGGGSGANLN-KYSFVVTAMDRGRP----PLSSDAT 636          

HSP 4 Score: 141.739 bits (356), Expect = 5.331e-34
Identity = 168/724 (23.20%), Postives = 303/724 (41.85%), Query Frame = 2
Query:  407 LKNLFKINNSSGDLVTISEIDRETVCQLNL-IKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIK--RFNQPT---------KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMN--ISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIH 2518
            + N+F++N +SG++ ++S +DRE V    L +K  +  +  Q  +V  L      I + D NDN+P F QI  +    +++     + +     LD+D+  P       L   + PFS+  +  ++ + R ++ E++  Y V + A D   P+   +  V I + + ND +P F ++ Y     E ++   +V    A D DDG  G++ +   S  +     F + + +G+I  ++  R+  P          K+ F + A D+   PL     + +++V  N ++P         FL  ++       V    RI      ++  D D+  N + +    S++  +    F +      +      L A  + DA     FS+ +   D G P  S+     I + +EN+Y P F     E+ + EN    +++  V   D D   +  +     +  GS  F I   SG +     LDYE  K  + +V A + G ++ T  + VS+ V DVNDN P  + +     + EN      +  + A D DS  N+   Y L +  ++         LF LN  TG++ +   LDYE    Y +TV+  +       +  +  + +  +N+      +P       N  +S      + +  V A D D+     V Y L   + +  F +N  TGEI       +  + +  L+ I  N+ +I 
Sbjct:  379 IGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVL------ISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVST---LDADE-GPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN----FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAP--------RFLRERYSTPVAATVRAGTRI----LDMSAVDPDRDVNGQIA---YSVVGGNASRRFDV------DAGGFLHLRASLAGDA--GSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEAD---------LFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNE-----YFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIR 1048          

HSP 5 Score: 140.969 bits (354), Expect = 7.739e-34
Identity = 134/597 (22.45%), Postives = 259/597 (43.38%), Query Frame = 2
Query:  692 SDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDR-DLTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYE---------KIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEI 2437
            S +  P+ Y +         F++     ++ + R++D+E + HY++V+ A D+G P       + +++ + ND +P F  S + A + E+T    IV+   A DKD G  G+++YS   G   +   F ++  +G+I  +   ++     ++ ++KATD+          + + V D N++SP             +F       V E+  + F +  ++  D D+G N+  +  +      D    F I         S  ++   +  + E+   +++ +   D   P  +  T + I + D N+  P F Q  Y I   E +  E  V  V   D  D    ++       +  F +  DSG I +   L Y           + K SF V A++RG    +S A V++ ++  N N P+F        V   ++    I  + A D D ++N ++ Y ++      NA     + F+++   G ++   +L  +   ++S+TV+  D GRPPLS+     I V + N   P + +P +    +++   +   S L RV A D D+     + Y +   + + +F+I+  +G++
Sbjct:  259 SRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYSIIDG--NIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSP-------------RFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL-----DPSLPFSI-------HPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVG----GNA----SRRFDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLE---LSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDV 812          

HSP 6 Score: 133.65 bits (335), Expect = 1.426e-31
Identity = 164/705 (23.26%), Postives = 280/705 (39.72%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYE---------NKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRF--NQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDD-----------SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVV--DMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAV---DNDSDKYNVVHYFL---HNHNDIFEINHLTGEI 2437
            F I+ S+G++     ++RE          + +   +++ + +    +  ++ I+  D+NDNAP F Q +  I   E S+ ++ +      D D      + + ++   ++   F + ++  ++   R + Y          N   Y  V+ A D G+P L  + TV INI   N  +P F R  Y+  +    + G  +L   A D D    G++ YS   G     + F +D   G + +      +  + F  +++A D+   PL  R    + V + N ++P     P++            + + EN+     LA +T +D D G N      + SI + D    F I        R+   +L     D E  K ++L++   D G    +  + + I + D N+  P  + + Y   I EN    T V  +   D D   + +        T +S+DD           +G ++T+  LDYE  +     V A N       S+A+V V +  VN+ FP+F      F V E+      +G + A D D+ I+  + Y L   +          K F +N  TG I  +  LD E     ++ V   ++G     ++    ++V   D ND  P++     H  V   +      SV T V  V   D DS        FL    N    F IN  TG I
Sbjct:  485 FSIHPSTGEITVSRRLNRE----------DRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN---FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGG--NASRRFDVDAG-GFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLE------------LSLPENHPAGSSLARVTATDTDAGVNGAI---VYSIASGDGSGLFDI-------SRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAV--------TMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGES--------RSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSEAA------SVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLI 1128          

HSP 7 Score: 100.908 bits (250), Expect = 1.406e-21
Identity = 139/588 (23.64%), Postives = 233/588 (39.63%), Query Frame = 2
Query:  680 VDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQIS---------------IIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITK--IEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD-----LTQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDND-SDKYN 2371
             D D+     I Y I     S   F +S+    ++L   +DYE +K Y + + A D G  +      V I++T+ ND  PM   S+Y  +I E+   G  VL   A D D        YS   G  ++   F +++KTG ++                ++ FN P  F +S                + + +  VN + P  +            Q      VSE+  +   +  +  +D D G +         +  +     F +      NE +  +++     D E     +L ++  + G  +   + +  + + I D N+  P F   LY   + E  S  T+V  V  +D D      T S ++   + G   FSI+  +G I     LD E +   +  V+A++ G    T +  V V + DVNDN P F L S   +V EN      +  + A D D   N K  Y      S+   R      F L+ ++G++ +   +D E+   + + V + D+G PPL++     + V+D NDN    +   +H N             +  VR  D D SD++N
Sbjct:  780 TDTDAGVNGAIVYSIASGDGSGL-FDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL---FVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYST-------------AQVHVQITGVNEYFPRFV------------QREYNFVVSESAPVGAPVGSVFATDRDAGIDGTV---FYMLFGESRSKGFSV------NEHT-GEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRA-FSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP-FLLTSS-AKVTENQPAGMTVLNLEAGDPDLPPN-KGPYTFQLLGSDPAWRG----YFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPG---GFIGDVRPRDPDISDRFN 1315          

HSP 8 Score: 67.781 bits (164), Expect = 1.853e-11
Identity = 76/334 (22.75%), Postives = 145/334 (43.41%), Query Frame = 2
Query:  239 KEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDS-DQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFS-SGADEV-KKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNN 1225
            +E +F + E+  +G  VG++                    D     ++ +  FG S    F +N  +G+++  S++DRE      L    +N   ++   V++++   VN+ I D ND  P F        +SE++ V + +      D DS   ++   + IQ  +     FS++ +   +++   +D E+   Y + ++A D G+P   G   V++ + + ND  P    S  +A + E+   G  VL+ +A D D     +  Y+F   G+D   + YFS+   +G +   +  +  Q  +F   +   D    PL     + L V+D N+
Sbjct:  967 REYNFVVSESAPVGAPVGSV---------------FATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVL---VNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRA-FSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTS--SAKVTENQPAGMTVLNLEAGDPDL-PPNKGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQND 1276          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 210.305 bits (534), Expect = 5.712e-55
Identity = 188/687 (27.37%), Postives = 318/687 (46.29%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHL-HKSNFPFSLSQNP----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGS---TWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEIT 2440
            F  N+++G + T + IDRET  Q++L  R  N +       N+   I V +++ DINDN P F  +  ++ + ES  V +   +    D D+     + Y I    + + F    +  P    L +I ++ +D E    YQ+ + A D G P+L G   + I I +END +P+F +++Y   I E+T+ G  +L   A D+D G  G+++Y+    A +    F +D  TG I   +  +   K  + F++ A+D           + ++V+D N++SP + +    ++L     +  +   SEN+ I   +A+I V+D D   NS+       I N D    FK+           Y +   K  D E   +++L +   D G P  S +  + I + D N+  P F  N Y   I E     + V  +   D D   +  +  +  G     WF +D  SG ++T   LD E++  ++  + A + G    T S  V+V +ID NDN P+F  +S +  + E       + ++ A D DS  N ++ Y + ++ ++ N       LFELN  TG++++   LD E   LYS TV   D G P L +  +  + + D+NDN P++       ++M    +N     L +V A D D     V+ Y +   N+N  F I+  TG I+
Sbjct:   42 FGFNSNTGVISTTARIDRETTTQISLQLRTLNPS-------NQ--PISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKI----TYLPPHNGDKAI--RSENSLINTNIAYILVTDKDSNTNSQTELK---ITNGDDEGCFKV------EFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNG------LFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIM----ENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVIS 694          

HSP 2 Score: 179.874 bits (455), Expect = 1.259e-45
Identity = 178/616 (28.90%), Postives = 282/616 (45.78%), Query Frame = 2
Query:  785 LERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKS-FDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGS---TWFSIDDS-GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL-HNHNDIFEINHLTGEITFKRLNIKPG---QLTLQLQAIDANSKNIHTSQSL-IVYIMGHDRSYLQFPLSSSLT 2596
            L++ +D E    Y + L   D G PS      V+I++T+ ND SP F  + YTA I+E  Q G  VL   A D D+G  G + YS + G D    +F +D ++G ++  K  +  Q +    +I A D    P  G T + + ++D N++ P         F+ S ++      +SE   I   +  ++ +D+D G+N R +  I S       +  ++  + E N ++   +L  KS  D E    +S  +L  DHG+PQ  +  K+E+ I D N+  P F    Y   I EN  P   +  V   D D   + ++     G      FSID S G IST   LD+E  +  S  + A + G K    +A V+V V++  DN P F      F V EN+     +G+++A  +D   N  ++Y +++    N        LF ++ T GII  N  +D EE   Y + V        PLS      I V+D NDN P +   ++   +++I    +   V+    AVD D+ K  +V Y L  N   +  IN  +G I   R  +  G   Q T+Q+ A D+ S   H++ ++ I   + H     +F LSS +T
Sbjct:  379 LQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGND--LGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKP--------RFMKSSYKG----TISEGASIGATVLQVSATDVDSGDNGRITYEISS-------SDAQVNGLFELNTQT--GVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMEN-EPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTN--------LFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSV---IVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLAR-KLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHPP---KFTLSSYVT 953          

HSP 3 Score: 141.739 bits (356), Expect = 6.600e-34
Identity = 150/573 (26.18%), Postives = 256/573 (44.68%), Query Frame = 2
Query:  797 VDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRF--NQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSR-ILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSS------ARVSVYVIDVNDNFPKFSLASKRFEVEE-NLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGE-ITFKRLNIKPGQL 2473
            +D E K  Y + +IA       L    TV I + + ND +P F  S+    I+    +G++V +  A D D GK G + Y  +S A+ +     I+  +G I + ++      T++   + A+D    P    + + +H+    NH P         F +S +  H    V  +  + +Q  ++   D D G+N +      SI   +    F I            KL   KS        + L +   D G P  SA   + I+I+D N+++  F  N +   + EN+SP T V T+  +  D ++++ I+       + F++D  SG I+T++ LD E++ K + + + I +    +  +      A V V V D+NDN P FS A     V E +L G   + +I A D D   N+K  Y L++ T  +         F +N +TG ++ + TLD E    Y++ VK  D+    L +  +  I V D ND  P+  +P   D  +NI+   +  S++  + A D D  +  ++ Y + N N   +F++   TG  I  K L+ +  QL
Sbjct:  802 MDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGL---LWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQ--HSTMTIHITLSINHPP--------KFTLSSYVTH----VLASQPLSYQFFYVVAVDQDSGKNGQL---FYSIPQGNEEGLFGIF--------PGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPG-SPVFRIKAMDADEGDNAKFFYSLVSGTGMDK--------FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPV--FPE-SDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQL 1334          

HSP 4 Score: 132.494 bits (332), Expect = 4.646e-31
Identity = 145/627 (23.13%), Postives = 269/627 (42.90%), Query Frame = 2
Query:  776 KLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFK------FSIKATDKAPNPLIGR--TWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAF-ITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIV----LDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEEC----DLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHY-FLHNHNDIFEINHLTGEITF-KRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQFPLSSSLTF 2599
            KL + +S+    K  Y +++ A D G PS   +  V I I + ND   +F  + +   + E++  G +V +  A   D  +  ++ YS  S     + +F++D ++GQI+   R ++    K      + ++A     +  I R    + + V D+N+++PV        F  + +     I VSE + +P    F I   D D+G+N++      S+++   ++ F I         S  +L   K+ D E T  ++L +   D       +  KIEI + D N+ +P F ++ Y + I E+    + V  +   D+D+ Q+ ++  +       ++ D  + + +++    LD+E  +     + A + G+   +S+  V+V V+DVNDN P F        V EN+   + +G+  A D D+  N+ + + + + T          K F +N  T  I +   +D E      D + + V   D G P LS  +   + V D NDN P +  P       ++++  I         A D D +    V Y  +  +N  F ++  TG++    ++   P    L +QA D    +  T   + V+  G        P+    TF
Sbjct: 1001 KLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISS----ESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPV--------FSRAVY----AITVSELS-LPGSPVFRIKAMDADEGDNAK---FFYSLVSGTGMDKFFI-------NSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTP--------SKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVMTI--------TAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEG--------PIGGGPTF 1576          

HSP 5 Score: 123.25 bits (308), Expect = 3.390e-28
Identity = 161/667 (24.14%), Postives = 280/667 (41.98%), Query Frame = 2
Query:  251 FKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNL------FKINNSSGDLVTISEIDRETVCQLNLIK-RNENCTILQIVSVNKLMWI-----YVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQ-SIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKI--VLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDL-YSITVKVIDSGRP 2197
            F + EN S GT+VG +                         H+L H+R    + +L      F ++  SG + T   +DRE      LIK    N  I+Q  ++     I      V + + D+NDNAP F +   +I++SE S   S +   + +D D        Y +      +  F ++ +  +L L +++D E    Y +V+ A D    +L     + I + + ND+ P+F  S+YT  I ED  IG +V++  A DKD G+ G ++YS S+G   +   F ++  TG++ + K  +  T   ++ +I A D    PL     + ++V+DVN+++P+    P+             + V EN    F +   T SD D G N     HI  S+ ++     F + +   T E +    +  ++  A     F L ++  D G P+ S    I + + DEN+  P F   +        +S      T +  DR+        +    + +F++  S      I  + D   I +L+  + A + G  S  +   VSV+        P FS A  +  V EN      +  + A    S +N  + YYL + +S+          FE+  +TG++ +   +D E     +++ V  +D   P
Sbjct: 1057 FAVAENSSPGTLVGTL-----------------------VAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDRE-----ELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMD-KFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNG--NLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPV------------TLTVRENVNTGFPVGRCTASDRDTGTN----AHIAFSMYSQTPSKTFSVNSA--TCEITTIAAIDLETMPAGRDS-FQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF---VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLT--IQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGG--------FEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGP 1660          

HSP 6 Score: 112.079 bits (279), Expect = 8.473e-25
Identity = 178/745 (23.89%), Postives = 309/745 (41.48%), Query Frame = 2
Query:  407 LKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKF--SIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVS-DLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGE-PQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGS---TWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEE------CDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEI----TFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQFPLS 2584
            +  LF++N  +G L T S++DRET    +     ++    Q++S  K     V + I DINDNAP F  +    S+ E+      + +    D D      I Y I     +N  FS+  +   +    S+D+E ++ + +++ A D G         V + + N+ D  P+F    Y   + E+   G +V    A  KD  K G + Y+  SG  +    F +D   G I I    ++  K ++  ++ A      PL  +  + + V+D N+++P             +F   +VI   +   +  Q+ +   + DLD G+N      + S  N + L +         N  S    LA K  D +ET+Y ++ +L  D G  PQ+S +T   IHI     + P F  + Y  ++  +         V   D+D  ++  L  + P       F I   G +  +  L           V A + G+ SF++S  V++Y+ D ND+   F   + RF V EN      +G + A   D      + Y L+++          E  F ++  +G I + V LD EE       ++Y +  + + +      +     + V D+NDN P++        V  +SL     S + R++A+D D        Y L +    D F IN  TGE+    T  R         L ++A DA++ N++++  + + +   +     FP S
Sbjct:  576 VNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVK-----VELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTA-TDADEGTNAVISYDIIG-GNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSG--DPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAP-------------QFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS--NAEGLLWI--------NSTSGVIKLARKLTDGDETQY-TVQVLASDSGSPPQHSTMT---IHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISS----------ESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPG---SPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTS--SYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPES 1267          

HSP 7 Score: 99.3673 bits (246), Expect = 6.161e-21
Identity = 128/510 (25.10%), Postives = 209/510 (40.98%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXX-XXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT------KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTV-KVYDRDLTQSRI--LDLTDPGSTWFSI-DDSGTISTKIVLDYEKIKKLSFN--VLAINR-GIKSFTSSARVSVYVIDVN 1906
            F IN+S+G+L     +DRET    NL+ +  + +   + S  K     + I + D ND  P F +         ++      INL    D D  Q   I+Y I + + +   F +     +LI+ +S+D+E  + Y++ + A D+G   L     V +N+ + ND +P+F     T  + E+   G  V    A D+D G    + +S  S      K FS++  T +I+ I   +  T       F+  + ATD+    L  R  I + V D N++SP  +  P  +   S                   +  IT  D D+  N + +  I S  N     YF +     T +  +   + D          + L I   D G+P     T + +  +      PTF    Y+  + EN    T+V TV   Y +      I     +D     F +   +G + T   +D E +   SFN  V A+++ G  + TSSA V++ V DVN
Sbjct: 1207 FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAK-----IEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNAS-DKDIGQNGLIKYSISNGNLAAM-FDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYS--QTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSS-----------------LNVMTITAEDPDRNSNGKVTYSIISGNN----GYFNLHP--STGQLQMIHQIPDNP------TIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGA-SFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 208.764 bits (530), Expect = 1.975e-54
Identity = 185/686 (26.97%), Postives = 308/686 (44.90%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLIL--ERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILD---LTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLT-RVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKR 2449
            FKI+ SSG +     +DRET     L+ R       +  S  + ++    I ++D+NDNAP F   S + SL E+  +   +      D D  +   + Y +     S F      NP   ++  +R +D E++  Y + + A D+GKPS      + + I + ND SP F +S YT  + E+T  G  +L   A D D G  G + YS  SG       F ID  TG+I+++   ++     +  +I A D    P +   ++ + V D N++SP+               N T   + E   I  ++A +T +D D+G N++      SI+  D   +   IN +         L   K  + E    ++L I   D G P  ++  ++ + + D N+  P F+   Y   ++EN++  T+V TV   D D+  + +L    ++      F I+  SG I T   LD+E+  +    V A +     +T+   V++ VI++ND  P F+  +    V EN      + K+ A D DS     L+Y ++     +         F ++  +GII +   LD E   LY+I V+V D+G PPLSN+    I ++D NDN P +   +   ++    L+N   S  + ++ A D D      + Y L + ND F I   +G IT  +
Sbjct: 1042 FKIDQSSGLISVAKRLDRETTANYTLVVR-----ATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEV----NPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISG--NHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFA------------SNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQV---FYSIVRGDTSAF--AINAMNG------VLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD---SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSF--GSLSYSIVGGKDSDK--------FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSI----LENSAPSSFSFKLAATDADEGTNARITYNL-SRNDAFMIGASSGVITLAQ 1675          

HSP 2 Score: 203.756 bits (517), Expect = 6.051e-53
Identity = 192/706 (27.20%), Postives = 321/706 (45.47%), Query Frame = 2
Query:  359 DFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSR--ILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWK----YPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLH-NHNDIFEINHLTGEITFKR 2449
            D      L +     ++K  F I+ +SG +   SE+DRET    +L             S ++     V I + DINDN+P F Q      +SESS    QI      D D      ++Y    L  +   FS++ +   + L+  +DYE K  Y V + A D G PS      V + + + ND  P F +S YT  + E+   G  V    A D D G  G++ YS  SG + +   F++D+ TG+I+     ++ T   +  +I A D +    +  T + + + D N++ P              F   +   +SE++    ++  +T +D D G N   +    +II+ +  N F++      + RS   L    + D E    ++L +   D G PQ S    I + + D N+  P F+++L+   I+E+ S  + V  VKV D+D   +    L L+  GS  F+ID +G + +K  LDYE        V A + G  S +++A+V + +I+VNDN P F   ++   + E++     + K++A D D    + L + ++    E NA S     F+++ ++G+I     LD E    Y++ V+  ++G    S      I V+D+NDN P++       ++H+N+       I  +V  +V A D D  +   V Y L       FE+N  TG +T KR
Sbjct:  506 DSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSL-----QVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRY---ALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMA--FAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPT-------------FTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTY---AIISGNQGNSFQL------DPRSGI-LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIV----EGNAGS----SFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLP------IGQTV-AKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKR 1159          

HSP 3 Score: 203.371 bits (516), Expect = 7.248e-53
Identity = 203/719 (28.23%), Postives = 326/719 (45.34%), Query Frame = 2
Query:  326 SNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVN-IEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYD-----RDLTQSRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV-LTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEITFK 2446
            + V +      D   + +++++ F  S +N F +N+ +G++ T++ +D ET          ++   ++I + +     +V  I + D+NDNAP F        + E   V S +     VDLD      + Y +     S F    SQ  ++   + + D E K  YQV L A D G PS  G  TV I I + ND  P+F  + YTA ++ED  IG  +++  A DKD+G   +L YSF+SG       F++D  TG +++ +   F Q + +   +  TD+   PL   + + ++V D+N++ PV        F  S +Q+     V EN     Q   ++ +D D   N      +  II  +    F I       + S   +   KS D E    + L +   D G P      ++ I I+D N++ P F  + Y   I E+T   + V TV   D     R   + R++     G+  F+ID +SG+I     LD E     S  V A + G  S +SS RV++ + D+NDN P F      F V E+    ++IG++ A D D   N  + Y L          S N  +F +N +TG+I     LDYE+   Y +TV   D G P  S++    + V D+NDN P +   +++   +    +N+   V +  V A D DS     + Y +   N N  F ++  TGEIT +
Sbjct:   86 AQVAIVTATDRDSGTNAAITYSLF--SGENKFMMNSKTGEIRTVTPLDHET----------KDSYTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVD-SQGVIRT--KGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSG--NTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPV--------FSPSAYQSR----VKENTPAGTQ---VSATDRDSSTN---GALVFGIIKGNDDGVFTI-------DGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGA--FNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQ-GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYAL----------SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAK-SLYTCTVG---ENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTR 745          

HSP 4 Score: 172.555 bits (436), Expect = 2.344e-43
Identity = 179/680 (26.32%), Postives = 307/680 (45.15%), Query Frame = 2
Query:  326 SNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIK--RFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD-LTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDND 2356
            SN+   L +  D   +  ++++    +  N F+I++++G +  +  +DRE +   NL    ++  +   VS       +V I + D NDN+P F     S  + E   + S++ +    D D      + Y I     S F  + + N + L +++ ++ E    Y + + A D G P +  ++ + + + + ND  P+F   +Y   + E++     VL+  A D D G    L YS  SG DE  K F I+  +G I       F + +++   + ATD        +T + + V+++N+ +P               QN+T   V EN+  P   + + VS  D+      S    SI+     + F I      ++RS     AD   D E    +++ +   D G P  S +T + I I DEN+  P FD + Y   I EN++P +    +   D D  T +RI         +     SG I+    LD E        + A + G     SS  + V VID+ND+ P  + +S R  V EN      + +I A D D+ +N++L + LL+    N  +S+    F L+ TTG I + V LD E+  +Y++ + V D G P LS++    I V+D +DN P ++ P  ++  ++ SL   R + + +V A D D
Sbjct: 1220 SNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVST-----AFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAIN-AMNGV-LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE--KRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSK---YTAKTNVTIRVINLNDITPAFTQ-----------QNYTA-SVRENS--PTSTSVVKVSASDRDSFGSLSY---SIVGGKDSDKFSI------DQRSGIISTADV-LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLS----NEHKSV----FTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQ-PTEYNVTISESLP--RGASIVQVTARDID 1852          

HSP 5 Score: 169.088 bits (427), Expect = 3.379e-42
Identity = 183/690 (26.52%), Postives = 303/690 (43.91%), Query Frame = 2
Query:  410 KNLFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKL--MWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQS-----RILDLTDPGSTWFSIDDS-GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFK 2446
            + +F I++S+G + T   + DRE+  +  L       T+L   + N+       V I++ D NDNAP F  ++  +     +   +Q+ +    D DS     I Y    L      F ++    ++     +D+E K  Y + + A D    +       +I + + ND +P F  S Y   + ED  +G IV    A D D G    L YS  SG      YF++D + G I     F++ TK  ++ +++A D       G+  + + ++DVN++ PV        F  +++       V E+  I   +  +T SD D G N+       S  N +H      +  + T  RS+         D E+   ++L +   D G P  +  + + I++ D N+  P F  + Y+  +KENT   T V      DRD + +      I+   D G   F+ID S G IS     DYE   +    V A +RG+     +A+V++++ DVND+ P FS ++   ++ E+      +  + A D DS    +L Y L++     N +      F ++  +G I  +  LD E    YS+ V+  D G    S+  R  I + D+NDN PI++ P     V  +S  +     + +V A D D      V Y L ++ D+F IN  TG IT K
Sbjct:    9 QGMFTIDSSTGSITTTGRKFDRESESRYRL-------TVLAQDAANRCHKGRTVVVIDVKDENDNAPEF-PLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITY---SLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFV----PLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD---TSYFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPV--------FSSAQY----TASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTS-GNTNHAFTLDAVTGVVTVSRSL---------DFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVSAT---DRDSSTNGALVFGIIKGNDDG--VFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLIS----GNVKG----AFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP----YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLK 640          

HSP 6 Score: 90.5077 bits (223), Expect = 3.865e-18
Identity = 89/328 (27.13%), Postives = 143/328 (43.60%), Query Frame = 2
Query: 1487 KSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDL-TQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIW---KYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEITFKR 2449
            + FD E    + L +L  D     +   T + I +KDEN+  P F  N Y   I+ENT P   V  V   DRD  T + I      G   F ++  +G I T   LD+E     +  + A +    +F       + V DVNDN P F+L+  +  V E++     + ++ A D D  IN++L+Y L+         S +   F ++ + G+I +    D E    Y + ++  D G P  S      I ++D+NDN P++   +Y    D  + I       + +  V A D D+     + Y     N N  F ++ +TG +T  R
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENT-PAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVP----LITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLV---------SGDTSYFTVD-SQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIG------AAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSR 332          

HSP 7 Score: 59.3066 bits (142), Expect = 1.125e-8
Identity = 57/186 (30.65%), Postives = 81/186 (43.55%), Query Frame = 2
Query: 1721 ILDLTDPGSTWFSIDDS-GTISTKIV-LDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRP---PLSNIQRFFIHVVDMNDNGPIW 2263
            I+D  D G   F+ID S G+I+T     D E   +    VLA +   +       V + V D NDN P+F L S  F + EN     ++  + A D DS  N+ + Y L +           E  F +N  TG I +   LD+E  D Y++ +   D       PL       I V D+NDN P +
Sbjct:    3 IMDGNDQG--MFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPA-AQVAIVTATDRDSGTNAAITYSLFS----------GENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-------ITVDDVNDNAPFF 168          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 179.104 bits (453), Expect = 3.925e-46
Identity = 199/782 (25.45%), Postives = 344/782 (43.99%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCG--NQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPL--IGRTWIFLHVVDVNNHSP--------------------VILVNPIDS--------------------FLISKFQNHTV-------------IEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERS-IYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRI-----LDLTDP-GSTWFSIDDS-GTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIH--VVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEITF-KRLNIKP-GQLTLQLQAIDANSKNIHTSQSLIVYI 2545
            F I+N +G + +  E D ET    +   R E+       S  +     ++++I D NDN P F+ +     +SE++ + + +   + VD DS     + Y IQ+   +N  F++  +  +++  +  D+E  + Y + +   D G P+L       V+I + +END  P F +  YTA + E+  +G +VL   A DKD G    L+YS  SG       F I   +G IS+ K  ++ T   +   +  TD    PL  I R  + + V  VN H+P                    ++ V  ++                     FL+++  + T+              E+ EN     Q+  +   D D+G N +   +I +           +  V  TN  + +  L A+   D E    +++ ++  D G P  +A   +++ + D N+  P F    Y + + E TS  T +  V   DRD     +       L D   S  FSI+D+ G I+ K  +DYE+    SF V A + G    T S+ V + +IDVNDN P F       ++ EN+     + ++ A D DS +N K+ + +L   S+          F ++  TG++ +N +LDYE+   Y++ ++  D G PPL++ Q   +H  VV++NDN P++          +I        V+ RV A D DS     V + +   N +  F ++  TG +T  K L+ +   + TL +QA D     +++SQ  ++++
Sbjct:   52 FVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRG-----SPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQN-GNNNGSFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSG--NTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVT---------SSVKGVFTTNSTTGVVSLTAE--LDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGK--------FVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYS---ASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHV 803          

HSP 2 Score: 128.257 bits (321), Expect = 5.085e-30
Identity = 152/583 (26.07%), Postives = 246/583 (42.20%), Query Frame = 2
Query:  917 PMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAI--TKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLT-DPGST---WFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVI--DVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNY----------YLLNTTSE-----------------------------------NNARSINEKLF------------ELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNV---VHYFLHNH--NDIFEINHLTGEITFKR 2449
            P+F ++ Y+AII ED  +G  +L+  A D+D      + YS  S + E   YF ID  TG +   K F+  T+  + FS++A D+          I + + D N++ P+        F   +++      VSEN  +   +A +   D D   N+     I SI N ++   F I N       S  +++  K FD E+T+ ++L I   D G P  S++    + I + DEN+  P F Q  Y   + EN +  T V  V  +D+D   + +L  +   G+T   +  I DSG IS    LD E I+  +  ++  + GI    S  R+ V VI   VN++ P+F        + ENL     I ++ A ++D  + ++  Y          +L+N T +                                   +    IN ++F              N TTG++     LD E    Y++ V   D G PP +      + V+D NDN P++    ++  +      +I   +L RV A D D     V   + YFL +   +  F IN  TG+IT K+
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTE-SDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPI--------FQPMEYETR----VSENTPLGTIVARVKAVDKDSTSNADL---IYSIQNGNNNGSFTIDN-------STGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFT--TLYYTLQLSEATSIGTRIL-RVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQ 557          

HSP 3 Score: 125.946 bits (315), Expect = 2.454e-29
Identity = 156/688 (22.67%), Postives = 302/688 (43.90%), Query Frame = 2
Query:  239 KEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFS--IKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLD---QGENSRCSCHIQ-SIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLT-QSRILDLTDPGST--WFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSS--ARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIH--VVDMNDNGPI 2260
            K  +  + EN ++GT+V  + ++A               +D   +  L ++    +  + F I   SGD+     +D+ET+    L+    +  I  + S+ +++   VN+ +  +N++AP F     + S+ E+  + + I     V+ D        Y I+    S   F ++Q    + L R +DYE ++ Y                             E  M+          E+   G  VL+  A D+D+G  G++ Y   + +  VK  F+ +  TG +S+    ++ + ++++  + A D    P      + + V+D N++ PV                +  +++SE   I  ++  ++ +D D   +G N+     ++ +I++K     F I         +  ++   ++ D EE   +S  +   D GE + +  + + I I D N+ +P F    Y + + EN +  T V  V   D D +   ++L     G++   F ID ++G ++T   LDYE + + +  + A + G     SS    + V V+++NDN P FS       ++EN    + I ++ A D DS +N K+ + +L   S+          F ++  TG++ +N +LDYE+   Y++ ++  D G PPL++ Q   +H  VV++NDN P+
Sbjct:  219 KRYTATVYENFTVGTVV--LRVTAH-------------DKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMV---VNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKV-FLVNQTG-DITLARELDYETRRRY-----------------------------EFEMY----------ENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSS--VKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTL------------YYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKK----FSI-------NDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGK--------FVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPV 814          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 176.792 bits (447), Expect = 1.563e-44
Identity = 200/726 (27.55%), Postives = 331/726 (45.59%), Query Frame = 2
Query:  437 SGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAF-RQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILER-----------------SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSI--KATDKAPNPLIGRTWIF-LHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKI-INVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGST-------WFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLH--NHNDIFEINHLTGEITFKRLNIKPGQ--LTLQLQAIDANSKN 2512
            +G + T + +DRE V   NL       TI++  +  K   + V ++  D+NDN+P+F R  S  + + E+ K   Q  +    D  S+  Q   Y I   +  N          KLI +R                  VD E    Y + + A D G P+  G   + I + + ND  P F   +Y+  I E+  +G  +L   A DKD G   E++YS  + +D  +  F I   TG I    R +   K  + I  KA DK  +  +  + I  + V+DVN+++PVI V+     L   +Q      V+EN  I  Q+A ++VSD D G+N   +  ++         YF +  +V+  N+ SI  +   +S D E   +F L  +C D G+P  +      I++ D N+  P FD++ YE  + EN +  T V  V   D+D   +  L  T   +T       WF+ID  SG I+T   LD E+I ++   VL  +RG    + +  V V + D NDN P F+ +S    + EN      + ++ A D D   NS + Y +L   +           F L+P  G++ ++ TLD+E    Y+  V   D G    S      + + D+NDN P++  P+ + +V       I  S+  +++A+D DS K+ +  + +   N +++F ++  +G IT  +L  +  Q    L ++A+D   ++
Sbjct:   11 AGVITTKTVLDREKVSAYNL-------TIVEFSTPPKSYTVLVYVQ--DLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQ--SYTIVSGNVGNV--------FKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDP-QAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVS---YTLGGSYQ------VTENATIGTQVARVSVSDADSGKNGEVNVTLEG-----GDGYFSMKFDVL--NDESI--IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP----------FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFD-PSSY-SVEYFENTRIGQSIC-QLKAIDRDSPKFAITRFIIEQGNADEVFSVDG-SGLITLAKLLDRETQDNYLLTVKAVDGGGQD 682          

HSP 2 Score: 159.073 bits (401), Expect = 4.476e-39
Identity = 163/635 (25.67%), Postives = 282/635 (44.41%), Query Frame = 2
Query:  563 VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQ---PTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTV-IEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINV-IETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDP--GSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITF 2443
            V++ + D+NDN P F   S S+   E++++   I   + +D DS +F   ++ I+  +     FS+  + L + L + +D E + +Y + + A D G         V I + + NDE P+F ++ Y   I E +Q   ++    A  +D G   E+ YS S G  +      +   TG + +    +    P+ +  +++A DK   PL G   + + V+D+N++SP             +F + ++ + + E+  I      ++V D D G   R S  + S       N   + N+   T   S+ KL+          + ++L +   D G P  S+   +E+ + D N+Y P F    Y  ++ E T P++N+  V   D D  +  RI    D    ++ F + + G I  K  LD E I++ +  V+AI+ G    +SSA V V V DVNDN P F  AS  F V+EN      +G + A D D   N  + Y      ++          F ++  TG I ++  LD E    Y  ++   D G  P  +  +  + V D+ND  P +   N +   +N  L  +  S+LT +   D+     + + Y +      F +N +TG +T 
Sbjct:  585 VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEV-FSVDGSGL-ITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTD---NIVLINSTGTLYLQSEVDHEKIPSLY-LTVQAKDKGTPPLFGYANVTIAVIDINDNSP-------------QFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLS-------NPGTLFNLDSNTGALSLTKLIDY----GNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ----------FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSK-NKYSVTVNEDLP-VGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTL 1177          

HSP 3 Score: 155.221 bits (391), Expect = 7.557e-38
Identity = 166/621 (26.73%), Postives = 276/621 (44.44%), Query Frame = 2
Query:  794 SVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQI--GEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPI-------DSFLISKFQNHTVIEVSENNRIPFQL--------AFITVSDLDQGENSRCSCHIQ-SIINKDHLNYFKIINVIETNERSIYKLLADKSFDAE-ETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYD--RDLTQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVY--VIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIR-DSVLTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTG----EITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHD 2557
            ++DYE+ K++++ L+A   G  SL G   + IN+ + ND SP F+ SN  A + EDT       V+   A D D G  G++ YS  +G +     F+ID  TG+I+  K  ++ T   F   I+ TD    P      + + V D+N++ P  L +P+       D+   +   +    +  + +R+ + L        A + VS  DQ   S         I N D ++Y KI       +     + A ++ D      +  + +   D G P   A+  + I I  E    P F+   Y   + EN    T+V TV+V D    L   RI       S +F I   SG IS    LDYE  ++    V AI+    S     RV VY  V DVND  P F  +    +  E +     +  + A D+DS  N ++ ++ + +  +  + +I+ K       TG+I +   LD+E    + ++V+  D G PP+       I V+D+NDN P+++ P  +D  +   L+N+  +S L  + A D DS     + + +       +F I+  +G     ITF   N    Q +L ++A DA +  + ++ ++IV +   D
Sbjct: 2024 ALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNE--AGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPP--LFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDY-KI-------DADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRI-SYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPS--KPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRV-WFAIQSGDDKGSFAIDRK-------TGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQV---LENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADED 2614          

HSP 4 Score: 153.68 bits (387), Expect = 1.971e-37
Identity = 178/695 (25.61%), Postives = 313/695 (45.04%), Query Frame = 2
Query:  221 SSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVF----SNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNL-IKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDD-GKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFK--FSIKATDKAPN-PLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIE-VSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERS-IYKLLADKSFDAEETKYFSLNILCYDHGEPQN-SAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLT-QSRILDLTDPGSTWFSID------------DSGTISTKIVLDYEKIKKLSFNVLAINRGIKS---FTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRF 2221
            SS AML+    K+V+      + GN + +A +       SN+   +    D  E+  +S+    +   + F + N  G +   S++DRE + + NL +   ++ T  +  S +      V + + D+NDN P F+Q S +  + E+  V + +      D D      + YR          F + +   K+   + +D E K  Y   ++A D G         V + + + ND SP F ++ Y+  +NED  +G  +L+  A D D  G   ++ Y   +G     K FS+++ TG ++++   ++    +    + A+DK  N  L   T+I ++V+DVN++ PV             F N T  + V E   I   +A +   D DQG+N +    I   +N +    FKI      NE + +   L  ++ D E T  + L +   D G+ Q  ++   + I+++D N+ +PTFD+N    +I EN    TNV T+K +D D    SRI         W++ID            ++G I T   +D E+I + S  V A ++         ++A + + + D+NDN PKF   +  + +E+    F ++  I A D D+     + Y ++         S +   F L+  TG++    +LDYE+   Y++ +   D G PPL++ Q F
Sbjct:  893 SSTAMLE---LKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNG-GKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSAD------VKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ---FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAG----PKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPV-------------FINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKI---VNGNTDGTFKI------NETTGVISTL--RALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRI---------WYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNF-QVTSITALDPDTGQGGNVEYRIV---------SPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLF 1527          

HSP 5 Score: 149.443 bits (376), Expect = 4.037e-36
Identity = 179/691 (25.90%), Postives = 311/691 (45.01%), Query Frame = 2
Query:  401 RSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQI---SIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAF-ITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTW--FSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSE--INSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEIT 2440
            +S +  FKIN+ +G + T   IDRE + + +L  R  +    Q  +    ++    ++II  D+NDNAP F   +L+  + +      Q+     +D D+ Q   ++YRI       F   L    LKLI   S+DYE+   Y + + A D G P L   Q   + + + ND  P F R  +   ++E+   G  V+   A+D+D G   EL YS  SG +  K  FSIDK +G I   SI+ R  + T F  ++ AT  +    +  T + ++V+D N++ P   ++P+             ++V EN+  P +L + +TV DLD G N++    + SI++ +    F I        RS  +L      D E    + L++   D   P  +A   I I I+D+N+  P F Q+LY   I E T P T++  +   D+D   +  +  T    T+  +SID  +G + +    +    ++ +F  +A ++G     +   V + + D N++ P+F+       +  N      +  + A D D++   N K+ Y L +  S+N+       LF +   TG + ++          +++ +   D G PPL       I + ++ D+ P  ++ N     ++I   +   S +T VRA  + SD          N    F ++  TG I+
Sbjct: 1372 QSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATD----QAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNF-QVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLI--GSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDK--FSIDKHSGLIVTNSILDREKKDTYF-LTVHATGVSYPFRVSSTSVRINVMDRNDNPPK-FISPV-----------VTLKVPENS--PARLIYTLTVQDLDYGNNTKV---LYSIMSGNTDGAFTI-------GRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDD--SKNST-----SLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPP--RFLNQTPARVSIPENSKVGSYITTVRARAS-SDAQVTYSIISGNKGRAFYVDPFTGVIS 2018          

HSP 6 Score: 147.132 bits (370), Expect = 1.905e-35
Identity = 171/664 (25.75%), Postives = 291/664 (43.83%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVN---KLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTF-DQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDD-SGTIS--TKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYE--IGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRD-----SVLTRVRAVDNDSD 2362
            F I+  SG +VT S +DRE        K++     +    V+   ++    V I ++D NDN P F    +++ + E+S  +    L    DLD      + Y I     ++  F++ ++  +L     +D E K  YQ+ + A D   P       + I I ++ND  P+F +S Y++ I+E T  G  +L+  A DKD G  G + Y+ S   ++    +SID +TG +    RF    K  + F   A D+  +P +    + + + D NNH+P         F  + ++ H     S +  +    A  T +D D+  N + +  +    +K+  + F    V+E+N  S+        F        +L I+  DHG P       ++I I +  +  P F +Q    + I EN+   + + TV+       Q     ++      F +D  +G IS  +   LDYE  K    +++A  +G  S      + + VID NDN P F  ++   ++ E+   F    + K+ A D DS  N K+ Y +    + N A      +F ++ TTG I +   LD E    + + ++  DSG PP S   +  + V D+NDN P++           +S  NIR+     +V+T V A D D +
Sbjct: 1589 FSIDKHSGLIVTNSILDRE--------KKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQ-DLDYGNNTKVLYSIMS-GNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLS---NDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAP--------QFTKTPYEVHIFPNTSASALVTMVTA--TDADTDKSTNGKVTYRLDD--SKNSTSLF----VVESNTGSVR---TSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIW---TGNEA-----GVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFD---------PLSEVNIREDTRTGAVVTSVVATDTDKE 2203          

HSP 7 Score: 144.436 bits (363), Expect = 1.420e-34
Identity = 173/717 (24.13%), Postives = 308/717 (42.96%), Query Frame = 2
Query:  416 LFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFR---QXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLK----LILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKY---FSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ---SRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHY-FLHNHNDIFEINHLTGEITFKRLNIKPG----QLTLQLQAIDANS 2506
            +F I+ ++G +V    +D E      ++ + E+      +S + +    V IE++D+NDN P       +  S  ++E++ + +Q+      D DS +   +      L   +  FS+  + L     + + +S+D E   H+ +  +  D G P     ++  IN+ + ND +P F R  Y   + E+  +  +V    A D+D G   EL Y+ ++   E + Y   F+ID  +G I+     +  Q  +   ++   D+   PL     + +++ D N++ P         +      N ++ E S +     QL      D D GENS     + SI+  +   +      + TN R++         D E    ++  +   D G    S    + + + D N+ QP FD + Y +   ENT    ++  +K  DRD  +   +R +         FS+D SG I+   +LD E        V A++ G +   + A V++ V+DVND  P FS A   F ++E+ +    IG +HA   D   N+++ Y +    ++N        +  +N +TG +Y    +D+E+     +TV+  D G PPL       I V+D+NDN P +   +I   ++ +            V   D DS     V +  L N   +F ++  TG ++  +L I  G      TL +QA D  S
Sbjct:  220 IFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAI----VRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVT---LEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIAN-TTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDP---------YFNQSSYNASLFENSPSGSPVVQLL---AQDPDIGENSLI---LYSILTPNTPFFLDPRKGLVTNSRTL---------DHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDN--------IVLIN-STGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSI---LVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKL-IDYGNSARSYTLPVQAQDGGS 889          

HSP 8 Score: 138.658 bits (348), Expect = 7.359e-33
Identity = 171/687 (24.89%), Postives = 296/687 (43.09%), Query Frame = 2
Query:  533 VSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQ--INLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIV----------------------------LSPKAFDKDDGKFGELEYSFS-SGADEVKKYFSIDKKTGQISIIKRFNQPTKFKF---SIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVI-EVSENNRIPFQLAFITVSDLDQG-ENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSI---DD---------SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKR-FEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLY--SITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDS-DKYNVVHYFLHNHNDIFEINHLTGEI 2437
            VS+N  M +  +I +ID NDN+PAF   ++   L+E +       +      D+DS     + Y I   +++   F++     ++   + +D E    + +V+   D+G P    N  V + +T+ ND  P+F   +   I  EDT+ G +V                            L   A D+D G   +++YSF  + +D++   + ID  TG IS  +  +   +  F    ++A D+   P   R  +++ ++        I   P       KF+  +   +V EN  +   +  + V+D   G    R S +I+      + NYF+I       +RS   +  +K  D E  + F L +   D   P       + I++ D N+ +P F Q+ Y     E     T V  V   D+D   +        G  WF+I   DD         +G I T+  LD+E IK    +V A + G     +   V++ V+D+NDN P F +      +V ENL     + +I+A D DS  N++L++ ++  T +         LF ++  +G + +N+T DYE   +Y  S+T+K  D+G PPLS+     ++V D ++  P +   N  D   ++         + +V A D DS D+  V   F +  ++  ++N  TG I
Sbjct: 2045 VSLNGYMIL--DINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV-FTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNI-REDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQID--YKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQ--RALVYVRII--------ITREP-------KFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIE------NSNYFRI------GQRSGV-ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGAN--------GRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQG--------LFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF---NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTGII 2676          

HSP 9 Score: 130.568 bits (327), Expect = 2.388e-30
Identity = 176/740 (23.78%), Postives = 315/740 (42.57%), Query Frame = 2
Query:  248 SFKLVENCSIGTIVGNINLS-AQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNK-----LMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKS-NFPFSLSQNPLKLILERSVDYENKKHYQVVLIAC--DNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRT---WIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRD-LTQSRILDLTDPGST--WFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDY-EECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPI---WKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND 2404
            S+++ EN +IGT V  +++S A       V + LE  + +             S+K  F + N    +     +DRET           +   L+ V ++K            I + D+ND AP F + +    + E++ V + + +   VD D      + Y I +  +S ++    + +P   ++  + D + ++  QVVL     D G P L  N +VI+N+T+ ND  P F +S+Y A + E++  G  V+   A D D G+   + YS  +        F +D + G ++  +  +   +  + F + ATD       GR+    + + + D+N++ PV        F  S +     +E  EN RI   +  +   D D  + +     I+        N  ++ +V  +   ++ KLL     D E    + L +   D G   +     + I + D N+  P F +  Y   I+E++   + +  V    RD  T + ++     G+T     I+ +GT+  +  +D+EKI  L   V A ++G       A V++ VID+NDN P+F+ +S    + E+    +    +  FD DS +  ++++ LL+             LF L+  TG +     +DY      Y++ V+  D G PP S+     + VVD+ND  P+   W Y        ++      DS +  V A D DS +   + Y   +  D
Sbjct:  288 SYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGY------------FSMK--FDVLNDESIIAVGQSLDRET----------HDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILT----PNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG-----GRSCNATVHVSLTDLNDNQPV--------FDPSSYS----VEYFENTRIGQSICQLKAIDRDSPKFAITRFIIE------QGNADEVFSVDGSGLITLAKLL-----DRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPG---------TLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSY------TAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVD 956          

HSP 10 Score: 101.679 bits (252), Expect = 1.654e-21
Identity = 172/730 (23.56%), Postives = 293/730 (40.14%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSL-SQNPLKLILERSVDYEN--KKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKF--GELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFS--IKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNE-RSIY--------KLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTW-------FSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLAS-----------------------KRFEVEENLKGFYEIG----KIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLY-SITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-KYNVVHYFLHNHNDIFEINHLTGEITFKR 2449
            F I  S+G+L T +++DRET     L  + ++ T     +     +  + I I D NDN P F+Q   S ++SE +   + I      D DS     I Y +     SN  + + S +    I+  +  +E   K+ Y    IA D G+        V I I ++N+ +P F ++ Y   I  +T    +V    A D D  K   G++ Y      +     F ++  TG +     F+ P + + +  I A D    PL G   + + + ++ +  P             +F N T   VS    IP              ENS+   +I ++  +   +     ++I  N+ R+ Y         + +  + D E TK F L+++    G    +    ++I++ D N+  P F  +     + E+T        VKV   D+       +T   S W       F+ID  +G I+T  +LD E        +   + GI   +++ +V V V D+NDN P F   S                       K   +  NLK     G    ++ A D+DS  N+++ Y    T S+       +  ++++  TG+I +  T+D    D +  I V+ +D G PP    QR  ++V  +    P ++ P+    V   ++     SVLT VR  DN +      + Y + N N  F I   +G I+  +
Sbjct: 1693 FTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTA-----FANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTL-----SNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNST-SLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPP-------------RFLNQTPARVS----IP--------------ENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVT--YSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSD-------QIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP----QRALVYVRIIITREPKFELPSYFGKVPENAMMGT--SVLT-VRVTDNAAGLPLGRISYNIENSN-YFRIGQRSGVISVNK 2363          

HSP 11 Score: 83.5741 bits (205), Expect = 5.084e-16
Identity = 147/619 (23.75%), Postives = 248/619 (40.06%), Query Frame = 2
Query:  740 SNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAII--NEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQI---------SIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVI-EVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKI---INVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQ---NSAITKIEIHIKDENEYQPTFDQNLYEIY-IKENTSPETNVKTVKVYDRDLTQSRILDLT-DPGSTWFS-----IDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQ--LTLQLQAIDANSKN 2512
            S  P  L  N   +  +  +D E    Y + ++       S     TV++ + + ND SP F R     ++    D    + ++   A D D G      Y+  SG    V K  S     G +         SI     +   +  +I A+D       G   + + V D N++ P             +F N +    + EN  +   +  ++ SD D G N+     I++  + D    F I     VI  N R           D E  + + + +   D G      +SAI +IE+   ++N         L   Y + EN +  T V  V V D D  ++  +++T + G  +FS     ++D   I+    LD E         + I++G    T+     + V DVND  PKF   +    V EN      +  ++A D+D   NS+L Y + NTT    +RS     F ++P++G+I +   LD E+     +TV V D G PPLS+     +++ D NDN P +   + + ++   S      S + ++ A D D  + +++ Y +   N  F ++   G +T  R      Q   T Q+ A D   ++
Sbjct:    1 SGIPADLEYNAGVITTKTVLDREKVSAYNLTIVEFSTPPKSY----TVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI---AVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKP-------------EFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIET--HSDPQAIFGIHPTTGVIVNNVR----------LDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTT---ESRSY-LHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSG---SPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRS 580          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 174.866 bits (442), Expect = 5.790e-44
Identity = 189/753 (25.10%), Postives = 331/753 (43.96%), Query Frame = 2
Query:  245 ISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILE---RSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ----SRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVT----LDYEECDLYSITVKVIDSGRPPLSNIQRF---FIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEITFKR 2449
            ++ KL EN SIGT V  I  +    +   +   + N + +                 LF I+N +G++ T++E+DRE V Q  L  + ++   L    V+ L+ + V +E  D+NDN P F     +I   E S   + I   + +D D      + Y I      N    ++ N +  ++      +D E ++++   + A D+G PS     +V I + + ND SP+F  ++Y A + E+   G  VL   A DKD G   +L Y  S     +   F+ID  TG I+  +  N  +   +  +++A D A     G T + + V D N+H P               Q+     V E+ ++   +  +  +D D  +N+R   +I S       N   + +V ET          D+    E+   ++L I   DHG P   + T + I I+D N+ +P F +++Y + ++E+   +T V  V   D D       +  +   D    ++   ++G I+ K  LDYEK    +  V A + G    T +  V ++V DV+DN P F       E+ EN+   + +  ++A D D+E + K  YY + + +        + +F +   +G+I  N T    L+ E    Y + V  I   R  L+  +      I V+D+NDN P +   +   +V+      I D+ +  V+A D D  +   + + +   N N +F++++ TG +T  R
Sbjct: 1197 LTVKLSENASIGTNVTKIT-ALDKDIGDTISYSIANGDPY----------------GLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNL----VSDLLKVVVQVE--DVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVE----NVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSG---VLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFT------------QSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISS------GNTSLMFSVNETTGIISTTSTLDR----EQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGN-------TDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAI--SRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLE-DTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTR 1887          

HSP 2 Score: 154.066 bits (388), Expect = 1.468e-37
Identity = 160/579 (27.63%), Postives = 273/579 (47.15%), Query Frame = 2
Query:  752 FSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQP--TKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIIN--KDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGS--TWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV-----LTRVRAVDNDSDKYNVVHYFL--HNHNDIFEINHLTGEITFK 2446
            F +S++   +I++  +D E K  Y + + A +    +      V I +T+  D+ P F  S+ T  ++E+  IG  V    A DKD G    + YS ++G  +    F+ID  TG+I  +   ++   T+++  ++A D   N +     + + V DVN++ PV     +  + I  ++     E  E   I  Q+  I   D D G+N+     + SI+    D++    I  VI          L     D E  +YF+  I   D G P  S+   + I + D N+  P F+   Y  Y++EN    T V  V   D+D+  +  L     G   T F+ID D+G I+T+  L+ E+    +  + A++  I++   + RV + V D ND+ P+F+ +   F V E++K  + +G++   DED   N+++ YY+   +S N +      +F +N TTGII +  TLD E+   Y++ +   D G P L +     I + D+NDN P++       +V N++L   R+SV     + +V A D D        Y +   + +D+F I+  TG IT K
Sbjct: 1135 FYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGD--TISYSIANG--DPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSV-NLVSDLLKVVVQVEDVNDNPPVF---SMPGYTIEYWE-----ESPEGTSI-LQVKAI---DADIGDNAAV---LYSIVENVTDYVTVNAITGVIS---------LGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYI---SSGNTSL-----MFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFS-----KSVYNVTL---RESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIK 1668          

HSP 3 Score: 149.443 bits (376), Expect = 3.151e-36
Identity = 181/699 (25.89%), Postives = 317/699 (45.35%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRE--TVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGN-QTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI-IKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGST--WFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPN----IHDNVMNISLQNIRDSVLTRVRAVDNDSDK-YNVVHYFLHNHN--DIFEINHLTGEITFKRLNIKP 2464
            F ++ S+GD++  S +DRE   V  LN+   N       IV+  +     V+I + D+ D+ P F   SL++ LSE++ + +  N+ +   LD D    I Y I +       F++     ++     +D EN   Y++ + A D+   +L  +   V++ + + ND  P+F    YT    E++  G  +L  KA D D G    + YS     + V  Y +++  TG IS+   + ++  +  F F+I+ATD           + + +VD+N++SPV   N  D +            V EN      +  +T SD D G N++ S  +  ++       F I       +     +   +  + EET  ++L +   D         T++ I + D N++ P F Q+ Y   ++E+      V  V   D D+   +R+      G+T   FS+++ +G IST   LD E+    +  + A + GI +  S+  V + + DVNDN P FS +     + E++    ++ ++ A D D   N +  Y +    +++        +F ++  TG+I     LDYE+  LY++TV   D G PPL+      IHV D++DN P++  P     +++NV        R   +  V A D D++  +  V+Y + + N   +F I   +G IT   LN  P
Sbjct: 1135 FYVSRSTGDIIVDSPLDREFKNVYILNVTAAN-------IVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGT--NVTKITALDKDIGDTISYSIANGDPYGL-FTIDNVTGEIRTVAELDRENVTQYELFVQAKDS--VNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSI---VENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVF--NNTDYYAY----------VRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVL----YTRFAI-------DPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDD--------VFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVT-------RGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVIT---LNCTP 1777          

HSP 4 Score: 138.272 bits (347), Expect = 1.016e-32
Identity = 158/631 (25.04%), Postives = 276/631 (43.74%), Query Frame = 2
Query:  407 LKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLD-QGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHG----------EPQNSAITKIE-----------IHIKDENEYQPTFDQNLYEIYIKENTSPETN--VKTVKVYDRDLTQS-----RILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFS------LASKR--FEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKV 2179
            L   F I+  +G++ T   ++RE      L  R  +  I       +++     I + D ND+ P F Q   + S+ E  KV   +      D D +    ++Y I   + S   FS+++    +    ++D E    Y +++ A D+G P+L  N +V+I I + ND  P+F +S Y   + E   +   V+   A D D+G  G+  Y  ++G  +    F ID  TG I+I  +  + + + +  ++ A D    PL G  ++ +HV DV++++PV        F   ++      E+ EN      +  +  +D+D +  + R    I+S                  N  S++ +        E++   +LN  C   G          E Q +AI+++            I + D N+  P FD   Y   + E+T P T+  + TVK  D D  +S      I+   + G   F +D+ +G ++    LD E     S  V+A ++G  + +SS  V++ V+D+NDN P         +  +R  F V+ENL     +G + A D D++    L YY +  T E       +K F LN T+G + + +TLD E+  ++ + VK 
Sbjct: 1442 LYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVI-----ITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTS-LMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAG--DTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPV--------FHKPRYS----AELYENVTRGHHVITVNATDIDAEASHKRVYYRIES-----------------GNTDSMFLI-------GEQSGVITLN--CTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENG--VFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTK---NLIYYYITNTEE-------QKYFILNETSGELRTRITLDREDSSVHYLYVKA 2014          

HSP 5 Score: 130.183 bits (326), Expect = 2.664e-30
Identity = 165/679 (24.30%), Postives = 288/679 (42.42%), Query Frame = 2
Query:  458 SEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQS--RILDLTDPGST--WFSIDD-SGTISTKIV----LDYEKIKKLSFNVLAINR-GIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYE--IGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPN---IHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHND--IFEINHLTGEI 2437
            S++DRE     N   R  +  +      +K     V I+++DINDN+P F        + E+    + + +    D D      + Y +  +  + F  ++  +   +     ++ E    Y + L A D+   +  G   VII +T+ ND  P F +S Y   + ED ++G  V      D+D      + Y  SSG       FS+++ TG IS     +  Q   +   I A D     L   T + + + DVN++ P+        F  S +     + + E+  +  Q+  +  +D D+G N + +  I +    D  + F I       + +   +      D E+T  ++L +   D G P  +    +EIH+ D ++  P F +  Y   + EN +   +V TV   D D   S  R+    + G+T   F I + SG I+        L+ E   +    V AI+R  +    S     + V+DVNDN P+F   S    V E+     +  I  + A D D   + ++ + ++ + +EN        +F+++  TG++     LD E+   YS+ V   D G P LS+     I V+DMNDN PI + P    I +     S++   D+ +        D D  N+++Y++ N  +   F +N  +GE+
Sbjct: 1355 SQLDREVEEYFNFTIRATDSGVP-----SKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRF--AIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSG--NTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPL--------FSKSVYN----VTLRESVFLKTQVVQVIATDPDEGANGQFTYKITA---GDTDDVFYI-------DANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIV-SGNENG-------VFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNLIYYYITNTEEQKYFILNETSGEL 1994          

HSP 6 Score: 126.331 bits (316), Expect = 3.778e-29
Identity = 162/642 (25.23%), Postives = 259/642 (40.34%), Query Frame = 2
Query:  419 FKINNSSGDLVTISEIDRETV--CQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRS-NYTAIINEDTQIGEIVLSP-KAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIK--------ATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSEN-NRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLL----ADKSFDAEETKYFSLNILCYDHGEP---QNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTIST----KIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRP-PLSNIQRFFIHVVDMNDNGPIWKY 2269
            F +N  +G +     +D +T+   Q +L+ ++      +I          V + + D+NDN P F  +  +  ++E+    + +      D DS +   + + I         FS++ + L +   R +D E    Y + + A D+G  S   +  + +N+ +END +P        T  I+E    G ++LS   A D D G  G+L YS S G       F+++  TG++ I      PT     +K         TD    P    T + + ++DVN+++P    NP  S          VI V E    I   L  I  +D D   N + +  +      D   +F++  V  T E S+ K L       S +A+    F L+I   D   P   + SA  ++ I ++D N+  P F    YE  + E   P +NV  V   D+DL           G   ++I D          K+V  Y   KK       + +  K       V +YV DVNDN P F+ +    +V EN      + ++HA D D   N K+ Y L N   ++         F +N  TG I     +D E    + +TV+  D G P          I V D NDN P + +
Sbjct:  436 FSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIAT------VTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGH-FSINGSGL-VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGG----DSRFTLNSATGRLQI-----SPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATY------VITVDEGPGTINKTLIDINATDPDADANGKVAYSLSG----DEHGFFRLDPV--TGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYK--------GKVIYNITDGDENRKCEVEKLVRHYNWHKKN----CVLCKESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDD--------AFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSF 1028          

HSP 7 Score: 114.775 bits (286), Expect = 1.466e-25
Identity = 197/822 (23.97%), Postives = 334/822 (40.63%), Query Frame = 2
Query:  365 KEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVN--------KLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQT--VIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDK-----------------------------------APNPLIGRTWIFL--------------------HVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETN---ERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDL--TQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGII-YSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWK----YPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHN-HNDIFEINHLTGEITFKR-LNI-KPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQFPLSS 2587
            K  +SLS +  G      F+++  +G+L    E+DRE+  Q++   + +   +L I + +        K   + V+I + D NDN+P F+  +    LSE+++  S +      D D +    + Y I    ++           K  +E+ V + N      VL  C   K S C  +   V+I + + ND  P+F +S Y A + E++  G  VL   A D+D G  G++ Y  ++G  +    FSI+  TG+I++    ++     F  +++A D+                                   A N  +G T   +                     ++      P+ L+N  +S L  K   +  + VSE+      +  +T +D D+G        I +II       F   N  E      RS   ++ D   D E    + LN+   +         T++ I + D  + +P F+ +   + + EN S  TNV  +   D+D+  T S  +   DP    F+ID+ +G I T   LD E + +    V A +  +   +   +V V V DVNDN P FS+     E  E       I ++ A D D   N+ + Y ++   ++            +N  TG+I   +  LD E  + ++ T++  DSG P  S+     I +VD+NDN P++     Y  + +N      Q     VL  V A D D      + Y L       F I+  TG IT +  LN  + G  TL L+A+D+  +    +  +I+ +   +    QF  S 
Sbjct:  745 KVAYSLSGDEHG-----FFRLDPVTGELSVRKELDRES-PQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENR----------KCEVEKLVRHYNWHKKNCVL--C---KESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKD--DAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLIND-ESPLFEKSMYY--VNVSESASRGIVIGRVTATDRDEG--------INAII-------FYSSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYG-LFTIDNVTGEIRTVAELDRENVTQYELFVQAKDS-VNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTD---------YVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVREN------QPAGTPVLV-VTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSG 1507          

HSP 8 Score: 110.923 bits (276), Expect = 1.903e-24
Identity = 158/657 (24.05%), Postives = 273/657 (41.55%), Query Frame = 2
Query:  563 VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGK-PSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPT--KFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKL-LADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFD----QNLYEIYIKENTSPETNVKTV-----KVYDRDLTQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFT-------------SSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFF--IHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEIT 2440
            V + +I++NDN P F + S + ++ E     + I      D D   F  + Y ++    +   FS++ +   +   + +DY+  + YQ  L+  D G         TV + + + ND  P F    YT+ I E+   G IV    A DKD G+ G L ++ S+G D    +FSI+  +G ++  +  ++ T   +  ++ A D   +       + ++V+D N+++P I     D   I+      + E +    +   L+ I   D D G N + +  +    ++  LN             +  +L ++    D E    + L I   D+G P N+  T + + I D N+  P FD    Q+L    I  +  P T  KT+        D D        L+     +F +D  +G +S +  LD E   ++S N     R +   T             ++ RVS+ V D NDN P+F   +    + E  +    + ++ A D+D E   K+ Y +  T  + N +   EKL            +     + C L           +    +++R +  I+V D+NDN P++       +V+  S      + + RV A D D      + Y L N N  D F IN++TGEIT
Sbjct:  375 VTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAY--FSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDD--GGHFSIN-GSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQI----TDGLTITT----NISEGAGGGTV--LLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLN------------SATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRES-PQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNI--TDGDENRKCEVEKLVR----------HYNWHKKNCVLC----------KESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTG---TPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEIT 978          

HSP 9 Score: 110.923 bits (276), Expect = 2.125e-24
Identity = 185/791 (23.39%), Postives = 320/791 (40.46%), Query Frame = 2
Query:  254 KLVENCSIGTIVGNIN-LSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGK---FGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFS-------------------------IKATDK-APNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGE-PQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDL----TDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFS--LASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGII-YSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQ-----NIRDSVLTRVRAVDNDSDKYNVVHYFL-HNHNDIFEINHLTGEITFKR-LNIKPGQLTLQLQA 2491
            K+ EN  +GT +  I+ + A     S VQ +  N+       + +   F       F +N+ +G+L     +D E      L+   E+  + ++ S   ++     IE+ DI+D  P F Q      + E++ + S +   E  D D     PI Y I     S+  F++  N   + +  S+D E    +++ + A +   P+     TV++ + + ND  P F +S Y   + ED  +   V+S +    D  K   F  + Y    GAD  K  F+ID  +G + I K  +   +  F+                         + AT+            + L +++VN++ P+        F  S +      E++    I    A IT +D D G     +  ++         YF +             + A +  D +  + +  +++  D G   Q  AI  + + ++D N+  P F    Y   I EN    T V  V   D+D  ++  L       D G   FSI+ SG ++T   LD E I   +  V A + G+ S     +++V V+D NDN P+ +  L       E    G   +  I A D D+  N +L Y +          S  +  F LN  TG +  S   LD E  D Y + + V D+G PP +N     + ++D+NDN P +  PN   ++    +         +  L  + A D D+D    V Y L  + +  F ++ +TGE++ ++ L+ +  Q++   Q 
Sbjct:   54 KIAENARVGTTILKISAIDADSGTNSQVQYKFSNA-------TATQTPF-------FSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVI-----IEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIIS-GNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHL-VGADSDK--FAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPM--------FAKSSYNYTMDEEITPGTHI----ADITATDADLGTFGALTYELRG----GQAAYFSV-------NADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGG-HFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM----------SGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFD-PNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQG 786          

HSP 10 Score: 108.997 bits (271), Expect = 7.752e-24
Identity = 168/687 (24.45%), Postives = 281/687 (40.90%), Query Frame = 2
Query:  413 NLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGR----TWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTV-IEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNE-RSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ------SRILDLTDPGSTWFSIDD-SGTIS-TKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIR-DSVLTRVRAVDNDSDKYNVVHYFLHNHND--IFEINH 2422
            + F INN +G++     IDRE V    L  + E+    Q    ++  +  V I + D NDN P                                QF    Y  +    S    +++  P + I   ++   +       L+     +P           IT  NDESP+F +S Y   ++E    G ++    A D+D+G    + YS S+GA E K Y S  + TG I +    ++  K  + +  T  A N + G     T + + V DV +  P              F + ++ +++SEN  I   +  IT  D D G+         SI N D    F I NV  T E R++ +L      D E    + L +   D      S + K+ + ++D N+  P F    Y I   E +   T++  VK  D D+        S + ++TD    + +++  +G IS     LD E  +  +F + A + G+ S +S+A V++ ++D+NDN P F+       V EN      +  + A D+D   N+KL+Y L           +    F ++P TG I +   L+ EE   Y++T++ +DS         R  I V D ND+ P +       +V     ++++    + RV   D D +    V Y++ + N   +F +N 
Sbjct:  966 DAFSINNVTGEITVAGVIDREAVHTFVLTVQAED----QGEPSSRKTFAEVVITVKDENDNFP--------------------------------QFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRP-----------ITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYS-SNGA-EAKFYVS--RSTGDIIVDSPLDREFKNVYILNVT--AANIVAGAQDTTTQVHITVTDVIDDKPY-------------FNSSSLTVKLSENASIGTNVTKITALDKDIGDTISY-----SIANGDPYGLFTIDNV--TGEIRTVAEL------DRENVTQYELFVQAKDSVN-LVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTD----YVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVL---------SGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVR----EDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNE 1555          

HSP 11 Score: 101.293 bits (251), Expect = 1.752e-21
Identity = 142/608 (23.36%), Postives = 248/608 (40.79%), Query Frame = 2
Query:  848 NGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIK--RFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKT----VKVYDRDLTQSRIL-DLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFN-----------------------VLAINRGI-KSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVV-----DMNDNGPIW-KYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDI--FEINHLTGEITFKRLNIKP-GQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
             G  +  G++   + + + ND +P+F    Y A I E+ ++G  +L   A D D G   +++Y FS+       +FS++   G++++     F     +   + A D     L  RT + + V D+++  P  L            Q+  + E+ EN  I   +  +   D D G N+     +  II+ +    F I       + +   +  + S DAE+T  F + +   +  +P ++    + + + D N+ +P F Q++Y   ++E+ +    V +    V   D++    R+L  L    S  F+ID  SGT+     LDYEK    +F+                       V+A      + F+++A V++ +I+VNDN P F+ +S  + ++E +     I  I A D D      L Y L         R      F +N   G I +   LDY+    Y  ++ V D G       Q   I  V     D+NDN P +   P   D   N+    I    + +V A D DS +   + + +   +D   F IN      T + L+ +     TL + A D    + H    L V ++
Sbjct:   21 GGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFL------------QSFYLKEIEENTPIGSTVVTVEARDGDVGINNPI---LYEIISGNSDGVFTI-------DSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYEL---------RGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGG----GFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTI----VFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVL 589          

HSP 12 Score: 85.1149 bits (209), Expect = 1.487e-16
Identity = 177/724 (24.45%), Postives = 299/724 (41.30%), Query Frame = 2
Query:  419 FKINNSSGDL-VTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXX----------XXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKK---------HYQVVLIACDNGKP-SLCGNQTVIINIT--NENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQN-SAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHN--DIFEINHLTGEI----TFKRLNIKPGQLTLQLQAIDA 2500
            F +N+++G L ++ + +DRE     +LI       +    S        V++ I+D+NDN PAF         +            +K    IN  +P   D+D    + Y +    +  F F L     +L + + +D E+ +          + + + A D   P S   + TV ++IT  + ND SP F   NY   ++E  + G  V+   A D+D    G++ Y+ + G DE +K   ++K      +++ +N   K     K +  +    + RT++ ++V DVN++ PV        F  SK+      +V EN+     +  +  SD DQG N + +  + +  NKD  + F I NV  T E ++  ++     D E    F L +   D GEP +     ++ I +KDEN+  P F    YE  I EN SP                         GST   + D            +KI   +    +  R   +   +AR    +  +ND  P F  +     V E+      IG++ A D D  IN+ + Y      S N A    E  F ++ +TG I  +  LD E  ++Y + V   +          +  I V D+ D+ P   Y N     + +S      + +T++ A+D D    + + Y + N +   +F I+++TGEI       R N+   Q  L +QA D+
Sbjct:  646 FTLNSATGRLQISPTGLDRELKDSYDLI-----INVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDP---DADANGKVAYSLSG-DEHGF-FRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDG-DENRK-CEVEK------LVRHYNWHKKNCVLCKESKCS----VERTYVVIYVDDVNDNDPV--------FNQSKY----AADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNG-NKD--DAFSINNV--TGEITVAGVI-----DREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAEN-SPV------------------------GSTITMVPD------------QKISSSTLRPRSSPRAPAALL-TAREKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFY------SSNGA----EAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKP---YFNSSSLTVKLSENASIGTNVTKITALDKDIG--DTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVT--QYELFVQAKDS 1270          

HSP 13 Score: 82.4185 bits (202), Expect = 9.375e-16
Identity = 67/203 (33.00%), Postives = 106/203 (52.22%), Query Frame = 2
Query:  581 DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPF-SLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNP 1177
            D NDNAP F +      ++E+++V + I     +D DS     +QY+  +   +  PF SL+    +L L   +D+E  + Y +V+IA D G P L    TVII +T+ +D  P F +S Y   I E+T IG  V++ +A D D G    + Y   SG +D V   F+ID  TG I++    +      F+ ++KA+ + P+P
Sbjct:   38 DYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGV---FTIDSNTGVITVNGSIDAEKTDVFRITVKAS-EVPDP 236          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 242.662 bits (618), Expect = 1.402e-65
Identity = 227/812 (27.96%), Postives = 400/812 (49.26%), Query Frame = 2
Query:  179 WIVGFLVLILNLLFS-SKAMLKEISFKLVENCSIGTIVGNINLS---AQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            +++G L+  + L  S ++ ++  I  +L EN  IG I  ++N+S   A     +N+  +L +             + G S   L ++  ++G++ T S  IDRE +C  +  +  E    +++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+      +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  +     I E++ IG  V+  +A D D G   E+ Y F +  +   K+ F+++  +G I++ +  +  +    K S+ A+D + +P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + I  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK ++  I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E   +  F V A + G     + A V V V+D NDN PKF+    +F V ENL  +  +G I   D D+  N+ ++  +LN  +EN         F L+P +G+I SNV+ D E+   Y+  V+ IDSGRPP S+  +  I+V+D+NDN PI  YP  + +   + L +I  SV+  V AVD+D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:    7 YLLGSLLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVS-------------KAGDS--PLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELIN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP--ARATVIINVTDVNDNPPNIDLR----YIISPI-NGTVF-LSEKDPINTKIALITVSDKDTDINGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILND-NEN---------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 242.662 bits (618), Expect = 4.295e-65
Identity = 227/812 (27.96%), Postives = 400/812 (49.26%), Query Frame = 2
Query:  179 WIVGFLVLILNLLFS-SKAMLKEISFKLVENCSIGTIVGNINLS---AQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            +++G L+  + L  S ++ ++  I  +L EN  IG I  ++N+S   A     +N+  +L +             + G S   L ++  ++G++ T S  IDRE +C  +  +  E    +++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+      +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  +     I E++ IG  V+  +A D D G   E+ Y F +  +   K+ F+++  +G I++ +  ++      K S+ A+D + +P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + I  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK ++  I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E   +  F V A + G     + A V V V+D NDN PKF+    +F V ENL  +  +G I   D D+  N+ ++  +LN  +EN         F L+P +G+I SNV+ D E+   Y+  V+ IDSGRPP S+  +  I+V+D+NDN PI  YP  + +   + L +I  SV+  V AVD+D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:    7 YLLGSLLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVS-------------KAGDS--PLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELIN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP--ARATVIINVTDVNDNPPNIDLR----YIISPI-NGTVF-LSEKDPINTKIALITVSDKDTDINGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILND-NEN---------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 242.662 bits (618), Expect = 4.472e-65
Identity = 227/812 (27.96%), Postives = 400/812 (49.26%), Query Frame = 2
Query:  179 WIVGFLVLILNLLFS-SKAMLKEISFKLVENCSIGTIVGNINLS---AQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTIS-EIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEII--DINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNP-----LKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKRFNQPTK--FKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQ-SRILDLTDPGSTWFSID-DSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSD-----KYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIM 2548
            +++G L+  + L  S ++ ++  I  +L EN  IG I  ++N+S   A     +N+  +L +             + G S   L ++  ++G++ T S  IDRE +C  +  +  E    +++V +    +  + I+II  D NDNAP F    ++IS+ E++ + S+  +    D D+      +Y + +  +S F   + + P      +LI+++++D E K  Y + +   D G P       + + +T+ ND  P+F  +     I E++ IG  V+  +A D D G   E+ Y F +  +   K+ F+++  +G I++ +  ++      K S+ A+D + +P   R  + ++V DVN++ P I +     ++IS   N TV  +SE + I  ++A ITVSD D   N +  C I+    KD   + K    +  N+   Y L      D E TK ++  I+  D G+P  +    + + ++DEN+  P F Q + E+ + EN   +  + T+   D D  + + I+    P +++F +D  +G ++   V D E   +  F V A + G     + A V V V+D NDN PKF+    +F V ENL  +  +G I   D D+  N+ ++  +LN  +EN         F L+P +G+I SNV+ D E+   Y+  V+ IDSGRPP S+  +  I+V+D+NDN PI  YP  + +   + L +I  SV+  V AVD+D+      KY +V     N+  +F I+ +TG IT +    KP    + L  +  N  ++   +SL   ++
Sbjct:    7 YLLGSLLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVS-------------KAGDS--PLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELIN-GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP--ARATVIINVTDVNDNPPNIDLR----YIISPI-NGTVF-LSEKDPINTKIALITVSDKDTDINGKVICFIE----KDVPFHLK---AVYDNQ---YLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILND-NEN---------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVS---GNNKGLFRIDPVTGNITLEE---KPAPTDIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: PCDH8 (protocadherin 8 [Source:NCBI gene;Acc:101158635])

HSP 1 Score: 238.424 bits (607), Expect = 2.898e-64
Identity = 197/714 (27.59%), Postives = 335/714 (46.92%), Query Frame = 2
Query:  179 WIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLK----NLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTI-LQIVSVNKLMW--IYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQ---HLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSG-ADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQS-----RILD---LTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSL-----ASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVD 2239
            W  G LVL   +  +  A  K + ++  E  + GT++GN+                  ++D     S S N F R +K    +  ++  S G L     IDRE +C+  L      C I   +VS +K  +  I++ +E+ DINDN+P F +   S+ +SE++ V ++I L+  VD D        Y+I    H        +      +L+L + +D E +  Y + L+A D G PS  G   + I + + ND SP+F R +++  + ED  +G ++L   A D D+G  GE+ Y F      E+++ F +D+KTG++++     F   T ++F ++ATD  PNP      I + V DVN+++P I + P+ S          +  ++E       +A ++ SD D G N +  C   ++   DH   F++    E +    + +++    D E+   ++L ++  D G P    IT+  I + DEN+  P F + +YE+ + EN  P   + TV   D D+  +     ++ D   +  P S + S+D  SG++      +YE +K L   V A + G    + SA V V ++D NDN P  +       S    +  +    Y I ++ A D D  +NS+L+Y L   T E         +F +N  TG IY N  L ++  +  S+TV V D+GRP L++       +++
Sbjct:    6 W-CGLLVLACLVSLADVAQGKTVKYQTFEEDAPGTVIGNL------------------AKDISLSPSSSRNNF-RIMKQFNSSFIRLRESDGQLSIGERIDRERICKHTL-----QCLIAFDVVSFSKEQFKLIHIEVEVKDINDNSPEFPRKESSLEISENTAVGTRIPLDFAVDEDVGVNYIQSYQISVNSHFSIDVLSRADGVKYAELVLMKELDRETQASYALELVAMDGGNPSRSGTTRINIKVKDYNDNSPVFDRKSFSVDLREDAPVGSLLLDLNAEDPDEGLNGEVVYGFGHQVPPEIRQLFRVDRKTGRLTLESPVDFESKTTYEFDVQATDLGPNPSPAICKIVVQVQDVNDNAPEISITPMTSITAG------IAYITEAAARESFVALVSTSDRDSGANGQVHC---TLYGHDH---FRLQQAYEDS----FMIVSTSPLDREKIPEYNLTVVAEDLGSPPFRTITQYTIRLTDENDNAPVFSKPVYEVAVVENNPPGAYITTVVARDMDMGSNGKVTYKLADTYVMGSPISAFVSLDPASGSLYALRSFNYELMKHLELRVTASDGGSPPLSGSASVHVRIVDQNDNSPVITQPPLNNGSAEVLLPRDSPTGYVITRVEARDADEGVNSELSYGL--ATGE-------PSVFSVNKVTGEIYLNQVLSHDVDETLSVTVTVSDNGRPALTSTATLHFLIIE 669          

HSP 2 Score: 131.724 bits (330), Expect = 1.631e-30
Identity = 161/604 (26.66%), Postives = 253/604 (41.89%), Query Frame = 2
Query:  716 YRIQHLHKSNFPFSLSQNPLKLILERSVDYEN-KKHYQVVLIACDNGKPSLCGNQTVIINITNE----NDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDK-------KTGQISIIKRFNQPTKFKFSIK--ATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYE------IYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSI----DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEV-EENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDS----VLTRVRAVDNDSDKYNVVHYFLH-NHNDIFEINHLTGEI 2437
            +RI     S+F   L ++  +L +   +D E   KH    LIA D    S    Q  +I+I  E    ND SP F R   +  I+E+T +G  +    A D+D G      Y  S     V  +FSID        K  ++ ++K  ++ T+  ++++  A D       G T I + V D N++SPV        F    F     +++ E+  +   L  +   D D+G N          +  +    F++       +R   +L  +   D E    +  ++   D G   + AI KI + ++D N+  P               YI E  + E+ V  V   DRD   +  +  T  G   F +    +DS  I +   LD EKI + +  V+A + G   F +  + ++ + D NDN P FS       V E N  G Y I  + A D D   N K+ Y L +T    +  S       L+P +G +Y+  + +YE      + V   D G PPLS      + +VD NDN P+   P +++    + L   RDS    V+TRV A D D    + + Y L      +F +N +TGEI
Sbjct:   59 FRIMKQFNSSF-IRLRESDGQLSIGERIDRERICKHTLQCLIAFD--VVSFSKEQFKLIHIEVEVKDINDNSPEFPRKESSLEISENTAVGTRIPLDFAVDEDVGVNYIQSYQIS-----VNSHFSIDVLSRADGVKYAELVLMKELDRETQASYALELVAMDGGNPSRSGTTRINIKVKDYNDNSPV--------FDRKSFS----VDLREDAPVGSLLLDLNAEDPDEGLNGEVVYGFGHQVPPEIRQLFRV-------DRKTGRLTLESPVDFESKTTYEFDVQATDLGPNPSPAICKIVVQVQDVNDNAPEISITPMTSITAGIAYITEAAARESFVALVSTSDRDSGANGQVHCTLYGHDHFRLQQAYEDSFMIVSTSPLDREKIPEYNLTVVAEDLGSPPFRTITQYTIRLTDENDNAPVFSKPVYEVAVVENNPPGAY-ITTVVARDMDMGSNGKVTYKLADTYVMGSPIS---AFVSLDPASGSLYALRSFNYELMKHLELRVTASDGGSPPLSGSASVHVRIVDQNDNSPVITQPPLNNGSAEVLLP--RDSPTGYVITRVEARDADEGVNSELSYGLATGEPSVFSVNKVTGEI 629          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000036663.1 (pep primary_assembly:ASM223467v1:10:15171740:15179813:-1 gene:ENSORLG00000029341.1 transcript:ENSORLT00000036663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 233.802 bits (595), Expect = 1.733e-63
Identity = 201/701 (28.67%), Postives = 345/701 (49.22%), Query Frame = 2
Query:  176 MWIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIY-VNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSL----SQNPL-KLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSS-GADEVKKYFSIDKKTGQISIIKR--FNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDL--------TDPGSTWFSI-DDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPK-FSLASKRFEV-EENL----KGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLS 2206
            MWI  ++V +L  +F  +A+  + S+ + E  ++GT+VGN+     L    NVQ          +  +        S +  F++N  +G L    +IDRE +C          C+I     +N  + +Y + I I+D+ND++P F+  S  I++SES+    +  L    D D ++     Y++      N  FSL     +N + +L+L++S+D EN+    + L A D G P   G   +I+N+ + ND +P+F +S Y A + E+ + G  +++  A D D G  G++ YSFS  G  +    F ID+KTG ++ IK   F + + F+  ++A+D + +P+     + + VVDVN+++P I V    S L S         V E+      +A ++V D D G+N   +C I + +       FK    +E N ++ Y L+ D   D E    ++++I   D G+P  S+ + I + + D N+ +P F +N+  I++KEN+   + +KTV   D D+ Q+  +          + P ST  +I  ++G I +    DYEK+K   F V A + G+   +S+  V+V+V+D NDN P   +  S+   V  EN+    +  Y + KI A D DS  N+ L+Y+L      N        LF +  ++G I +   +   +   + + V V D+G P LS
Sbjct:   13 MWI--YVVALL--VFFWEAVSAQPSYSVPEEANLGTVVGNVAKDLNL----NVQ----------DLQTRMFQIVAGSKRKYFEVNLKTGALYVCEKIDREELC-----GNEAKCSITVEAVINNPLKLYRIEILILDVNDHSPVFQSESQRINISESTSAGKRFRLHSAEDADYERNSVTAYKLS----PNEYFSLVRHKGENTVPELVLQKSLDRENESLIHLTLTAIDGGTPPKSGTMNIIVNVLDINDNAPVFSQSLYKASVQENVKKGTTIITLNATDLDSGLNGQVSYSFSEVGRGKQADIFQIDEKTGIVTNIKNIDFEEDSAFEILVQASDNSLSPMTSDAKLLIEVVDVNDNAPEISVT---SLLNS---------VKEDVSTGTAIALVSVLDKDSGKNGMVTCKISNDVP------FK----LENNYKNYYSLVVDGELDREIAPQYNISITAADEGKPPLSSTSVIHVQVSDINDNRPLFTENIVNIFMKENSPSGSVLKTVSAVDADIEQNGRVTYSLLHTNINSMPLSTMINIRSETGEIISLQSFDYEKLKTFQFKVQATDSGVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYPAEAGYFVAKIRAVDPDSGYNALLSYHLSEPKGNN--------LFRIGTSSGEIRTKRRMSDNDLKSHPLLVLVSDNGEPSLS 656          

HSP 2 Score: 117.087 bits (292), Expect = 4.588e-26
Identity = 144/589 (24.45%), Postives = 249/589 (42.28%), Query Frame = 2
Query:  812 KKHYQV-----VLIACDN-GKPSLCGNQT-------VIIN-----------ITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISI--------IKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKI--INVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLS----FNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYP-NIHDNV--MNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLH--NHNDIFEINHLTGEITFKR 2449
            +K+++V      L  C+   +  LCGN+         +IN           I + ND SP+F   +    I+E T  G+      A D D  +     Y  S       +YFS+ +  G+ ++        + R N+ +    ++ A D    P  G   I ++V+D+N+++PV              Q+     V EN +    +  +  +DLD G N + S     +      + F+I     I TN ++I         D EE   F + +   D+     ++  K+ I + D N+  P          +KE+ S  T +  V V D+D  ++ ++         F ++++      +V+D E  ++++     ++ A + G    +S++ + V V D+NDN P F+       ++EN      +  + A D D E N ++ Y LL+T   +   S    +  +   TG I S  + DYE+   +   V+  DSG PPLS+     + V+D NDN P    P + H +V   NI         + ++RAVD DS    ++ Y L     N++F I   +GEI  KR
Sbjct:   73 RKYFEVNLKTGALYVCEKIDREELCGNEAKCSITVEAVINNPLKLYRIEILILDVNDHSPVFQSESQRINISESTSAGKRFRLHSAEDADYERNSVTAYKLSPN-----EYFSLVRHKGENTVPELVLQKSLDRENE-SLIHLTLTAIDGGTPPKSGTMNIIVNVLDINDNAPVF------------SQSLYKASVQENVKKGTTIITLNATDLDSGLNGQVSYSFSEVGRGKQADIFQIDEKTGIVTNIKNI---------DFEEDSAFEILVQASDNSLSPMTSDAKLLIEVVDVNDNAPEISVTSLLNSVKEDVSTGTAIALVSVLDKDSGKNGMVTCKISNDVPFKLENNYKNYYSLVVDGELDREIAPQYNISITAADEGKPPLSSTSVIHVQVSDINDNRPLFTENIVNIFMKENSPSGSVLKTVSAVDADIEQNGRVTYSLLHTNINSMPLS---TMINIRSETGEIISLQSFDYEKLKTFQFKVQATDSGVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYPAEAGYFVAKIRAVDPDSGYNALLSYHLSEPKGNNLFRIGTSSGEIRTKR 631          

HSP 3 Score: 101.679 bits (252), Expect = 2.678e-21
Identity = 105/416 (25.24%), Postives = 187/416 (44.95%), Query Frame = 2
Query:  377 SLSHNRFGRSLK-NLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLS---QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSF---SSGADEVKKYFSIDKKTGQISIIKRFN--QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAF----ITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEI 1585
            S S +  GR  + ++F+I+  +G +  I  ID E      ++ +  + ++  + S  KL+     IE++D+NDNAP     SL  S+ E     + I L   +D DS +   +  +I +    + PF L    +N   L+++  +D E    Y + + A D GKP L     + + +++ ND  P+F  +     + E++  G ++ +  A D D  + G + YS    +  +  +    +I  +TG+I  ++ F+  +   F+F ++ATD    PL     + + V+D N++SP IL         + +  H  +  SEN   P +  +    I   D D G N+  S H+         N F+I     + E    + ++D        K   L +L  D+GEP  SA   IE+
Sbjct:  277 SYSFSEVGRGKQADIFQIDEKTGIVTNIKNIDFEEDSAFEILVQASDNSLSPMTSDAKLL-----IEVVDVNDNAPEISVTSLLNSVKEDVSTGTAIALVSVLDKDSGKNGMVTCKISN----DVPFKLENNYKNYYSLVVDGELDREIAPQYNISITAADEGKPPLSSTSVIHVQVSDINDNRPLFTENIVNIFMKENSPSGSVLKTVSAVDADIEQNGRVTYSLLHTNINSMPLSTMINIRSETGEIISLQSFDYEKLKTFQFKVQATDSGVPPLSSNVTVNVFVLDENDNSPSIL---------APYSEHGSVN-SENIPYPAEAGYFVAKIRAVDPDSGYNALLSYHLSEPKGN---NLFRIGT--SSGEIRTKRRMSDNDL-----KSHPLLVLVSDNGEPSLSATVSIEV 663          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000042292.1 (SMESG000042292.1)

HSP 1 Score: 2197.55 bits (5693), Expect = 0.000e+0
Identity = 1137/1137 (100.00%), Postives = 1137/1137 (100.00%), Query Frame = 2
Query:  176 MWIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQFPLSSSLTFPVMXXXXXXXXXXXXXXXXXXXYFCYRKRCMYRNSGHSAVTSNCRXXXXXXXXXXXXXXXXXYDIPLDLVTDNDAFNQNIIEDSMKLILDPLYCNSSSSSNAFHQNDQNSNLETLLCKLQVDNIYQDFIRHGYSENYNDPKKDQQMLPTISSIQTPLNTHSETCILHSMTNREISSHFDPCKNKSASKLKALDSNDSTFDTYATFLNCSCNNVVTSDYENSPPMSKVLTAPFIFNGSAWIPNTSLTNEKFSIPNKKDMSKHQPLKSIMKKTTASFINIDXXXXXGHCLDTDQASSTHDSGCIVAYTDSSLPPRSISLLDNTYQCKKSQV 3586
            MWIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQISLSISLSESSKVKSQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQFPLSSSLTFPVMISIIGISSLISIVLVVFVFYFCYRKRCMYRNSGHSAVTSNCRKNDKIKDIKNQKDSKKSYDIPLDLVTDNDAFNQNIIEDSMKLILDPLYCNSSSSSNAFHQNDQNSNLETLLCKLQVDNIYQDFIRHGYSENYNDPKKDQQMLPTISSIQTPLNTHSETCILHSMTNREISSHFDPCKNKSASKLKALDSNDSTFDTYATFLNCSCNNVVTSDYENSPPMSKVLTAPFIFNGSAWIPNTSLTNEKFSIPNKKDMSKHQPLKSIMKKTTASFINIDSSSSSGHCLDTDQASSTHDSGCIVAYTDSSLPPRSISLLDNTYQCKKSQV
Sbjct:    1 MWIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQISLSISLSESSKVKSQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQFPLSSSLTFPVMISIIGISSLISIVLVVFVFYFCYRKRCMYRNSGHSAVTSNCRKNDKIKDIKNQKDSKKSYDIPLDLVTDNDAFNQNIIEDSMKLILDPLYCNSSSSSNAFHQNDQNSNLETLLCKLQVDNIYQDFIRHGYSENYNDPKKDQQMLPTISSIQTPLNTHSETCILHSMTNREISSHFDPCKNKSASKLKALDSNDSTFDTYATFLNCSCNNVVTSDYENSPPMSKVLTAPFIFNGSAWIPNTSLTNEKFSIPNKKDMSKHQPLKSIMKKTTASFINIDSSSSSGHCLDTDQASSTHDSGCIVAYTDSSLPPRSISLLDNTYQCKKSQV 1137          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000043597.1 (SMESG000043597.1)

HSP 1 Score: 306.605 bits (784), Expect = 5.462e-88
Identity = 258/808 (31.93%), Postives = 410/808 (50.74%), Query Frame = 2
Query:  194 LVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI---QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAP-NPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTV--IEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSI-YKLLADKSFDAEETK---YFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSID---------DSGTISTKIVLDYEKIKKLSFNVLAINRGI--KSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTT--SENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV-LTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYI 2545
            LVLIL +L SSK M+  I F++ EN  I + VG++N +      +  QLQ++  +          N F       F +N +   + T +EIDRE +C   L     +C +   V++N+ + I + + I+DINDN+P F+++     + ES  V  QI L++ +DLDS Q     Y +   Q  H++ F  + + + L L+L +S+DYE    + + LIACD G+P LC +Q ++I+I + NDE+P F   NYT ++ ED  +G ++L   A D++ G FG++ Y      D    + SID  +G I + K      K   +++A D A  N     T + + ++DVNNH P I V             + +  +E+ ENN   F+++FI V D D+G+N    C IQ+   K   N F + + +  N+ +  YKL   +S D E+      FS+N  C D+G+P   +   +++ + D+NEY   F ++ Y + I EN     ++ +  V D+D        L    S  F+++          SG I     LD EK  +  F++  +N       FTS A VSV V+D+NDN P++ +    FE++EN    YE+G++   D+D   NS+++   L TT        S NE LF ++    I+    ++DYE      I +   D G P   N     ++++D NDN P W YP+  DNV+NIS  NI+    LTRVRA+D DS   N + Y L   +D   I+  TGEI+  + +I+ G+  L LQ  D  +   ++S +L + I
Sbjct:   14 LVLIL-ILDSSKEMI--IKFRIYENVPINSKVGDLNTTIDALKLNKPQLQVQYCD---------RNPFDIEF---FYLNVTDASINTHTEIDREAICS-ELSGTTNDCFVTLGVTLNQYL-INIYVYILDINDNSPKFQKLERHFKILESESVNFQIKLDQAIDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAVDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCKIQT--TKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSIN--CQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLN--SSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELK-ILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTRLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTK-DIEAGKYDLFLQVTDNGNPMRNSSANLTIII 794          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000043597.1 (SMESG000043597.1)

HSP 1 Score: 307.76 bits (787), Expect = 1.779e-87
Identity = 258/808 (31.93%), Postives = 410/808 (50.74%), Query Frame = 2
Query:  194 LVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRI---QHLHKSNFPFSLSQNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAP-NPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTV--IEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSI-YKLLADKSFDAEETK---YFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSID---------DSGTISTKIVLDYEKIKKLSFNVLAINRGI--KSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTT--SENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSV-LTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYI 2545
            LVLIL +L SSK M+  I F++ EN  I + VG++N +      +  QLQ++  +          N F       F +N +   + T +EIDRE +C   L     +C +   V++N+ + I + + I+DINDN+P F+++     + ES  V  QI L++ +DLDS Q     Y +   Q  H++ F  + + + L L+L +S+DYE    + + LIACD G+P LC +Q ++I+I + NDE+P F   NYT ++ ED  +G ++L   A D++ G FG++ Y      D    + SID  +G I + K      K   +++A D A  N     T + + ++DVNNH P I V             + +  +E+ ENN   F+++FI V D D+G+N    C IQ+   K   N F + + +  N+ +  YKL   +S D E+      FS+N  C D+G+P   +   +++ + D+NEY   F ++ Y + I EN     ++ +  V D+D        L    S  F+++          SG I     LD EK  +  F++  +N       FTS A VSV V+D+NDN P++ +    FE++EN    YE+G++   D+D   NS+++   L TT        S NE LF ++    I+    ++DYE      I +   D G P   N     ++++D NDN P W YP+  DNV+NIS  NI+    LTRVRA+D DS   N + Y L   +D   I+  TGEI+  + +I+ G+  L LQ  D  +   ++S +L + I
Sbjct:   14 LVLIL-ILDSSKEMI--IKFRIYENVPINSKVGDLNTTIDALKLNKPQLQVQYCD---------RNPFDIEF---FYLNVTDASINTHTEIDREAICS-ELSGTTNDCFVTLGVTLNQYL-INIYVYILDINDNSPKFQKLERHFKILESESVNFQIKLDQAIDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAVDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDKLTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCKIQT--TKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSIN--CQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKD-NFSILSFAVIDQDALSFNEFHLN--SSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQY-VGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWIS-ELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTRLTRVRAIDADSVSSNRLTYELKAKHDSISIDPFTGEISLTK-DIEAGKYDLFLQVTDNGNPMRNSSANLTIII 794          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000030992.1 (SMESG000030992.1)

HSP 1 Score: 306.99 bits (785), Expect = 6.155e-87
Identity = 232/711 (32.63%), Postives = 365/711 (51.34%), Query Frame = 2
Query:  401 RSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPL--KLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKF--QNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNIL-CYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSI----DDSGTISTKIVLDYEKIKK--LSFNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQ-NIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAID 2497
            +S K LF I+  SG + T +EIDRE +C   +   N  C+I  +VSV + + I + I I+D+NDN P F+     I + E+ ++   ++LE+  DLDS QF    Y++  L   + PF+L  +P+  KL L + +D+E  + Y +VL  CD G  SLC  Q +II I + ND +P F + NY+ ++NE  ++G ++L   A+D + G FG++ Y      +   ++  ID KTG+I +IK      K   +I+A D    P    T + +H++DVN++ P +  NP  + + SK+   N   I++ EN  +   LA + V D D+G N + SC + S   K   +   ++N I+   +  YKL+ + S+D E   + S   L C D+G P+ S +  I I+I D NEY P FD   Y     E    E NV    + D D T +    +      WF I      +G +     +D EK  +  L   ++ I    K+FTSS+ V + VID+NDN P+  +    FEV EN      +G+I   D D   N++ +   + +   N +       F++N   G I S V LDYE+     I+V   D G P L++     + ++D NDN P W +P+  DN +N+S+      S LTR+RA+D D      + Y LH+   +F+++  TG++T     +KPG   LQ+ A D
Sbjct:   86 QSEKPLFVIDQYSGVISTSAEIDREAICP-KISGTNLPCSISLVVSVVEYL-INIKINIVDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKL--LTSEDLPFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTG--SLCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPLLGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEVRFNPSQN-VTSKYISDNFYQIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHS--TKPLKSKEILLNPIKGRHK-FYKLVTNVSYDKENDNHVSSYFLNCTDNGSPRLSTVVSININILDCNEYPPYFDSQFYSATTTEELKSE-NVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTDRIDLLIIIINIGLDNKNFTSSSSVLITVIDINDNPPEL-VGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAIDFQVN-KIGEIRSTVVLDYEKFQQCIISVIATDQGIPSLTSTLTVHLQILDENDNYPQWVFPSSKDNYLNLSVSVTGSSSKLTRIRAIDLDKGANENITYKLHSQLGLFDLDRFTGDLT-SISQLKPGNYVLQVSAQD 782          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 305.834 bits (782), Expect = 2.795e-86
Identity = 238/785 (30.32%), Postives = 388/785 (49.43%), Query Frame = 2
Query:  239 KEISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQXXXXXXXXXXXXXXXQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLS-QNPLKLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGAD-EVKKYFSIDKKTGQISIIKRFNQ---PTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTDPGSTWFSIDD-SGTISTKIVLDYEKIKKLSFNVLAINRG-IKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEEN---LKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENN-ARSINE---KLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNI--RDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYI 2545
            + I + + E   +G  VGN+N+ + +F       +++    FK +        G+ LK  F +  S+G L+    IDRE VC  +    +  C I   + V    WI V I I D+ND+ P F +    I +SE+ +V  +I+L    D D    +P       +H  N  F+++  N L LI+  ++DYE + +Y+  L+ACD G P LCGNQT+ I++ + ND  P+F +  Y  II E+  +GE+V +  A D D G FG++ Y F    D  V  YF I   TG+I + +  N       F  +I+A+D    P +G   +F+H+ DVNN  PVI +N +               V EN  +    A I VSD D G N+   CH+   +  ++   FK+ N      R IY L  ++ FD E   +F + +LC D G P+ +   +I + I+D NE+ P F +  Y + + EN++    +  +   D D T   +  L    + +F ID   G + T  +LD EK  K+   VLAI++G  +S T++  V + + DVNDN P   +   + +V+EN   L  F  + +I A D D   N  + +Y+     +   A  I+E   K+F ++  +G +    +LD E  D Y + + V D G+P L++I+   + V+D+NDN P W  P  H    NI+ +++  +D  +   +A D DS     + Y +   +D+  I+ + G++   R +I+ G   ++L A D  + N+ T   + +YI
Sbjct:  171 RNIHYAVKEEIDVGNFVGNLNIDSNIF-------KIQPKSTFKLYDD------GKLLK-YFSLEESTGKLIIAQRIDREQVCPTSFTALDR-CQIELTIFVPIDYWINVIITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPD---VEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP-------AKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHL--TVGAEN---FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDATAQLLYQLAPSQNAFFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDN-PPTVINPPKLQVKENEETLPMF--LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHST--NITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLR-ARQSIREGHYLIKLVANDNGNPNLSTEIKINLYI 919          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH93.039e-6328.36protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDHAC25.376e-6326.63protocadherin alpha subfamily C, 2 [Source:HGNC Sy... [more]
PCDH91.029e-6228.36protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.150e-6228.36protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.251e-6228.36protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-13.185e-3523.73FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.738e-3324.46FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
hmr-16.627e-3023.78Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-16.627e-3023.78Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
cdh-33.617e-2926.07Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan1.233e-4725.48gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.243e-4725.48gene:FBgn0024836 transcript:FBtr0303223[more]
stan1.243e-4725.48gene:FBgn0024836 transcript:FBtr0088214[more]
stan1.246e-4725.48gene:FBgn0024836 transcript:FBtr0339463[more]
stan1.253e-4725.48gene:FBgn0024836 transcript:FBtr0304899[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.972e-6428.26protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.12.602e-6428.26pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh93.278e-6428.26protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh93.278e-6428.26protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh1a5.076e-6428.02protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh172.829e-7028.27protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.039e-7028.27protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.824e-7028.27protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.605e-7028.19protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh178.897e-7028.19protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh98.319e-6428.71protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.157e-6228.71protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.157e-6228.71protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.191e-6228.71protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.261e-6228.71protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN4.940e-6228.36Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q9Y5I4|PCDC2_HUMAN2.649e-6126.63Protocadherin alpha-C2 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q5DRE5|PCDA7_PANTR3.402e-6127.44Protocadherin alpha-7 OS=Pan troglodytes OX=9598 G... [more]
sp|Q9UN72|PCDA7_HUMAN5.607e-6127.22Protocadherin alpha-7 OS=Homo sapiens OX=9606 GN=P... [more]
sp|Q5DRE1|PCDC2_PANTR7.804e-6126.48Protocadherin alpha-C2 OS=Pan troglodytes OX=9598 ... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PLF42.257e-7829.64Protocadherin-9 OS=Mizuhopecten yessoensis OX=6573... [more]
V4AB093.337e-7829.71Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2H5BFB81.538e-7529.44Pcd11x OS=Platynereis dumerilii OX=6359 PE=2 SV=1[more]
A0A210PLD82.432e-7429.62Protocadherin-11 X-linked OS=Mizuhopecten yessoens... [more]
V4ACR28.518e-7429.26Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh7a1.137e-6927.69protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-... [more]
pcdh1a3.770e-6727.88protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a6.881e-6726.84protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh92.835e-6527.33protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh92.945e-6527.33protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.350e-6528.00protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.15.332e-6327.04protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.14.122e-4125.40pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.15.096e-4123.85pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000004042.13.327e-3826.59pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354125.712e-5527.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461891.975e-5426.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333593.925e-4625.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.563e-4427.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303645.790e-4425.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.402e-6527.96protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh94.295e-6527.96protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh94.472e-6527.96protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
PCDH82.898e-6427.59protocadherin 8 [Source:NCBI gene;Acc:101158635][more]
ENSORLT00000036663.11.733e-6328.67pep primary_assembly:ASM223467v1:10:15171740:15179... [more]
back to top
BLAST of Protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042292.10.000e+0100.00SMESG000042292.1[more]
SMESG000043597.15.462e-8831.93SMESG000043597.1[more]
SMESG000043597.11.779e-8731.93SMESG000043597.1[more]
SMESG000030992.16.155e-8732.63SMESG000030992.1[more]
SMESG000076350.12.795e-8630.32SMESG000076350.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029677 ID=SMED30029677|Name=Protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=3701bp
AGATCAACCAATTATTATAATAAAATTAAAACAAAATAAAAGATCAATTT
CATATTTTATTTCAAAAATACATGGACTATAATTAATTAGGTAATAAGAA
ATTAAAAAAAAATTATTAAATCGGTTTTTATGCCCCATGATAATTGCCAA
CAATTAAACAGGAATCAATGTTTTCATGTGGATAGTAGGATTTCTAGTTT
TGATTCTGAACCTTTTGTTTTCTTCAAAAGCCATGCTGAAAGAGATTTCC
TTCAAACTTGTTGAAAATTGCTCAATTGGAACGATTGTTGGAAATATCAA
TTTATCTGCACAATTATTCGTTTTCAGTAACGTGCAACTTCAACTAGAAA
ACTCGGAAGATTTCAAAGAACATCACTCTCTCTCACACAACAGATTTGGA
AGATCTTTGAAAAATCTTTTCAAAATAAACAATTCCTCTGGAGACTTGGT
GACAATTTCGGAGATCGACAGAGAAACTGTTTGCCAGTTGAATCTAATAA
AAAGAAACGAGAACTGCACTATTCTCCAAATAGTTTCTGTAAATAAACTG
ATGTGGATTTATGTCAATATCGAAATAATCGACATCAATGACAATGCGCC
AGCGTTTCGACAGATTTCTCTTTCGATATCCTTGAGTGAAAGTTCCAAAG
TGAAGAGTCAGATCAATTTAGAGGAGCCAGTCGACTTAGATTCAGATCAA
TTCCAGCCCATTCAATACAGAATTCAACATTTACACAAATCTAATTTTCC
TTTCAGTTTATCACAAAACCCCTTGAAACTCATTTTAGAACGGTCTGTCG
ATTATGAAAATAAAAAACACTATCAAGTGGTCCTTATAGCTTGCGACAAT
GGAAAGCCTTCATTGTGTGGAAATCAAACTGTAATAATTAACATAACGAA
TGAAAATGATGAATCCCCCATGTTTTACAGATCAAACTATACAGCCATTA
TAAACGAGGATACCCAAATAGGGGAAATAGTTCTCTCTCCAAAGGCTTTT
GACAAAGACGATGGAAAATTTGGTGAATTAGAATACAGTTTTAGCTCCGG
TGCAGATGAAGTGAAAAAATATTTTTCAATCGACAAAAAAACCGGTCAAA
TTTCCATTATAAAAAGATTTAATCAACCTACAAAATTTAAATTTTCCATC
AAAGCCACTGATAAAGCTCCGAATCCATTGATCGGGCGAACATGGATCTT
TCTTCACGTCGTCGACGTCAACAATCACAGTCCGGTGATCCTTGTCAATC
CAATAGATTCTTTTCTCATTTCCAAATTTCAGAACCACACTGTAATTGAA
GTGTCAGAAAACAATAGAATTCCATTTCAATTAGCCTTTATTACAGTATC
TGATCTCGATCAAGGTGAAAATTCCCGATGTTCTTGTCACATTCAGTCGA
TTATTAATAAGGATCATTTGAATTATTTCAAAATCATCAACGTCATTGAA
ACAAACGAAAGAAGTATATATAAATTGCTTGCCGATAAATCCTTTGATGC
CGAAGAGACCAAATACTTTTCACTAAATATCTTGTGTTATGATCACGGTG
AACCTCAAAACTCAGCGATCACAAAAATCGAGATCCACATCAAAGACGAA
AACGAATACCAACCGACATTTGATCAAAACCTATATGAAATATATATCAA
AGAAAACACATCTCCCGAAACAAATGTTAAAACAGTGAAAGTATACGATA
GAGATTTAACCCAATCTAGAATTTTAGATCTCACTGATCCAGGTTCAACT
TGGTTTTCAATAGACGATTCTGGAACCATTTCAACGAAAATCGTTTTAGA
TTATGAAAAAATTAAAAAGTTGTCTTTCAACGTTTTAGCAATCAATCGTG
GAATAAAATCTTTCACTTCATCCGCCAGAGTTTCTGTCTATGTGATTGAT
GTTAATGATAATTTTCCGAAATTCTCTTTGGCTTCCAAAAGATTTGAAGT
GGAAGAAAATTTAAAAGGTTTTTATGAAATTGGAAAGATTCATGCATTCG
ACGAAGATAGTGAAATCAATTCTAAACTTAATTACTATTTGCTCAATACA
ACCTCTGAAAACAATGCAAGGTCTATTAATGAAAAGCTATTTGAGCTAAA
TCCTACAACTGGGATCATCTATTCTAACGTGACCTTAGACTATGAAGAGT
GTGATTTGTATTCAATTACGGTTAAAGTGATAGATAGTGGAAGACCTCCT
TTAAGTAATATCCAAAGATTTTTTATTCATGTCGTTGATATGAATGATAA
CGGTCCAATCTGGAAATATCCAAACATTCATGACAATGTCATGAACATAT
CGTTACAAAATATCCGTGATTCAGTTCTAACAAGAGTGAGAGCCGTTGAT
AATGACAGTGATAAGTATAATGTGGTTCACTATTTTCTCCATAATCATAA
TGACATTTTTGAAATCAATCATTTAACTGGTGAAATAACTTTCAAAAGAC
TTAATATAAAACCAGGTCAGCTAACCCTTCAGCTTCAAGCAATCGACGCC
AATTCCAAAAACATTCATACTTCTCAGAGTCTTATTGTGTACATAATGGG
ACACGATAGGTCGTACTTACAATTTCCATTGTCATCGTCACTCACATTTC
CAGTAATGATTTCGATTATCGGAATTTCTTCATTGATATCTATAGTGCTA
GTAGTGTTTGTTTTTTATTTTTGCTACAGAAAAAGATGTATGTACAGAAA
TTCCGGTCACTCGGCCGTTACGAGTAATTGTAGGAAAAACGATAAAATTA
AGGATATCAAAAACCAAAAAGATTCTAAAAAGTCCTACGATATTCCTTTA
GATTTGGTAACAGATAACGATGCATTTAATCAGAATATAATTGAAGATTC
AATGAAACTAATTCTTGATCCTCTTTATTGTAATTCAAGTTCATCCTCAA
ACGCTTTCCATCAAAACGATCAAAATTCCAATTTGGAAACATTACTTTGT
AAATTACAAGTAGACAATATCTATCAGGATTTTATAAGACATGGATATTC
AGAAAATTATAATGATCCAAAAAAGGATCAACAGATGCTACCGACCATAT
CTAGTATTCAGACTCCCCTTAACACTCACAGTGAAACGTGCATCCTACAC
TCAATGACTAACAGAGAAATCAGTTCACATTTTGATCCATGTAAAAATAA
ATCCGCCTCCAAATTGAAAGCGCTTGATTCAAATGATTCAACATTTGATA
CGTATGCAACCTTTCTCAACTGCAGCTGTAACAATGTTGTTACTTCAGAT
TATGAAAATTCTCCTCCAATGAGTAAAGTTTTGACAGCTCCGTTTATATT
TAATGGATCAGCTTGGATTCCAAATACATCATTAACAAATGAGAAGTTTT
CCATACCAAACAAAAAGGACATGTCAAAACATCAGCCACTCAAGTCTATA
ATGAAAAAAACTACTGCTTCTTTTATCAACATTGATAGTTCATCTTCGTC
AGGCCATTGTTTGGACACGGATCAAGCCAGTTCTACTCATGACAGCGGCT
GTATTGTCGCCTACACAGATAGTAGCTTGCCCCCCAGATCAATTAGTTTG
TTAGATAACACTTACCAATGCAAAAAGTCTCAAGTTTAGCTGATCTAGCA
TTTGTAATCCAATAAGATATCGTATTATATGAGGATTTTGTTTTAATCTA
TCAATACATTATTTCCGTTTGAAAACAATCGATTCCCATGATTTGTAAAG
A
back to top

protein sequence of SMED30029677-orf-1

>SMED30029677-orf-1 ID=SMED30029677-orf-1|Name=SMED30029677-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1138bp
MWIVGFLVLILNLLFSSKAMLKEISFKLVENCSIGTIVGNINLSAQLFVF
SNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRE
TVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQISLS
ISLSESSKVKSQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPL
KLILERSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMF
YRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYF
SIDKKTGQISIIKRFNQPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNN
HSPVILVNPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENS
RCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSL
NILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETN
VKTVKVYDRDLTQSRILDLTDPGSTWFSIDDSGTISTKIVLDYEKIKKLS
FNVLAINRGIKSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFY
EIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYS
NVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPN
IHDNVMNISLQNIRDSVLTRVRAVDNDSDKYNVVHYFLHNHNDIFEINHL
TGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQSLIVYIMGHDRSYLQF
PLSSSLTFPVMISIIGISSLISIVLVVFVFYFCYRKRCMYRNSGHSAVTS
NCRKNDKIKDIKNQKDSKKSYDIPLDLVTDNDAFNQNIIEDSMKLILDPL
YCNSSSSSNAFHQNDQNSNLETLLCKLQVDNIYQDFIRHGYSENYNDPKK
DQQMLPTISSIQTPLNTHSETCILHSMTNREISSHFDPCKNKSASKLKAL
DSNDSTFDTYATFLNCSCNNVVTSDYENSPPMSKVLTAPFIFNGSAWIPN
TSLTNEKFSIPNKKDMSKHQPLKSIMKKTTASFINIDSSSSSGHCLDTDQ
ASSTHDSGCIVAYTDSSLPPRSISLLDNTYQCKKSQV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 144..173
score: 21.79
coord: 480..493
score: 38.26
coord: 531..557
score: 28.93
coord: 80..99
score: 35.68
coord: 565..582
score: 43.74
coord: 215..227
score: 34.07
coord: 229..248
score: 32.61
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 721..798
e-value: 0.17
score: 11.6
coord: 272..353
e-value: 3.9E-13
score: 59.6
coord: 504..581
e-value: 4.3E-13
score: 59.5
coord: 43..142
e-value: 0.1
score: 14.0
coord: 166..248
e-value: 3.4E-9
score: 46.6
coord: 605..694
e-value: 3.1E-22
score: 89.9
coord: 389..480
e-value: 3.6E-10
score: 49.8
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 589..686
e-value: 3.0E-12
score: 46.8
coord: 487..573
e-value: 1.6E-10
score: 41.3
coord: 150..241
e-value: 8.7E-8
score: 32.5
coord: 255..339
e-value: 5.8E-9
score: 36.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 23..137
e-value: 1.2E-11
score: 46.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 694..796
e-value: 4.5E-9
score: 38.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 362..477
e-value: 5.8E-16
score: 60.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 579..693
e-value: 1.7E-26
score: 94.9
coord: 138..245
e-value: 1.2E-20
score: 76.0
coord: 246..354
e-value: 1.8E-22
score: 81.9
coord: 478..578
e-value: 6.1E-20
score: 73.8
NoneNo IPR availablePANTHERPTHR24025FAMILY NOT NAMEDcoord: 325..635
coord: 23..512
coord: 526..795
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 716..803
score: 8.686
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 483..583
score: 19.911
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 368..482
score: 14.189
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 584..696
score: 23.638
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 145..250
score: 17.477
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 20..144
score: 12.194
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 251..355
score: 19.867
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 23..140
e-value: 6.36518E-6
score: 43.8414
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 487..579
e-value: 1.36169E-20
score: 85.4429
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 716..790
e-value: 1.4501E-7
score: 48.4638
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 589..692
e-value: 9.25325E-26
score: 100.466
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 255..351
e-value: 3.52393E-21
score: 87.3689
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 373..477
e-value: 6.50422E-15
score: 69.2645
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 169..245
e-value: 4.69689E-12
score: 61.1753
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.794
NoneNo IPR availableTMHMMTMhelixcoord: 810..832
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 684..694
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 132..142
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 137..242
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 69..144
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 470..572
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 684..807
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 571..699
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 348..474
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 238..358