peptidyl prolyl cis trans isomerase FKBP-2

Overview
Namepeptidyl prolyl cis trans isomerase FKBP-2 (AFJ24780.1)
Smed IDSMED30029676
Length (bp)1455
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of peptidyl prolyl cis trans isomerase FKBP-2 (SMED30029676) t-SNE clustered cells

Violin plots show distribution of expression levels for peptidyl prolyl cis trans isomerase FKBP-2 (SMED30029676) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of peptidyl prolyl cis trans isomerase FKBP-2 (SMED30029676) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for peptidyl prolyl cis trans isomerase FKBP-2 (SMED30029676) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029676

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029676h1SMcG0016660 SmedASXL_004087SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30029676h1SMcG0016660 dd_Smed_v4_3023_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029676h1SMcG0016660 dd_Smed_v4_3023_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029676h1SMcG0016660 dd_Smed_v4_3023_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029676h1SMcG0016660 dd_Smed_v4_3023_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029676h1SMcG0016660 dd_Smed_v4_3023_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Human
Match: FKBP6 (FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HGNC:3722])

HSP 1 Score: 118.242 bits (295), Expect = 3.823e-29
Identity = 81/285 (28.42%), Postives = 138/285 (48.42%), Query Frame = 3
Query:  258 NAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            +A    ++   P   Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E    PFDS  F++ P   ++G    L G+++ L SM + E A F+F  +  +G LG PP IP    +  E+E++DF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L     A  EE+ +     + + LN++   LKL+R   A+      L     NAKAL+R G+  +++ E+  A      A K  P N DI
Sbjct:    2 SASSWPQNGMPPSSLYERLSQRMLDISGD-RGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRY-KRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDI 284          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Human
Match: FKBP6 (FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HGNC:3722])

HSP 1 Score: 118.242 bits (295), Expect = 4.687e-29
Identity = 83/282 (29.43%), Postives = 137/282 (48.58%), Query Frame = 3
Query:  270 VEESDSTPFVK-YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            V E D  P    Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E    PFDS  F++ P   ++G    L G+++ L SM + E A F+F  +  +G LG PP IP    +  E+E++DF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L     A  EE+ +     + + LN++   LKL+R   A+      L     NAKAL+R G+  +++ E+  A      A K  P N DI
Sbjct:   10 VLEGDDAPGQSLYERLSQRMLDISGD-RGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRY-KRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDI 289          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Human
Match: FKBP6 (FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HGNC:3722])

HSP 1 Score: 103.99 bits (258), Expect = 1.670e-24
Identity = 73/257 (28.40%), Postives = 126/257 (49.03%), Query Frame = 3
Query:  258 NAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGR 1028
            +A    ++   P   Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E    PFDS  F++ P   ++G    L G+++ L SM + E A F+F  +  +G LG PP IP    +  E+E++DF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L     A  EE+ +     + + LN++   LKL+R   A+      L     NAKAL+R G+
Sbjct:    2 SASSWPQNGMPPSSLYERLSQRMLDISGD-RGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRY-KRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQ 256          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Human
Match: FKBP6 (FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HGNC:3722])

HSP 1 Score: 90.5077 bits (223), Expect = 2.300e-20
Identity = 54/179 (30.17%), Postives = 91/179 (50.84%), Query Frame = 3
Query:  270 VEESDSTPFVK-YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRY 803
            V E D  P    Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E    PFDS  F++ P   ++G    L G+++ L SM + E A F+F  +  +G LG PP IP    +  E+E++DF +    D+F   S +++ +    +++K+    R   N   R  R+
Sbjct:   10 VLEGDDAPGQSLYERLSQRMLDISGD-RGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRF 187          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Human
Match: FKBP6 (FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HGNC:3722])

HSP 1 Score: 85.8853 bits (211), Expect = 5.115e-18
Identity = 74/282 (26.24%), Postives = 124/282 (43.97%), Query Frame = 3
Query:  270 VEESDSTPFVK-YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            V E D  P    Y+ L+ +M+DIS D + + K +I +G G  +                             PD   + +   L G+++ L SM + E A F+F  +  +G LG PP IP    +  E+E++DF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L     A  EE+ +     + + LN++   LKL+R   A+      L     NAKAL+R G+  +++ E+  A      A K  P N DI
Sbjct:   10 VLEGDDAPGQSLYERLSQRMLDISGD-RGVLKDVIREGAGDLV----------------------------APDASVLDI--TLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRY-KRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDI 259          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Celegans
Match: fkb-6 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:O45418])

HSP 1 Score: 60.4622 bits (145), Expect = 1.421e-9
Identity = 51/171 (29.82%), Postives = 77/171 (45.03%), Query Frame = 3
Query:  624 PGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDIL----YAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAI 1124
            P G++I      ++FT   +  + FEK +    E++ +E +    Q ++     ++     +A NKY R  ++L       P    E E I  G     YLN++    K N     IK C+ VL  +P N KALYRK   L+ + E  DA KLF+   +  P NK     I
Sbjct:  216 PAGSNIPVNA-TLEFT---IFLKEFEK-VPATWEMTAEEKLDAAKQAKDRGTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEKMAERETILNG----AYLNLSLVCSKQNEQLECIKWCDKVLETKPGNVKALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQI 377          

HSP 2 Score: 59.6918 bits (143), Expect = 2.005e-9
Identity = 39/121 (32.23%), Postives = 65/121 (53.72%), Query Frame = 3
Query:  327 IDISDDSKLIFKRLISK-GEGSKIPI-GSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNL 683
            IDI+        +LI K G+G   P  G+ V  +Y    E+  + FDS+R +       +G G ++ G D+ + +M K E A F   S   +G+ G PP+IPGGA +  EVE+ +++ +++
Sbjct:    6 IDITPKKDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTLENGTK-FDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEWSAEDI 125          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Celegans
Match: fkb-6 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:O45418])

HSP 1 Score: 60.4622 bits (145), Expect = 1.421e-9
Identity = 51/171 (29.82%), Postives = 77/171 (45.03%), Query Frame = 3
Query:  624 PGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDIL----YAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAI 1124
            P G++I      ++FT   +  + FEK +    E++ +E +    Q ++     ++     +A NKY R  ++L       P    E E I  G     YLN++    K N     IK C+ VL  +P N KALYRK   L+ + E  DA KLF+   +  P NK     I
Sbjct:  216 PAGSNIPVNA-TLEFT---IFLKEFEK-VPATWEMTAEEKLDAAKQAKDRGTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEKMAERETILNG----AYLNLSLVCSKQNEQLECIKWCDKVLETKPGNVKALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQI 377          

HSP 2 Score: 59.6918 bits (143), Expect = 2.005e-9
Identity = 39/121 (32.23%), Postives = 65/121 (53.72%), Query Frame = 3
Query:  327 IDISDDSKLIFKRLISK-GEGSKIPI-GSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNL 683
            IDI+        +LI K G+G   P  G+ V  +Y    E+  + FDS+R +       +G G ++ G D+ + +M K E A F   S   +G+ G PP+IPGGA +  EVE+ +++ +++
Sbjct:    6 IDITPKKDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTLENGTK-FDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEWSAEDI 125          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Celegans
Match: fkb-3 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:O16309])

HSP 1 Score: 51.9878 bits (123), Expect = 2.745e-7
Identity = 22/63 (34.92%), Postives = 38/63 (60.32%), Query Frame = 3
Query:  456 FDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIY 644
             DS+  +  P   ++G GQ++ G+DIA++ MC+ E+   V    + +GE G PP IPG + ++
Sbjct:  183 IDSSWSRNRPFIFKMGSGQVIKGMDIAMEGMCQGEKRKVVIPPELAYGENGRPPAIPGNSYLH 245          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Celegans
Match: fkb-3 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:O16309])

HSP 1 Score: 51.9878 bits (123), Expect = 2.745e-7
Identity = 22/63 (34.92%), Postives = 38/63 (60.32%), Query Frame = 3
Query:  456 FDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIY 644
             DS+  +  P   ++G GQ++ G+DIA++ MC+ E+   V    + +GE G PP IPG + ++
Sbjct:  183 IDSSWSRNRPFIFKMGSGQVIKGMDIAMEGMCQGEKRKVVIPPELAYGENGRPPAIPGNSYLH 245          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Celegans
Match: fkb-2 (Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U2Q8])

HSP 1 Score: 47.7506 bits (112), Expect = 8.058e-7
Identity = 21/68 (30.88%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  459 DSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVI 662
            DS+R +  P + ++G G+++ G D  +  M   E++     + + +G  GVPP+IP  A +  EVE++
Sbjct:   38 DSSRDRGTPFKFKIGKGEVIKGWDQGVAQMSVGEKSKLTISADLGYGPRGVPPQIPANATLVFEVELL 105          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Fly
Match: shu (gene:FBgn0003401 transcript:FBtr0072237)

HSP 1 Score: 106.301 bits (264), Expect = 1.828e-24
Identity = 101/385 (26.23%), Postives = 175/385 (45.45%), Query Frame = 3
Query:  264 VDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSK--IPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFT---EKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSA---IKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDA-IRENEDLKQQDYEAKKLLAQ--NMINIKENXXXXXXXXXXDLT-SDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNL 1382
            VD EE  S     + +L   M +I ++   I+KR+   G   +  +P  + V   Y  Y E +  PFDS+  +        G G ++ GL++A++SM   E+A F+    ++FGELG PPRI   AD   +VEVID++   +   ID   ++  D+     F  +    V        +V+  RY  A   + R +  L    +A DEEE+ +   +  L  N+     K+N+   A   +K    +    P+  KAL+++GR L  +GE++ A   +  A    P NK+I D  I  N+ + + +  ++ + A+  ++ N K +V         +    D    + + IR F ++   ++  + K  S  + D    L  + NL
Sbjct:   58 VDGEELRSPWTYSFDELRALMSEIDEN---IYKRITRTGHVDREAVPNKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDK-----FCVVYPKAVDLHLHGKDSVKLGRYQSAATAFERAVSSLNYCRMANDEEERKQTELLTTLNQNLMIVYNKMNKPKRACIMMKALRHLTMGNPS-CKALFQEGRALAALGEYNLARNAYLQAQAKQPANKEISDEIISMNKRISKYEEASRDIWARAFSLKNSKSDVRKTPAQLEKEAKEQDFNDKMEDLIRRFKNTSDQQVSFSRKSYSNAQFDATCKLAKEHNL 433          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Fly
Match: Fkbp59 (gene:FBgn0029174 transcript:FBtr0079872)

HSP 1 Score: 60.4622 bits (145), Expect = 1.640e-9
Identity = 62/233 (26.61%), Postives = 104/233 (44.64%), Query Frame = 3
Query:  513 LLTGLDIALQSMCKKERANFVFDSSVMFGELGVPP-RIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILD-AIRENEDLKQQDYEAKKLLAQNMINIKEN 1205
            ++ G++IAL+ M   E +     +   FG  G    +IP  A +   V+++D   K L          E  +LS +E +      +       + + + +A+  Y +  +IL       +E +KI+    V  + N+A C+ K N    A + CN VLA    N KALYR+G+  + I E +DA + F+   +  P NK   +  I   + LK+   + KKL A     +  N
Sbjct:  182 IIDGVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCG-KGL----------EEWKLSDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNILPTTVHTNEEVKKIK----VATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKLAAN 399          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Fly
Match: Fkbp59 (gene:FBgn0029174 transcript:FBtr0342837)

HSP 1 Score: 60.4622 bits (145), Expect = 1.640e-9
Identity = 62/233 (26.61%), Postives = 104/233 (44.64%), Query Frame = 3
Query:  513 LLTGLDIALQSMCKKERANFVFDSSVMFGELGVPP-RIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILD-AIRENEDLKQQDYEAKKLLAQNMINIKEN 1205
            ++ G++IAL+ M   E +     +   FG  G    +IP  A +   V+++D   K L          E  +LS +E +      +       + + + +A+  Y +  +IL       +E +KI+    V  + N+A C+ K N    A + CN VLA    N KALYR+G+  + I E +DA + F+   +  P NK   +  I   + LK+   + KKL A     +  N
Sbjct:  182 IIDGVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCG-KGL----------EEWKLSDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNILPTTVHTNEEVKKIK----VATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKLAAN 399          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Fly
Match: zda (gene:FBgn0034368 transcript:FBtr0345424)

HSP 1 Score: 58.9214 bits (141), Expect = 4.298e-9
Identity = 68/278 (24.46%), Postives = 120/278 (43.17%), Query Frame = 3
Query:  345 SKLIFKRLISKG--EGSKIPI-GSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPR------IPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDIL-------------YAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            +K + KR I K   +  + PI G LV  N+    ++     +   F+ H     VG  +++ GLD+ L  +   E +    DS   +G LG+         +P  A +  E+E++D          +E+  D +   SF+ + K   + +  AN   +   +  A++ Y R LD L               + L+  + + +    ++ +Y N+A   +K+    +A++    VL  QP N+KALYRKGR L    +   A KL +      P N+ +
Sbjct:   63 NKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELNFQCH-----VGDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIK--------YEEFADLK---SFEILRKYGTRKKERANFFYKRSEFTTAIHLYRRALDFLDNRDGDPDSEFDKEDLELSNSDTQTLLEDRLI-VYNNLAMTQIKIAAYDAALQSVEHVLRCQPNNSKALYRKGRILEGKADTQGAIKLLQKVATLEPENRAV 323          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Fly
Match: zda (gene:FBgn0034368 transcript:FBtr0086661)

HSP 1 Score: 58.9214 bits (141), Expect = 4.298e-9
Identity = 68/278 (24.46%), Postives = 120/278 (43.17%), Query Frame = 3
Query:  345 SKLIFKRLISKG--EGSKIPI-GSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPR------IPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDIL-------------YAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            +K + KR I K   +  + PI G LV  N+    ++     +   F+ H     VG  +++ GLD+ L  +   E +    DS   +G LG+         +P  A +  E+E++D          +E+  D +   SF+ + K   + +  AN   +   +  A++ Y R LD L               + L+  + + +    ++ +Y N+A   +K+    +A++    VL  QP N+KALYRKGR L    +   A KL +      P N+ +
Sbjct:   63 NKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELNFQCH-----VGDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIK--------YEEFADLK---SFEILRKYGTRKKERANFFYKRSEFTTAIHLYRRALDFLDNRDGDPDSEFDKEDLELSNSDTQTLLEDRLI-VYNNLAMTQIKIAAYDAALQSVEHVLRCQPNNSKALYRKGRILEGKADTQGAIKLLQKVATLEPENRAV 323          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Zebrafish
Match: fkbp6 (FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-050302-4])

HSP 1 Score: 116.701 bits (291), Expect = 1.289e-28
Identity = 77/275 (28.00%), Postives = 134/275 (48.73%), Query Frame = 3
Query:  288 TPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            TPF +   L  +M DI  D   + K +I +GEG  +P+ + V  N+  + E    PF++T   ++P   ++G    L GL++ L +M K E + F+F     +G+LG PP IP  A +  EV+V+DF +   +D+F + +++E+       ++ ++   R+  N     KRY  A  +Y + + +L        EE+K      +   LN++   LKL +   A+      L   P N KAL+R G+  + + +++ A      A    P + DI
Sbjct:   26 TPFQR---LAPQMEDILGDGG-VLKEVIHEGEGPPVPMHASVSINFSGFIEYTDAPFETTNHLKYPRMMKLGKDVTLYGLELGLLTMKKGEFSRFLFKPKYAYGDLGCPPHIPPCATVLYEVQVLDFLDSAQVDDFMDLTLEEQNTAPLSVLLNVLDTQRSFGNLCFNKKRYEDARERYKQAMTLLQNREPEDAEEKKHLEEIKLPFLLNLSFTYLKLEKPQKALVYGQKALDINPQNTKALFRCGQACLEMKDYEKAQDYLTLAQAKKPFDPDI 296          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Zebrafish
Match: fkbp6 (FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-050302-4])

HSP 1 Score: 113.62 bits (283), Expect = 1.789e-27
Identity = 76/275 (27.64%), Postives = 133/275 (48.36%), Query Frame = 3
Query:  288 TPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            TPF +   L  +M DI  D   + K +I +GEG  + + + V  N+  + E    PF++T   ++P   ++G    L GL++ L +M K E + F+F     +G+LG PP IP  A +  EV+V+DF +   +D+F + +++E+       ++ ++   R+  N     KRY  A  +Y + + +L        EE+K      +   LN++   LKL +   A+      L   P N KAL+R G+  + + +++ A      A    P + DI
Sbjct:   26 TPFQR---LAPQMQDILGDGG-VLKEVIHEGEGPPVSMHASVSINFSGFIEYTDAPFETTNHLKYPRMMKLGKDVTLYGLELGLLTMKKGEFSRFLFKPKYAYGDLGCPPHIPPCATVLYEVQVLDFLDSAQVDDFMDLTLEEQNTAPLSVLLNVLDTQRSFGNLCFNKKRYEDARERYKQAMTLLQNREPEDAEEKKHLEEIKLPFLLNLSFTYLKLEKPQKALLYGQKALDINPQNTKALFRCGQACLEMKDYEKAQDYLTLAQAKKPFDPDI 296          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Zebrafish
Match: fkbp6 (FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-050302-4])

HSP 1 Score: 90.5077 bits (223), Expect = 3.062e-20
Identity = 63/229 (27.51%), Postives = 112/229 (48.91%), Query Frame = 3
Query:  288 TPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQL---------LTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNR 947
            TPF +   L  +M DI  D   + K +I +GEG  + + + V  N+  + E    PF++T   ++P   ++G G +         L GL++ L +M K E + F+F     +G+LG PP IP  A +  EV+V+DF +   +D+F + +++E+       ++ ++   R+  N     KRY  A  +Y + + +L        EE+K      +   LN++   LKL +
Sbjct:   15 TPFQR---LAPQMQDILGDGG-VLKEVIHEGEGPPVSMHASVSINFSGFIEYTDAPFETTNHLKYPRMMKLGKGVIHTFFPIDVTLYGLELGLLTMKKGEFSRFLFKPKYAYGDLGCPPHIPPCATVLYEVQVLDFLDSAQVDDFMDLTLEEQNTAPLSVLLNVLDTQRSFGNLCFNKKRYEDARERYKQAMTLLQNREPEDAEEKKHLEEIKLPFLLNLSFTYLKLEK 239          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Zebrafish
Match: fkbp8 (FKBP prolyl isomerase 8 [Source:ZFIN;Acc:ZDB-GENE-040426-1849])

HSP 1 Score: 90.1225 bits (222), Expect = 4.581e-19
Identity = 73/212 (34.43%), Postives = 105/212 (49.53%), Query Frame = 3
Query:  498 VGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGV-PPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSF---DEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYA---MPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            +G G +L  LD+ +Q M   E+A     +   +G LG   P +P  AD+  EV+++              S DE L+L      E I L  + R   N   +   Y  A+N Y   L I  A   + ++ +EEE++     VK   NMA   LKL+   +A++ C +VLA QP N KAL+RKG+ L + GEF +A K  K A K  P+NK I
Sbjct:  139 LGDGDVLQALDLTVQLMEMGEKALIEAAAKYAYGALGSSAPAVPPDADLLLEVQLL--------------SADEALDLELMPPSERIILANRKRERGNVHYQRADYAFAVNSYGIALQITEASSRVDISQEEEEEL-LDMKVKCLNNMAAAQLKLDHYEAALRSCVSVLAHQPDNVKALFRKGKVLALQGEFAEAIKTLKMALKLEPSNKTI 335          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Zebrafish
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-514])

HSP 1 Score: 83.1889 bits (204), Expect = 1.204e-16
Identity = 87/295 (29.49%), Postives = 135/295 (45.76%), Query Frame = 3
Query:  330 DISDDS-KLIFKRLISKGEGSKIP-IGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQ---LLTGLDIALQSMCKKERANFVFDSSVMFGELGVPP-RIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDIL-YAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMIN 1193
            DI+DD    I +R+I+KGEG   P  G+ V    +  HED++  FD    K       VG G+   L  G++ ALQ+M + E A F       FG  G     IP  A +  ++++  F +     E +E +  E+LE S        V  +       +  +Y  A+ +Y R +  L +   +  D+EEK +    +  YLN+A C LKL     A++ C+  L     N KAL+R+G  L+++ EFD A   F+   +  P NK     I   +   ++ +E  K L  NM  
Sbjct:  136 DITDDEDGGITRRIITKGEGYTKPNEGATVEVWLEGSHEDRV--FDERELKFE-----VGDGENLGLPLGVEKALQAMEQGEEALFTIKPKYGFGTAGSEKYNIPPNATLQYKIKMKAFEKAK---ESWEMNTIEKLEQS--------VIVKEKGTQYFKEGKYKQAIVQYKRIVSWLEHESSMQPDDEEKAK-ALRLAAYLNLAMCYLKLQDANPALENCDKALELDANNEKALFRRGEALVVMKEFDMAKVDFQRVIELYPANKAAKSQISICQKHMREQHEKDKRLYANMFQ 411          

HSP 2 Score: 49.6766 bits (117), Expect = 5.043e-6
Identity = 32/114 (28.07%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  354 IFKRLISKGEGSKIP-IGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDE 692
            + K +  +G G+++P IG  V  +Y     D  + FDS+R +       +G GQ++   DI + +M   E           +G  G PP+IP  A +  +VE+ DF  +++ D+
Sbjct:   28 VLKLVKKEGTGTELPMIGDKVFVHYVGTLLDGSQ-FDSSRDRGEKFSFELGKGQVIKAWDIGVATMKIGEICQLTCKPEYAYGAAGSPPKIPPNATLLFQVELFDFRGEDITDD 140          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Xenopus
Match: fkbp6 (FKBP prolyl isomerase 6 [Source:NCBI gene;Acc:394649])

HSP 1 Score: 128.642 bits (322), Expect = 8.089e-33
Identity = 88/290 (30.34%), Postives = 143/290 (49.31%), Query Frame = 3
Query:  303 YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQ-----QDY 1157
            +  L  +M D+S D + + K +I  G+G K+P  + VI  Y  Y E   +PFD++ ++RHP   ++G    L+G++I L +M + E + F+F     +G LG  P IP  A +  E+E++DF +    D F   S + +   S D+IIK+    R   N   +  R+  A ++Y R   +L +   + +EE K+     + + LN++   LKL R   A+K     L+    N KAL+R G   + + E+D A      A    P N +I      N +LK+     QDY
Sbjct:   23 FHQLAQQMEDVSGD-RGVLKEVIRPGKGGKVPCDATVILKYSGYLEHADKPFDTSCYRRHPKMMKLGEDITLSGMEIGLLTMQRGELSRFLFSPKYAYGTLGCSPLIPPSATVLFEIELLDFLDTAESDLFCALSPEVQATFSLDKIIKIAGTEREFGNYLFKRNRFYDARDRYKRASSVL-SCKASCEEERKLLEAAQLFVALNLSLTYLKLERPSRALKWGEKALSIDNRNTKALFRCGLACLEMREYDKARNYLLKAQWLEPYNPEI------NNELKRLSSCYQDY 304          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:Xenbase;Acc:XB-GENE-988107])

HSP 1 Score: 82.4185 bits (202), Expect = 1.719e-16
Identity = 78/269 (29.00%), Postives = 123/269 (45.72%), Query Frame = 3
Query:  321 KMIDISDDSKLIFKRLIS-KGEGSKIPIGSLVIYNYKFYHEDQ--IEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLA--TDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            + +D+  +  L  K LIS KG  S+   G  V    K   ED   +E  ++  F        +G G ++  LD+ +Q M  +E +    D+   +G+ G  P IP  +++  EV ++D  +   ++            LS  E + L  + R   N   +   Y  A+N Y   L+++ +      + EEE       +K   N+A   LKL+   +A+K CN VL  QP N KAL+RKG+ L   GE+ DA  + + A K  P NK I
Sbjct:   64 EWLDVLGNGILKKKILISGKGADSRPRKGQDVTVGLKSMLEDGNVVEEQETLTF-------TLGDGDVIQALDLCVQLMEAEETSLIASDAKYCYGKEGRSPDIPPNSNLNLEVALLDVQDGPDLEN-----------LSGQEKLNLANKKRERGNFYYQQADYVFAINSYDIALNVVNSSSKVEFSLEEEASLLDVKIKCLNNLAASQLKLDHYEAALKSCNMVLEHQPENIKALFRKGKVLAQQGEYSDAITILRKALKLEPANKTI 314          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:Xenbase;Acc:XB-GENE-988107])

HSP 1 Score: 82.8037 bits (203), Expect = 1.838e-16
Identity = 78/269 (29.00%), Postives = 123/269 (45.72%), Query Frame = 3
Query:  321 KMIDISDDSKLIFKRLIS-KGEGSKIPIGSLVIYNYKFYHEDQ--IEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLA--TDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            + +D+  +  L  K LIS KG  S+   G  V    K   ED   +E  ++  F        +G G ++  LD+ +Q M  +E +    D+   +G+ G  P IP  +++  EV ++D  +   ++            LS  E + L  + R   N   +   Y  A+N Y   L+++ +      + EEE       +K   N+A   LKL+   +A+K CN VL  QP N KAL+RKG+ L   GE+ DA  + + A K  P NK I
Sbjct:   88 EWLDVLGNGILKKKILISGKGADSRPRKGQDVTVGLKSMLEDGNVVEEQETLTF-------TLGDGDVIQALDLCVQLMEAEETSLIASDAKYCYGKEGRSPDIPPNSNLNLEVALLDVQDGPDLEN-----------LSGQEKLNLANKKRERGNFYYQQADYVFAINSYDIALNVVNSSSKVEFSLEEEASLLDVKIKCLNNLAASQLKLDHYEAALKSCNMVLEHQPENIKALFRKGKVLAQQGEYSDAITILRKALKLEPANKTI 338          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:Xenbase;Acc:XB-GENE-988107])

HSP 1 Score: 82.4185 bits (202), Expect = 2.088e-16
Identity = 78/269 (29.00%), Postives = 123/269 (45.72%), Query Frame = 3
Query:  321 KMIDISDDSKLIFKRLIS-KGEGSKIPIGSLVIYNYKFYHEDQ--IEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLA--TDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            + +D+  +  L  K LIS KG  S+   G  V    K   ED   +E  ++  F        +G G ++  LD+ +Q M  +E +    D+   +G+ G  P IP  +++  EV ++D  +   ++            LS  E + L  + R   N   +   Y  A+N Y   L+++ +      + EEE       +K   N+A   LKL+   +A+K CN VL  QP N KAL+RKG+ L   GE+ DA  + + A K  P NK I
Sbjct:   68 EWLDVLGNGILKKKILISGKGADSRPRKGQDVTVGLKSMLEDGNVVEEQETLTF-------TLGDGDVIQALDLCVQLMEAEETSLIASDAKYCYGKEGRSPDIPPNSNLNLEVALLDVQDGPDLEN-----------LSGQEKLNLANKKRERGNFYYQQADYVFAINSYDIALNVVNSSSKVEFSLEEEASLLDVKIKCLNNLAASQLKLDHYEAALKSCNMVLEHQPENIKALFRKGKVLAQQGEYSDAITILRKALKLEPANKTI 318          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Xenopus
Match: adam33 (ADAM metallopeptidase domain 33 [Source:Xenbase;Acc:XB-GENE-988107])

HSP 1 Score: 82.0333 bits (201), Expect = 2.265e-16
Identity = 78/269 (29.00%), Postives = 123/269 (45.72%), Query Frame = 3
Query:  321 KMIDISDDSKLIFKRLIS-KGEGSKIPIGSLVIYNYKFYHEDQ--IEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLA--TDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            + +D+  +  L  K LIS KG  S+   G  V    K   ED   +E  ++  F        +G G ++  LD+ +Q M  +E +    D+   +G+ G  P IP  +++  EV ++D  +   ++            LS  E + L  + R   N   +   Y  A+N Y   L+++ +      + EEE       +K   N+A   LKL+   +A+K CN VL  QP N KAL+RKG+ L   GE+ DA  + + A K  P NK I
Sbjct:   63 EWLDVLGNGILKKKILISGKGADSRPRKGQDVTVGLKSMLEDGNVVEEQETLTF-------TLGDGDVIQALDLCVQLMEAEETSLIASDAKYCYGKEGRSPDIPPNSNLNLEVALLDVQDGPDLEN-----------LSGQEKLNLANKKRERGNFYYQQADYVFAINSYDIALNVVNSSSKVEFSLEEEASLLDVKIKCLNNLAASQLKLDHYEAALKSCNMVLEHQPENIKALFRKGKVLAQQGEYSDAITILRKALKLEPANKTI 313          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Mouse
Match: Fkbp6 (FK506 binding protein 6 [Source:MGI Symbol;Acc:MGI:2137612])

HSP 1 Score: 127.872 bits (320), Expect = 1.121e-32
Identity = 85/270 (31.48%), Postives = 140/270 (51.85%), Query Frame = 3
Query:  303 YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E   +PFDS  F++ P   ++G    L G+++ L SM K E A F+F  +  +G LG PP IP  A +  E+E+IDF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L    LAT EE+ +    V+ + LN++   LKL+R   A++     L     NAKAL+R G+  +++ E++ A      A K  P N DI
Sbjct:   22 YERLSQRMLDISGD-RGVLKDIIREGTGDTVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELIDFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNYLFRQNRFCDAKVRY-KRALLLLHRRLATCEEQHLVEPAVLLVLLNLSFVYLKLDRPAMALRYGEQALLIDKRNAKALFRCGQACLLLTEYERARDFLVRAQKEQPCNHDI 289          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Mouse
Match: Fkbp6 (FK506 binding protein 6 [Source:MGI Symbol;Acc:MGI:2137612])

HSP 1 Score: 127.872 bits (320), Expect = 1.121e-32
Identity = 85/270 (31.48%), Postives = 140/270 (51.85%), Query Frame = 3
Query:  303 YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E   +PFDS  F++ P   ++G    L G+++ L SM K E A F+F  +  +G LG PP IP  A +  E+E+IDF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L    LAT EE+ +    V+ + LN++   LKL+R   A++     L     NAKAL+R G+  +++ E++ A      A K  P N DI
Sbjct:   22 YERLSQRMLDISGD-RGVLKDIIREGTGDTVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELIDFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNYLFRQNRFCDAKVRY-KRALLLLHRRLATCEEQHLVEPAVLLVLLNLSFVYLKLDRPAMALRYGEQALLIDKRNAKALFRCGQACLLLTEYERARDFLVRAQKEQPCNHDI 289          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Mouse
Match: Fkbp6 (FK506 binding protein 6 [Source:MGI Symbol;Acc:MGI:2137612])

HSP 1 Score: 127.872 bits (320), Expect = 1.330e-32
Identity = 85/270 (31.48%), Postives = 140/270 (51.85%), Query Frame = 3
Query:  303 YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E   +PFDS  F++ P   ++G    L G+++ L SM K E A F+F  +  +G LG PP IP  A +  E+E+IDF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L    LAT EE+ +    V+ + LN++   LKL+R   A++     L     NAKAL+R G+  +++ E++ A      A K  P N DI
Sbjct:   22 YERLSQRMLDISGD-RGVLKDIIREGTGDTVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELIDFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNYLFRQNRFCDAKVRY-KRALLLLHRRLATCEEQHLVEPAVLLVLLNLSFVYLKLDRPAMALRYGEQALLIDKRNAKALFRCGQACLLLTEYERARDFLVRAQKEQPCNHDI 289          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Mouse
Match: Fkbp6 (FK506 binding protein 6 [Source:MGI Symbol;Acc:MGI:2137612])

HSP 1 Score: 86.6557 bits (213), Expect = 1.889e-18
Identity = 47/131 (35.88%), Postives = 74/131 (56.49%), Query Frame = 3
Query:  303 YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEF 695
            Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E   +PFDS  F++ P   ++G    L G+++ L SM K E A F+F  +  +G LG PP IP  A +  E+E+IDF +    D+F
Sbjct:   22 YERLSQRMLDISGD-RGVLKDIIREGTGDTVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELIDFLDSAESDKF 151          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Mouse
Match: Fkbp4 (FK506 binding protein 4 [Source:MGI Symbol;Acc:MGI:95543])

HSP 1 Score: 80.1073 bits (196), Expect = 1.392e-15
Identity = 78/259 (30.12%), Postives = 125/259 (48.26%), Query Frame = 3
Query:  354 IFKRLISKGEGSKIPI-GSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLL---TGLDIALQSMCKKERANFVFDSSVMFGELGVPP-RIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDIL-YAMPLATDEEEKIRWGHVVKL--YLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNK 1106
            I +R+ ++GEG   P  G++V    + YH+D++  FD            VG G+ L    GL+ A+Q M K E +      S  FG +G    +IP  A++  EV +  F +     E +E S  E+LE S   I+K          A  +  +Y  AL +Y + +  L Y    + +E +K+   H ++L  +LN+A C+LKL    +AI+ CN  L     N K L+R+G   + + +FD A   F+   +  P+NK
Sbjct:  150 IIRRIRTRGEGYARPNDGAMVEVALEGYHKDRL--FDQRELCFE-----VGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPHAELRYEVRLKSFEKAK---ESWEMSSAEKLEQS--NIVK------ERGTAYFKEGKYKQALLQYKKIVSWLEYESSFSGEEMQKV---HALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNK 387          

HSP 2 Score: 52.7582 bits (125), Expect = 6.078e-7
Identity = 37/134 (27.61%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  312 LTIKMIDISDDS-KLIFKRLISKGEGSKIP-IGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQR-----VGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDE 692
            L ++ +DIS    + + K +  +G G++ P IG  V  +Y  +        D T+F    DR+      +G G+++   DIA+ +M   E  +        +G  G PP+IP  A +  EVE+ +F  ++L +E
Sbjct:   18 LPLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWL------LDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGAAGSPPKIPPNATLVFEVELFEFKGEDLTEE 145          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. UniProt/SwissProt
Match: sp|A6QQ71|FKBP6_BOVIN (Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Bos taurus OX=9913 GN=FKBP6 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.252e-33
Identity = 81/286 (28.32%), Postives = 143/286 (50.00%), Query Frame = 3
Query:  255 NNAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            N    ++  D +P   Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E   +PFDS  F++ P   ++G    L G+++ L SM + E A F+F  +  +G LG PP IP    +  E+E++DF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y R L +L+      +E+  +    ++ ++LN++   LKL R   A++     L     NAKAL+R G+  +++ E+  A      A +  P N DI
Sbjct:    8 NGLSRLDAEDRSP---YQRLSQRMLDISGD-RGVLKDVIREGAGELVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGTLGCPPLIPPNTTVLFEIELLDFLDSAESDKFCALSAEQQSQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRALLLLHRRTAPPEEQHLVETAKLL-VFLNLSFTYLKLERPTMALRYGEQALIIDRKNAKALFRCGQACLLMTEYQKARDFLVRAQREQPFNHDI 288          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. UniProt/SwissProt
Match: sp|F6PHZ6|FKBP6_HORSE (Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Equus caballus OX=9796 GN=FKBP6 PE=1 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 4.261e-32
Identity = 80/270 (29.63%), Postives = 136/270 (50.37%), Query Frame = 3
Query:  303 YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E   +PFDS  F++ P   ++G    L G+++ L SM + E A F+F  +  +G LG PP IP    +  E+E++DF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y R L +L+      +E+  +    ++ L LN++   LKL R  +A+      L     NAKAL+R G+  +++ E+  A      A K  P N DI
Sbjct:   11 YQRLSQRMLDISGD-RGVLKDVIREGAGELVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGTLGCPPLIPPNTTVLFEIELLDFLDSAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQHRFYDAKVRYKRALLLLHRRSAPPEEQHLVEAAKLLVL-LNLSFTYLKLERPTTALCYGEQALVIDQKNAKALFRCGQACLLMTEYQKARDFLVQAQKAQPFNHDI 278          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. UniProt/SwissProt
Match: sp|Q91XW8|FKBP6_MOUSE (Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Mus musculus OX=10090 GN=Fkbp6 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 9.300e-32
Identity = 85/270 (31.48%), Postives = 140/270 (51.85%), Query Frame = 3
Query:  303 YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E   +PFDS  F++ P   ++G    L G+++ L SM K E A F+F  +  +G LG PP IP  A +  E+E+IDF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L    LAT EE+ +    V+ + LN++   LKL+R   A++     L     NAKAL+R G+  +++ E++ A      A K  P N DI
Sbjct:   22 YERLSQRMLDISGD-RGVLKDIIREGTGDTVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELIDFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNYLFRQNRFCDAKVRY-KRALLLLHRRLATCEEQHLVEPAVLLVLLNLSFVYLKLDRPAMALRYGEQALLIDKRNAKALFRCGQACLLLTEYERARDFLVRAQKEQPCNHDI 289          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. UniProt/SwissProt
Match: sp|D3ZQF4|FKBP6_RAT (Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Rattus norvegicus OX=10116 GN=Fkbp6 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 8.165e-31
Identity = 82/270 (30.37%), Postives = 139/270 (51.48%), Query Frame = 3
Query:  303 YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E   +PFDS  F++ P   ++G    L G+++ L SM + E A F+F  +  +G LG PP IP  A +  E+E+IDF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y R L +L+      +E+  +    ++ L LN++   LKL+R   A++     L     NAKAL+R G+  +++ E++ A      A K  P N DI
Sbjct:   22 YERLSQRMLDISGD-RGVLKDIIREGAGDPVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGTLGCPPLIPPNATVLFEIELIDFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNYLFRQNRFCDAKVRYKRALLLLHRRLAICEEQHLVEPAELLVL-LNLSFVYLKLDRPAMALRYGEQALLIDKRNAKALFRCGQACLLLTEYEQARDFLVRAQKEQPCNHDI 289          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. UniProt/SwissProt
Match: sp|O75344|FKBP6_HUMAN (Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Homo sapiens OX=9606 GN=FKBP6 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.251e-28
Identity = 83/282 (29.43%), Postives = 137/282 (48.58%), Query Frame = 3
Query:  270 VEESDSTPFVK-YKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            V E D  P    Y+ L+ +M+DIS D + + K +I +G G  +   + V+  Y  Y E    PFDS  F++ P   ++G    L G+++ L SM + E A F+F  +  +G LG PP IP    +  E+E++DF +    D+F   S +++ +    +++K+    R   N   R  R+  A  +Y +   +L     A  EE+ +     + + LN++   LKL+R   A+      L     NAKAL+R G+  +++ E+  A      A K  P N DI
Sbjct:   10 VLEGDDAPGQSLYERLSQRMLDISGD-RGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRY-KRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDI 289          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. TrEMBL
Match: I1ZIC6 (Peptidylprolyl isomerase (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 457/457 (100.00%), Postives = 457/457 (100.00%), Query Frame = 3
Query:   48 PKMSTDVSFKFDIEDEKDRMLERKYITELMEQEESKLYNSNDSEETDSFFNGEGYQLLLKECGLSLPFDNNAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMINIKENXXXXXXXXXXDLTSDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLFNEKDGIIRKK 1418
            PKMSTDVSFKFDIEDEKDRMLERKYITELMEQEESKLYNSNDSEETDSFFNGEGYQLLLKECGLSLPFDNNAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMINIKENVVPAAPVAAPDLTSDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLFNEKDGIIRKK
Sbjct:    3 PKMSTDVSFKFDIEDEKDRMLERKYITELMEQEESKLYNSNDSEETDSFFNGEGYQLLLKECGLSLPFDNNAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMINIKENVVPAAPVAAPDLTSDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLFNEKDGIIRKK 459          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. TrEMBL
Match: A0A2L2YF89 (Peptidylprolyl isomerase OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 3.786e-47
Identity = 115/369 (31.17%), Postives = 200/369 (54.20%), Query Frame = 3
Query:  291 PFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMINIKENXXXXXXXXXXDLTSDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLFNEK 1397
            PF  YK+   +M  ++ D K I K ++  G G  IP  S+V+ +Y  Y E+Q EPFDSTR ++ P +   G   LL GL++A+++M K E + F+      +G +G PPRIP  A+I  EVEV++F +     EF + + +++ + SF++++ +     N AN     K Y  A+ +Y +  ++L  + +A +EE++ R G+++KLYLN+A C + +     A+   +  L  QP N K L+R G  L +I +++ A      A K  P  K I +AI + E  ++Q YE +K  ++  +   +    A     P+ T +    ++ QI +F +S+  + L+   G ++++I ++K L  + NL F  K
Sbjct:   68 PFSVYKE---RMEPVTSDKK-ILKEVMKHGSGVLIPNKSVVMMHYDAYLENQKEPFDSTRLRKRPYKFLFGDNNLLPGLELAIKTMKKDEMSRFLVSPDYAYGAMGCPPRIPPSAEILYEVEVLNFYDSKDAIEFEDMAPEDQKKASFEKVVAVYHCEHNMANDLFHKKLYKQAIARYRKAANMLQEVNVANEEEDEKRNGYLLKLYLNLAQCYINIQTPNKAVIYADLALKIQPKNPKGLFRMGCALHMISDYERAEHYLSQAKKEKPFAKSINEAIAKLEQKRKQHYEWEKRFSKYALAGSQQSEAAKEQVLPE-TQEFVDIVQEQINEFLESD-EKELTFSSGYTEDQIVVMKELAKKNNLAFVSK 430          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. TrEMBL
Match: A0A1S3J4U1 (Peptidylprolyl isomerase OS=Lingula unguis OX=7574 GN=LOC106170218 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.346e-45
Identity = 106/307 (34.53%), Postives = 162/307 (52.77%), Query Frame = 3
Query:  222 LKECGLSLPFDNNAVD----------VEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            + ECGL  P D+ + +           +ES  +PF   + L   M D++     + K+++  G G  +P  + V  +Y  Y E   EPFDSTR +    R ++G G  + GL+IA+ SM K E A F+F     +GE G PPRI   AD+  EVE+++F ++  +D F+EK+ +ER      EI+++V   +  A      ++Y  ALN Y + +  L  + L  D+EEK +   + K+YLN A+CN KL+R   A++ C  V+ K   N KA+Y + + L   G+FD A    K A    PNN DI
Sbjct:   66 VAECGL--PDDDESTEQYHSDDDNDTDDESGPSPF---QLLARNMQDLTPPEGGVLKQVLKPGTGDVVPKEAFVQVHYNGYLEYSGEPFDSTRLRDRQFRFQLGKGDTIMGLEIAVSSMRKGELARFIFSYKYAYGERGCPPRIGEKADVMFEVELLNFYDQGAVDAFYEKTEEERRNAPLSEILRVVQHDKQKAGELFNKQKYRPALNLYRKIIRTLEGVHLQNDDEEKEQQDLLQKVYLNSANCNTKLSRNADAVRDCKMVMEKDRNNVKAMYLRAKALYQDGKFDGAINWIKRAQAKSPNNTDI 367          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. TrEMBL
Match: A0A1S3J5B1 (Peptidylprolyl isomerase OS=Lingula unguis OX=7574 GN=LOC106170218 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.807e-45
Identity = 106/307 (34.53%), Postives = 162/307 (52.77%), Query Frame = 3
Query:  222 LKECGLSLPFDNNAVD----------VEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            + ECGL  P D+ + +           +ES  +PF   + L   M D++     + K+++  G G  +P  + V  +Y  Y E   EPFDSTR +    R ++G G  + GL+IA+ SM K E A F+F     +GE G PPRI   AD+  EVE+++F ++  +D F+EK+ +ER      EI+++V   +  A      ++Y  ALN Y + +  L  + L  D+EEK +   + K+YLN A+CN KL+R   A++ C  V+ K   N KA+Y + + L   G+FD A    K A    PNN DI
Sbjct:   87 VAECGL--PDDDESTEQYHSDDDNDTDDESGPSPF---QLLARNMQDLTPPEGGVLKQVLKPGTGDVVPKEAFVQVHYNGYLEYSGEPFDSTRLRDRQFRFQLGKGDTIMGLEIAVSSMRKGELARFIFSYKYAYGERGCPPRIGEKADVMFEVELLNFYDQGAVDAFYEKTEEERRNAPLSEILRVVQHDKQKAGELFNKQKYRPALNLYRKIIRTLEGVHLQNDDEEKEQQDLLQKVYLNSANCNTKLSRNADAVRDCKMVMEKDRNNVKAMYLRAKALYQDGKFDGAINWIKRAQAKSPNNTDI 388          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. TrEMBL
Match: T2MIQ4 (Peptidylprolyl isomerase OS=Hydra vulgaris OX=6087 GN=FKBP6 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.613e-45
Identity = 128/418 (30.62%), Postives = 213/418 (50.96%), Query Frame = 3
Query:  171 DSEETDSFFNGEGYQLLLKECGLSLPFDNNAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMINIKENXXXXXXXXXXDLTSDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLF----NEKDGIIR 1412
            D+EE+  F   E ++ L  EC       ++  D  +  STPF K K     M DI+    L+ K+++ +G G  IP  SL   +Y  Y E   EPFDS+R +    + ++G G+ + G  IA+ +M + E + F+   +V FG++G PPRIP  A++  E+E+I + ++   D F   S DE+++  F+EIIK+V   R   N A   K+Y  A +KY + L +L    L  + EEK      +KLYLN++ C+LK  R   +IK     L     N KALYR  R L  +GE++++ +    A++  P NK+++  + E ++  ++  +  + L++ M+N+     P    A    T  +   +R  ++ F D+  + +    K L++ EI  +     + NL      N KD II+
Sbjct:   57 DNEESRYFEQEELFKQLNYEC------IDDGCDSSDEKSTPFEKIKR---GMEDITG-CGLVLKKIMKQGSGPVIPPNSLCRVHYNGYIEYSDEPFDSSRLRGKQHQFKLGSGEGIEGWQIAISTMKRGEISKFLLHPTVAFGKMGCPPRIPSNAEVLFEIELISYVDQLASDVFQNFSKDEQMKTPFEEIIKVVDSIRLTGNEAFMVKQYNRASSKYSQALRLLENTNLKNENEEKEMKKCALKLYLNISLCDLKQVRYRKSIKYARKALDIDNKNVKALYRLARSLRCLGEYEESKRQISKAHRLDPRNKEVMQELLELDEEMKKTQKIDQQLSRKMLNLTPEKKPDKSPAKE--TQQMVHVVREALKGFKDNNESEMFLP-KNLTEEEIQSITKAAEELNLHIIQKENGKDKIIQ 461          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Cavefish
Match: fkbp6 (FKBP prolyl isomerase 6 [Source:NCBI gene;Acc:103027283])

HSP 1 Score: 119.013 bits (297), Expect = 1.428e-29
Identity = 81/288 (28.12%), Postives = 139/288 (48.26%), Query Frame = 3
Query:  276 ESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWG---HVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRE 1130
            E   TPF +   L  +M D+  D   IFK +I  G+G  +   S V  N+  + E   +PFDS+   + P   ++G    L GL++ L +M K E + F+F     FGE+G PP IP  A +  EV+V+DF +   +D FF  +++E+       ++ ++   ++  N      RY  A ++Y + + +L       +EE   RW     ++   LN++   L+L R   A++     L   P + KAL+R G+  + + ++D A      A    P + DI + +R+
Sbjct:   26 EGIQTPFQR---LARQMHDVLGDGG-IFKEVIRAGDGPAVQRDSTVSVNFSAFLEYADQPFDSSTHLKFPKMMKLGKDMTLCGLELGLLTMRKGECSRFLFKHDYAFGEMGCPPLIPPLAMVLYEVQVLDFFDTAQVDNFFALTVEEQNSAPLSTLLSVIDTEKSFGNRCFNQSRYEDAKDRYKQAVTLLQNREPMNEEE---RWRIEEAMLPFLLNLSFTYLRLERPQKALQYGKKALKINPNSTKALFRCGQACLEMDDYDGAQDYLTRAQAKKPFDIDINNLLRK 306          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Cavefish
Match: fkbp8 (FKBP prolyl isomerase 8 [Source:NCBI gene;Acc:103023735])

HSP 1 Score: 88.5817 bits (218), Expect = 1.143e-18
Identity = 69/209 (33.01%), Postives = 104/209 (49.76%), Query Frame = 3
Query:  498 VGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVP-PRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYA---MPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            +G G ++  LD+ +Q M   E+A     S   +G LG   P +P  AD+  E++++   E          + D  L LS  E I L  + R   N   +   Y  A+N Y   L I  A   + ++  EEE +     VK   NMA   LKL+   +A++ C +VLA QP N KAL+R+G+ L + GE+ +A ++ K A K  P+NK I
Sbjct:  140 LGDGDVMQALDLTVQLMEIGEKALVEAGSKYAYGALGSSTPAVPPHADLILEIQLLSAAE----------APDLEL-LSPSERISLASKKRERGNVHYQRGDYAFAINSYGIALQITEASSRVDISPQEEEDL-LDVTVKCLNNMAAAQLKLDHYEAALRSCVSVLAHQPDNIKALFRQGKVLALQGEYAEAIRILKRALKLEPSNKTI 336          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Cavefish
Match: fkbp8 (FKBP prolyl isomerase 8 [Source:NCBI gene;Acc:103023735])

HSP 1 Score: 87.8113 bits (216), Expect = 1.663e-18
Identity = 69/209 (33.01%), Postives = 104/209 (49.76%), Query Frame = 3
Query:  498 VGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVP-PRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYA---MPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            +G G ++  LD+ +Q M   E+A     S   +G LG   P +P  AD+  E++++   E          + D  L LS  E I L  + R   N   +   Y  A+N Y   L I  A   + ++  EEE +     VK   NMA   LKL+   +A++ C +VLA QP N KAL+R+G+ L + GE+ +A ++ K A K  P+NK I
Sbjct:  140 LGDGDVMQALDLTVQLMEIGEKALVEAGSKYAYGALGSSTPAVPPHADLILEIQLLSAAE----------APDLEL-LSPSERISLASKKRERGNVHYQRGDYAFAINSYGIALQITEASSRVDISPQEEEDL-LDVTVKCLNNMAAAQLKLDHYEAALRSCVSVLAHQPDNIKALFRQGKVLALQGEYAEAIRILKRALKLEPSNKTI 336          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Cavefish
Match: fkbp16 (FKBP prolyl isomerase 16 [Source:ZFIN;Acc:ZDB-GENE-050208-116])

HSP 1 Score: 77.411 bits (189), Expect = 9.297e-15
Identity = 77/271 (28.41%), Postives = 124/271 (45.76%), Query Frame = 3
Query:  327 IDISDDSKLIFKRLISKG-EGSKIPI-GSLVIYNYKFYHEDQ--IEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMP-----LATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            IDI+DD +L+ K+++  G E +  P+ G  V    +   ED+  +E      F        +G G +   L+    SM K+E A  + DS   +G LG  P IP    I  ++++++  +K            + L L   + I++  Q R   N   + + Y +A   Y   LD+L          A +EEE++   + VK   N+A   LKL +   A+     VL   P N KAL+RKG+ L   G++++A +  K A K  P+ K I
Sbjct:  199 IDITDD-RLLRKKVLEAGPERAPCPVWGQEVTLKMQGVLEDRTMVEKDCKLVFV-------IGEGDVNQALEECAISMKKEEIALLLADSQYTYGLLGRDPDIPPWTPILYQLQLVEIRDKP-----------DPLSLPISDRIRIGNQKRERGNFCFQREEYSMAAQAYCMALDVLTTQTHDGRVCAPEEEEEVN-DYRVKCLNNLAAAQLKLEQYSEALHTSQDVLFLDPNNVKALFRKGKLLSDKGDYEEAMETLKKALKLEPSTKAI 449          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Cavefish
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:103045630])

HSP 1 Score: 72.4034 bits (176), Expect = 2.689e-13
Identity = 81/295 (27.46%), Postives = 138/295 (46.78%), Query Frame = 3
Query:  330 DISDDS-KLIFKRLISKGEGSKIP-IGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQ---LLTGLDIALQSMCKKERANFVFDSSVMFGELGVPP-RIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDIL-YAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMIN 1193
            DI+D+    I +R+I+KGEG   P  G+ V  + +  +E ++  FD    K       VG G+   L  G++ ALQ+M + E + F       FG  G     IP GA +  ++++  F +     E +E +  E+LE S   I+K             ++ +Y  A  +Y R +  L +   L  ++EEK +   +   +LN++ C LKL+    A++ C+  L     N KAL+R+G  L ++ EF+ A   F+   +  P+NK     +   +   ++ +E  K L  NM  
Sbjct:  136 DITDEEDGGIVRRIITKGEGYTKPNEGASVDVHLEGQYEGRV--FDDRDLKFE-----VGDGENLDLPPGVEKALQAMEQGEESLFTIKPKYGFGNTGYAKFNIPPGATLQYKIKLTAFEKAK---ESWEMNTCEKLEQS--TIVK------EKGTQYFKDGKYKQAAVQYKRIVSWLEHESSLQGEDEEKAKALRLA-AHLNLSMCYLKLHDPNPALENCDKALELSANNEKALFRRGEALFVMKEFERAKDDFQRVIQLYPSNKAAKSQVVLCQKHIKEQHEKDKRLYANMFQ 411          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Sea Lamprey
Match: fkbp6 (FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-050302-4])

HSP 1 Score: 139.043 bits (349), Expect = 1.640e-37
Identity = 87/288 (30.21%), Postives = 152/288 (52.78%), Query Frame = 3
Query:  288 TPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQ 1151
            +PF K   +   M+D++ +   + K ++ KG G  +P  S V  NY  Y E   EP+DS+  ++   R  +  G ++ GL++ L +MCK E A F+  S   +G LG PPRIP  + +  EVE++ F +   +D+++  + +ER  L  ++++++ V  R   NA  +  RY  A++KYL+ L IL    L+++EE+      ++K+ LN+A C L+ NR  S +      L  QP N KA +R G+  +++G++  +      A    P +  I   ++  E   Q+
Sbjct:   21 SPFQK---IARNMVDLTGNGG-VLKIVLQKGSGDIVPELSAVRVNYNAYLEYSDEPYDSSHLRKEESRLWLSKGAVMPGLEVGLLTMCKGELARFLVRSDYAYGALGCPPRIPPNSTLLLEVELLGFIDCINVDDYYTMTPEERKRLKLEKVLRVAVNERTAGNAHFQAGRYDRAMHKYLKTLRILENAHLSSNEEQSQMEASLLKVLLNLALCYLRRNRPSSTVHYALRALRVQPNNVKACFRLGQAHLMLGDYVRSRYYLLRAQSMAPVHPVITHELKALEAKWQE 304          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004854.1 (pep scaffold:Pmarinus_7.0:GL501075:9618:21951:-1 gene:ENSPMAG00000004388.1 transcript:ENSPMAT00000004854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 8.341e-11
Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 3
Query:  402 GSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVID 665
            G  +  +Y    ED  E FDS+  +  P    +G GQ++ G D  L  MC+ E+   V    + +G+ G PP+IPGGA +  EVE++ 
Sbjct:   50 GDTLHMHYTGTLEDGTE-FDSSIPRNQPFIFTLGTGQVIKGWDQGLLGMCEGEKRKLVIPPELGYGDRGAPPKIPGGATLVFEVELLQ 136          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Yeast
Match: FPR2 (Membrane-bound peptidyl-prolyl cis-trans isomerase (PPIase); binds to the drugs FK506 and rapamycin; expression pattern suggests possible involvement in ER protein trafficking; relocalizes from nucleus to vacuole upon DNA replication stress; mutation is functionally complemented by human FKBP2 [Source:SGD;Acc:S000002927])

HSP 1 Score: 53.1434 bits (126), Expect = 3.445e-9
Identity = 26/70 (37.14%), Postives = 40/70 (57.14%), Query Frame = 3
Query:  456 FDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVID 665
            FDS+  +  P    +GVG+++ G D  +  MC  E+      SS+ +GE GVP  IP  AD+  +VE++D
Sbjct:   61 FDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVD 130          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Yeast
Match: FPR1 (Peptidyl-prolyl cis-trans isomerase (PPIase); binds to the drugs FK506 and rapamycin; also binds to the nonhistone chromatin binding protein Hmo1p and may regulate its assembly or function; N-terminally propionylated in vivo; mutation is functionally complemented by human FKBP1A [Source:SGD;Acc:S000005079])

HSP 1 Score: 48.1358 bits (113), Expect = 1.311e-7
Identity = 29/99 (29.29%), Postives = 50/99 (50.51%), Query Frame = 3
Query:  369 ISKGEGSKIP-IGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVI 662
            IS G+G+  P  G LV  +Y    E+  + FDS+  +  P +  +GVGQ++ G D+ +  +   E+A         +G  G P  IP  + +  +VE++
Sbjct:   14 ISPGDGATFPKTGDLVTIHYTGTLENG-QKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELL 111          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Yeast
Match: CPR6 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; plays a role in determining prion variants; binds to Hsp82p and contributes to chaperone activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004206])

HSP 1 Score: 49.6766 bits (117), Expect = 5.215e-7
Identity = 71/249 (28.51%), Postives = 112/249 (44.98%), Query Frame = 3
Query:  480 HPDRQRVGVGQLLTGLDIAL---QSMCKKERANFVFDSSVMFGELGVPP---RIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLEL-SFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDIL---YAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVL----AKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENE-DLKQQDYEAKKLLAQ 1181
            H D + V  G+++ G  I        C +E    + D  V   + GV P   ++P  A+     E  D  E  L         DE+++L +FD ++K +   +N      + + Y +AL KY++    L   +   L  ++ EKI    V  + LN+A C LKL      +   + VL    A + A AKALYR+G     + + D A    + A    PN+  IL AI   +   KQQ+ +AKK L++
Sbjct:  130 HLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRD--VKIDDCGVLPDDYQVPENAEATPTDEYGDNYEDVL-------KQDEKVDLKNFDTVLKAIETVKNIGTEQFKKQNYSVALEKYVKCDKFLKEYFPEDLEKEQIEKINQLKV-SIPLNIAICALKLKDYKQVLVASSEVLYAEAADEKAKAKALYRRGLAYYHVNDTDMALNDLEMATTFQPNDAAILKAIHNTKLKRKQQNEKAKKSLSK 368          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Nematostella
Match: EDO44176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWJ0])

HSP 1 Score: 162.54 bits (410), Expect = 3.066e-45
Identity = 112/343 (32.65%), Postives = 179/343 (52.19%), Query Frame = 3
Query:  144 EESKLYNSNDSEETDSFFNGEGYQLLLKECGLSLPFDNNAVDVEESDS-TPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFT----EKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDY 1157
            E++  ++++D E+T  +F+ E     L    L +  D ++V+ EE++S TPF K   +   M D++ D   + K++I +G G  +P  + V ++   Y E   EP+DS+RF+  P++ R+G G    GLDI + +M K E + F+FD   +F +LG  PR+PG A +  EVE++ F     E +L   F E    ER + SF+ ++ +    R   N   + K Y  A  KY R   +L    L  ++EE +    ++KLY NM+ C L  N+    IK    VL   P N KA Y+ G+  M  GEFD A      A ++ P +KDI DA+   ++L  + +
Sbjct:   51 EQNNDFHNSDDEDTGPYFDSEQMFQQLNHEVLGVDDDEDSVNDEENNSKTPFEK---MAQGMEDLTGDGG-VLKKIIRQGTGPVVPKTATVRFHSNGYKEFCDEPYDSSRFRGKPEQMRLGEGAF-PGLDIGVSTMRKGELSRFLFDKEYVFKDLGCEPRVPG-ATVMWEVELLSFVDHGPEGDLESNFPEG---ERRKASFEHLMAVANGDRETGNDLYKKKLYHKAFTKYSRATKLLEECRLQNEDEENMMNQVLLKLYSNMSQCALDQNQEARCIKYARKVLFIDPKNPKAFYKMGKAFMKQGEFDKARDNLIKARRYCPGSKDIRDALVTLDNLSHRHF 384          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Nematostella
Match: EDO43207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZA5])

HSP 1 Score: 64.3142 bits (155), Expect = 4.159e-11
Identity = 75/304 (24.67%), Postives = 136/304 (44.74%), Query Frame = 3
Query:  312 LTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVI-------YNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFG-------ELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIR-ENEDLKQQDYEAKKLLA 1178
            L  K I++++  + + K ++ KGEG   P    V+       Y+ K + E ++E      F    +        LL G++ A+ +M  KE++  +F     +G       +LG+PP             +I +    +ID    ++  E  ELS DE I   ++ ++      ++ +Y IA  +Y   + +L       +EEEK         +LN+A C+LKL      IK CN  L     N KAL+R+G+ L+ + +++ + + F    +  P N++  + ++  N  LK    + KKL +
Sbjct:  138 LDWKGINVTNKGE-VSKVILEKGEGHARPNTGAVVNAHVTGSYDGKVFEEREVE----FTFGEGTE------AGLLEGVEEAIGNMTNKEKSK-IFIQPGKYGVGPEGNPQLGLPPNA-----------LITY----IIDLKHFENFKEAWELSNDEKITTALKVKDKGTKFFKDGKYKIACRQYAVVIRVLEG--YFDEEEEKAVDPIKCAGHLNIAACHLKLGNNFKCIKACNKALDIDKENIKALFRRGKALLNLKDYEKSKEDFTQVLELDPKNREAREQLKIVNGMLKDHHQKEKKLYS 412          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Nematostella
Match: EDO40282 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7S7R3])

HSP 1 Score: 59.3066 bits (142), Expect = 8.523e-11
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  438 EDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKN 680
            ED  E FDS+  +  P    +G GQ++ G D  L +MC  E+   V  S + +G+ G PP+IPGGA +  EVE++   +K+
Sbjct:   50 EDGTE-FDSSIPRGEPFVFTLGTGQVIKGWDQGLLNMCAGEKRKLVIPSDMGYGDRGAPPKIPGGATLIFEVELLKIGDKS 129          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Nematostella
Match: EDO41747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C4])

HSP 1 Score: 58.151 bits (139), Expect = 3.220e-9
Identity = 67/255 (26.27%), Postives = 110/255 (43.14%), Query Frame = 3
Query:  456 FDSTRFKRHPDRQRVGVGQLLTGLDI------------ALQSMCKKERANFVFDS-----SVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHV-VKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRE----NEDLKQQD 1154
            F +T    H D + V  G++L G+D+            + +S C  E    +        SV  G   V P  P  ADI       DF++  L+ E  EK             +K++       N   + ++Y +A  KY + L  L     +  E+   +   + +  YLN A C LKL   PSAI+ CN  L     +AKAL+R+G+    + ++++A    + A+K  P +K I++ + +     E  KQ+D
Sbjct:  133 FITTVPTPHLDGRHVVFGKVLKGMDVVRELEATPVDDSSPKSPCIIEECGELAPGQDDGMSVDDGTGDVYPNWPKDADI-------DFSKVELVVEVAEK-------------LKVI------GNEQFKQQKYEVAKKKYKKALRYLDEFQNSDMEDNAKKMAAIALPCYLNSAACKLKLAEYPSAIEDCNEALKLDANSAKALFRRGQANEHMKDYEEAMVDLQKASKLAPGDKGIINEMSKVCKLQEAKKQKD 361          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Nematostella
Match: EDO41295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4K2])

HSP 1 Score: 49.6766 bits (117), Expect = 1.385e-6
Identity = 66/287 (23.00%), Postives = 119/287 (41.46%), Query Frame = 3
Query:  333 ISDDSKLIFKRLISKGEG--SKIPIGSLVIYNYKFYHEDQIEP--FDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPG------GADI-----------------YAEVEVIDFTEKNLIDEFFEKSID-------ERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPL--ATDEEEKIRWGHV-VKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSA 1082
            ++ +++ + K ++  GEG     P GS  ++++K +  +Q E    D +R    P    +G    L   +  +++M  KE A F  D SV+ G   V            G  +                 YA+++V+   EK+LI E    S++       E  ++   E +  + + + + N    + +Y  A  KY   L  L  + +     +EE ++   + +   LN + C L L      IK  +TVL K   N KAL+R+ +      + ++A   FK A
Sbjct:    1 MASNNQKVVKEVLYPGEGDIPAFPHGSKAVFHFKTFLMEQSEKQELDCSRKIGQPFELLMGKKFKLEIWEELIKTMRVKEVARFTCDKSVVAGYHFVSKNFRNAVKKNKGEHVHDHHEHSCSFSAVTTTGYADLDVLLTGEKDLIFEIELISVNKPGEYKKETWQMDPKEKLAAIPKYKEEGNELYVDGKYKDAAEKYAEALGCLEQLSIREKPGDEEWVKLDQMKIPFLLNFSQCKLLLGEYYEVIKHTSTVLEKDKDNVKALFRRAKAHKACWDPEEARSDFKRA 287          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Medaka
Match: fkbp6 (FKBP prolyl isomerase 6 [Source:NCBI gene;Acc:101170639])

HSP 1 Score: 113.62 bits (283), Expect = 1.343e-27
Identity = 82/303 (27.06%), Postives = 152/303 (50.17%), Query Frame = 3
Query:  279 SDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDE-EEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILD-----AIRENEDL-KQQDYEAK 1166
            S  TPF    DL  + +D     + + K ++  GEG  +P  + V+ +Y  Y E   +PF++T   +HP   ++G    L GL++ L +M + E +  +      +G+LG PP IP  A +  EV+++D+ +   ++EFF  S +E+  +   E++++    R+  N      ++  A   Y + + +L    + ++  +EKI+   +    LN++   L+L     A+K     L     N KAL+R G+  + +G+F++A K  K+A    P + DI +     AIR  + L K++D+ +K
Sbjct:   33 SFPTPF----DLLQQRMDDVLGDRGVLKEVLHPGEGPPVPQNASVLVHYSGYLEYSDQPFETTTHLKHPRLLKMGRDLTLWGLELGLLTMKRGEHSRVLLQPQYAYGDLGCPPLIPAAAVVLYEVQIVDYFDSGQVEEFFAMSPEEQSSVPLSELLEVTNTLRSLGNHYFSCSQHYRAKGSYKQAVMVLENREVQSEPVKEKIQPALLPLY-LNLSLTELRLENWHKALKYTTKALEMDSLNTKALFRCGQAYLELGDFENALKFLKAAQAKKPYDTDINNLLKKVAIRYKDSLDKEKDFCSK 330          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Medaka
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:101164056])

HSP 1 Score: 78.5666 bits (192), Expect = 3.237e-15
Identity = 81/294 (27.55%), Postives = 135/294 (45.92%), Query Frame = 3
Query:  330 DISDDS-KLIFKRLISKGEG-SKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQ---LLTGLDIALQSMCKKERANFVFDSSVMFGELG-VPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMIN 1193
            DI++D    I +R+I+KGEG SK   G+ V    +  H+++I  FD    K       +G G+   L  GL+ A+ +M + E A F       +G  G     IP GA +  ++++  F +     E +E +  E+LE S   IIK             ++ +Y  A  +Y + +  L      ++E+EK      +  +LN+A C LKL+    A++ C+  L    +N KAL+R+G  L  + EFD A   F+   +  P NK     +   +   ++ +E  K +  NM  
Sbjct:  137 DITEDEDGGIIRRIITKGEGYSKPNEGATVEVTVQGTHDERI--FDERELKFE-----IGDGESFNLPAGLEKAIMAMEQGEEALFTIKPKYGYGNAGNAKLNIPAGATLQYKIKLTAFEKAK---ESWEMNTPEKLEQS--SIIK------EKGTQYFKDGKYKQASVQYKKIVSWLEHESGLSEEDEKKAKTLRLAAHLNLAMCYLKLHEPNQALENCDKALEMDASNEKALFRRGEALFAMNEFDKARDDFQRVVQLYPANKAAKSQVMLCQKRLKEQHEKDKRIYANMFQ 412          

HSP 2 Score: 48.9062 bits (115), Expect = 7.530e-6
Identity = 31/114 (27.19%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  354 IFKRLISKGEGSKIPI-GSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDE 692
            + K +  +G G+++P+ G  V  +Y     D    FDS+R +       +G GQ++   DI + +M   E    V      +G  G PP+IP  + +  EVE+ DF  +++ ++
Sbjct:   29 VLKVIKREGTGTELPMTGDKVFVHYVGTLLDGTH-FDSSRDRGEKFSFELGKGQVIKAWDIGVATMKVGELCQLVCKPEYAYGSAGSPPKIPPNSTLVFEVELFDFRGEDITED 141          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Medaka
Match: fkbp8 (FKBP prolyl isomerase 8 [Source:NCBI gene;Acc:101174655])

HSP 1 Score: 76.6406 bits (187), Expect = 9.153e-15
Identity = 69/227 (30.40%), Postives = 104/227 (45.81%), Query Frame = 3
Query:  456 FDSTRFKRHPDRQ-RVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELG-VPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAM------PLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
             D T  +  P+    +G   ++  LD+ +Q M   E+A    D    +G+ G + PR+P  A +  EVE+++ T+          + D  L L   E I L  + R   N   +   Y  A+N Y   L I  +       P   DE   +R    VK   NMA   LKL+   +A+K C + L  QP N KAL+R G+ L + GE+ +A +  + A K  P+NK I
Sbjct:  118 IDGTLVEEQPNFSFTLGDCDVIQALDLTVQLMEMGEKALIQSDPKYAYGDRGSLEPRVPPNAQLSLEVELLEATD----------APDVEL-LPPAEKIALASRKRERGNVHYQRGDYAFAVNSYSIALQIAESSSKVDIRPEEEDELLDVR----VKCLNNMAASQLKLDHYDAALKSCVSALEHQPDNIKALFRMGKVLSLKGEYTEAIQTLRKALKLDPSNKVI 329          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Medaka
Match: fkbp8 (FKBP prolyl isomerase 8 [Source:NCBI gene;Acc:101174655])

HSP 1 Score: 76.6406 bits (187), Expect = 1.087e-14
Identity = 65/207 (31.40%), Postives = 97/207 (46.86%), Query Frame = 3
Query:  513 LLTGLDIALQSMCKKERANFVFDSSVMFGELG-VPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAM------PLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDI 1112
            ++  LD+ +Q M   E+A    D    +G+ G + PR+P  A +  EVE+++ T+          + D  L L   E I L  + R   N   +   Y  A+N Y   L I  +       P   DE   +R    VK   NMA   LKL+   +A+K C + L  QP N KAL+R G+ L + GE+ +A +  + A K  P+NK I
Sbjct:  138 VIQALDLTVQLMEMGEKALIQSDPKYAYGDRGSLEPRVPPNAQLSLEVELLEATD----------APDVEL-LPPAEKIALASRKRERGNVHYQRGDYAFAVNSYSIALQIAESSSKVDIRPEEEDELLDVR----VKCLNNMAASQLKLDHYDAALKSCVSALEHQPDNIKALFRMGKVLSLKGEYTEAIQTLRKALKLDPSNKTI 329          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Medaka
Match: fkbp16 (peptidyl-prolyl cis-trans isomerase FKBP8-like [Source:NCBI gene;Acc:105354225])

HSP 1 Score: 66.2402 bits (160), Expect = 1.887e-11
Identity = 61/233 (26.18%), Postives = 102/233 (43.78%), Query Frame = 3
Query:  498 VGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMP-----LATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAI-----RENEDLKQQDYEAK 1166
            +G G +   L+  + SM   E    + DS   +G LG  P IP  A    +++++D  +K            + L L   + I++  Q R   N   + + Y +A   Y   L++L         + T  E++    + VK   N+A   +KL +   A+     VL  +P N KAL+R G+ L   GE+ +A ++ K A K  P  K I   +     R++E    Q ++AK
Sbjct:  100 IGEGDVNQALEECVLSMQMGEITLLLADSQYAYGLLGREPDIPAWAPTLYQLQLLDIRDK-----------PDPLTLPIADRIRIGNQKRERGNFHFQREEYSLAAMAYCVALEVLTTRSTDGGHVGTKAEDQEVQEYRVKCLNNLATTQMKLEQFNEALHTSRDVLTLEPNNVKALFRAGKLLSDKGEYKEAMEVLKKALKLEPATKAIHAELSKLVKRQSEGKDTQQWKAK 321          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Planmine SMEST
Match: SMESG000078014.1 (SMESG000078014.1)

HSP 1 Score: 899.812 bits (2324), Expect = 0.000e+0
Identity = 454/455 (99.78%), Postives = 454/455 (99.78%), Query Frame = 3
Query:   54 MSTDVSFKFDIEDEKDRMLERKYITELMEQEESKLYNSNDSEETDSFFNGEGYQLLLKECGLSLPFDNNAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMINIKENXXXXXXXXXXDLTSDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLFNEKDGIIRKK 1418
            MSTDVSFKFDIEDEKDRMLERKYITELMEQEESKLYNSNDSEETDSFFNGEGYQLLLKECGLSLPFDNNAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFK ANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMINIKENVVPAAPVAAPDLTSDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLFNEKDGIIRKK
Sbjct:    1 MSTDVSFKFDIEDEKDRMLERKYITELMEQEESKLYNSNDSEETDSFFNGEGYQLLLKECGLSLPFDNNAVDVEESDSTPFVKYKDLTIKMIDISDDSKLIFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKLANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNMINIKENVVPAAPVAAPDLTSDLAIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLFNEKDGIIRKK 455          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Planmine SMEST
Match: SMESG000042680.1 (SMESG000042680.1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.196e-14
Identity = 72/287 (25.09%), Postives = 129/287 (44.95%), Query Frame = 3
Query:  351 LIFKRLISKGEG--SKIPIGSLVIYNYKFYH--EDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMP----LATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNM 1187
            L+ K++I  G G  ++   G  V   YK ++  E+ IE  +ST          +G G ++   D+ +    + E      D+   +G  G  P++     +   ++++   +      F  +   +R++ +    +K     R   N   R + Y +A+N Y R + I+   P     +TD  +   +   VK+  N+A   LKL    + I+ CNT+L    +N KAL+RKG+ L + G +D+A  + K A   L N+K I   I+    LK+ D E +  + + M
Sbjct:  210 LLTKKIIVYGLGRETRPTHGDSVTIQYKGWNSSEELIEENESTFV--------LGDGDMIQAFDLGICLAERHEEFELRTDARFAYGSYGWEPKVQPNEPLVYRIKLLRVDDSPDYTTFTHQ---DRMDAAD---VK-----RERGNYLYRREEYSLAVNSYSRAIKIIQTDPDYKRASTDPSKADMYDLFVKVTNNLAAAQLKLESYDNVIETCNTILNYDASNVKALFRKGKSLTMKGNYDEAIPILKRA-LELENSKLIAGEIQRCYQLKRADDEQRARVCRKM 476          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Planmine SMEST
Match: SMESG000042680.1 (SMESG000042680.1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.271e-14
Identity = 72/287 (25.09%), Postives = 129/287 (44.95%), Query Frame = 3
Query:  351 LIFKRLISKGEG--SKIPIGSLVIYNYKFYH--EDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRYGIALNKYLRGLDILYAMP----LATDEEEKIRWGHVVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENEDLKQQDYEAKKLLAQNM 1187
            L+ K++I  G G  ++   G  V   YK ++  E+ IE  +ST          +G G ++   D+ +    + E      D+   +G  G  P++     +   ++++   +      F  +   +R++ +    +K     R   N   R + Y +A+N Y R + I+   P     +TD  +   +   VK+  N+A   LKL    + I+ CNT+L    +N KAL+RKG+ L + G +D+A  + K A   L N+K I   I+    LK+ D E +  + + M
Sbjct:  210 LLTKKIIVYGLGRETRPTHGDSVTIQYKGWNSSEELIEENESTFV--------LGDGDMIQAFDLGICLAERHEEFELRTDARFAYGSYGWEPKVQPNEPLVYRIKLLRVDDSPDYTTFTHQ---DRMDAAD---VK-----RERGNYLYRREEYSLAVNSYSRAIKIIQTDPDYKRASTDPSKADMYDLFVKVTNNLAAAQLKLESYDNVIETCNTILNYDASNVKALFRKGKSLTMKGNYDEAIPILKRA-LELENSKLIAGEIQRCYQLKRADDEQRARVCRKM 476          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Planmine SMEST
Match: SMESG000026974.1 (SMESG000026974.1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.490e-9
Identity = 27/93 (29.03%), Postives = 49/93 (52.69%), Query Frame = 3
Query:  402 GSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVGVGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEVEVIDFTEKN 680
            G ++  +Y     D    FDS+  +  P +  +G GQ++ G D+ +Q MC  E+      S + +G+ G PP+IP  A +  EVE++   +++
Sbjct:   50 GDMIHMHYTGTLYDDGSKFDSSLDRGDPLKFTLGTGQVIKGWDLGIQGMCVGEKRKLFIPSHLGYGDNGSPPKIPPKATLVFEVELMKIEKRS 142          
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Planmine SMEST
Match: SMESG000033379.1 (SMESG000033379.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.305e-8
Identity = 31/94 (32.98%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  897 VVKLYLNMAHCNLKLNRGPSAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNNKDILDAIRENED--LKQQDYEAKKL 1172
            +  + LN++ C LK+N     I+ C+T++   P   KALYR+G+    IG+ D+A    K A++  P+N +IL    E +    +  DY A K+
Sbjct:  148 ITNILLNISACQLKVNSFNFVIENCSTIIQAYPQCVKALYRRGKAFFHIGKLDEALVDLKMAHELNPSNTEILKDFNEVKTSLTRYSDYMADKM 241          
The following BLAST results are available for this feature:
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FKBP63.823e-2928.42FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HG... [more]
FKBP64.687e-2929.43FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HG... [more]
FKBP61.670e-2428.40FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HG... [more]
FKBP62.300e-2030.17FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HG... [more]
FKBP65.115e-1826.24FKBP prolyl isomerase 6 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkb-61.421e-929.82Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-61.421e-929.82Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-32.745e-734.92Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-32.745e-734.92Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
fkb-28.058e-730.88Peptidylprolyl isomerase [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shu1.828e-2426.23gene:FBgn0003401 transcript:FBtr0072237[more]
Fkbp591.640e-926.61gene:FBgn0029174 transcript:FBtr0079872[more]
Fkbp591.640e-926.61gene:FBgn0029174 transcript:FBtr0342837[more]
zda4.298e-924.46gene:FBgn0034368 transcript:FBtr0345424[more]
zda4.298e-924.46gene:FBgn0034368 transcript:FBtr0086661[more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp61.289e-2828.00FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp61.789e-2727.64FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp63.062e-2027.51FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp84.581e-1934.43FKBP prolyl isomerase 8 [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkbp41.204e-1629.49FKBP prolyl isomerase 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp68.089e-3330.34FKBP prolyl isomerase 6 [Source:NCBI gene;Acc:3946... [more]
adam331.719e-1629.00ADAM metallopeptidase domain 33 [Source:Xenbase;Ac... [more]
adam331.838e-1629.00ADAM metallopeptidase domain 33 [Source:Xenbase;Ac... [more]
adam332.088e-1629.00ADAM metallopeptidase domain 33 [Source:Xenbase;Ac... [more]
adam332.265e-1629.00ADAM metallopeptidase domain 33 [Source:Xenbase;Ac... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fkbp61.121e-3231.48FK506 binding protein 6 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp61.121e-3231.48FK506 binding protein 6 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp61.330e-3231.48FK506 binding protein 6 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp61.889e-1835.88FK506 binding protein 6 [Source:MGI Symbol;Acc:MGI... [more]
Fkbp41.392e-1530.12FK506 binding protein 4 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QQ71|FKBP6_BOVIN8.252e-3328.32Inactive peptidyl-prolyl cis-trans isomerase FKBP6... [more]
sp|F6PHZ6|FKBP6_HORSE4.261e-3229.63Inactive peptidyl-prolyl cis-trans isomerase FKBP6... [more]
sp|Q91XW8|FKBP6_MOUSE9.300e-3231.48Inactive peptidyl-prolyl cis-trans isomerase FKBP6... [more]
sp|D3ZQF4|FKBP6_RAT8.165e-3130.37Inactive peptidyl-prolyl cis-trans isomerase FKBP6... [more]
sp|O75344|FKBP6_HUMAN2.251e-2829.43Inactive peptidyl-prolyl cis-trans isomerase FKBP6... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIC60.000e+0100.00Peptidylprolyl isomerase (Fragment) OS=Schmidtea m... [more]
A0A2L2YF893.786e-4731.17Peptidylprolyl isomerase OS=Parasteatoda tepidario... [more]
A0A1S3J4U11.346e-4534.53Peptidylprolyl isomerase OS=Lingula unguis OX=7574... [more]
A0A1S3J5B11.807e-4534.53Peptidylprolyl isomerase OS=Lingula unguis OX=7574... [more]
T2MIQ42.613e-4530.62Peptidylprolyl isomerase OS=Hydra vulgaris OX=6087... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp61.428e-2928.13FKBP prolyl isomerase 6 [Source:NCBI gene;Acc:1030... [more]
fkbp81.143e-1833.01FKBP prolyl isomerase 8 [Source:NCBI gene;Acc:1030... [more]
fkbp81.663e-1833.01FKBP prolyl isomerase 8 [Source:NCBI gene;Acc:1030... [more]
fkbp169.297e-1528.41FKBP prolyl isomerase 16 [Source:ZFIN;Acc:ZDB-GENE... [more]
fkbp42.689e-1327.46FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fkbp61.640e-3730.21FKBP prolyl isomerase 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000004854.18.341e-1135.23pep scaffold:Pmarinus_7.0:GL501075:9618:21951:-1 g... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
FPR23.445e-937.14Membrane-bound peptidyl-prolyl cis-trans isomerase... [more]
FPR11.311e-729.29Peptidyl-prolyl cis-trans isomerase (PPIase); bind... [more]
CPR65.215e-728.51Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441763.066e-4532.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432074.159e-1124.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402828.523e-1138.27Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO417473.220e-926.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412951.385e-623.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkbp61.343e-2727.06FKBP prolyl isomerase 6 [Source:NCBI gene;Acc:1011... [more]
fkbp43.237e-1527.55FKBP prolyl isomerase 4 [Source:NCBI gene;Acc:1011... [more]
fkbp89.153e-1530.40FKBP prolyl isomerase 8 [Source:NCBI gene;Acc:1011... [more]
fkbp81.087e-1431.40FKBP prolyl isomerase 8 [Source:NCBI gene;Acc:1011... [more]
fkbp161.887e-1126.18peptidyl-prolyl cis-trans isomerase FKBP8-like [So... [more]
back to top
BLAST of peptidyl prolyl cis trans isomerase FKBP-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078014.10.000e+099.78SMESG000078014.1[more]
SMESG000042680.14.196e-1425.09SMESG000042680.1[more]
SMESG000042680.14.271e-1425.09SMESG000042680.1[more]
SMESG000026974.14.490e-929.03SMESG000026974.1[more]
SMESG000033379.11.305e-832.98SMESG000033379.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029676
GenBankAFJ24780.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029676 ID=SMED30029676|Name=peptidyl prolyl cis trans isomerase FKBP-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1455bp
ATTTATTTCGTTAACTTTAAAGTTGTTTAAATCTAGCAAATTTGAATCCT
AAAATGTCAACTGATGTTTCTTTTAAATTTGATATTGAAGATGAAAAAGA
CCGTATGTTGGAAAGAAAGTATATTACTGAGTTAATGGAACAAGAAGAGA
GCAAACTATATAATTCTAATGATTCTGAAGAGACTGATAGTTTTTTTAAT
GGAGAAGGATATCAATTACTACTTAAAGAGTGTGGCCTGTCACTACCTTT
TGATAATAATGCAGTTGACGTTGAGGAATCTGATTCTACTCCATTTGTCA
AGTACAAAGATTTGACTATTAAAATGATAGACATTAGTGATGATTCGAAA
CTTATTTTTAAAAGACTCATATCCAAGGGAGAGGGTTCGAAAATACCCAT
TGGATCTTTGGTGATCTATAATTATAAATTCTATCATGAAGATCAAATAG
AACCATTTGATAGTACTAGATTTAAAAGGCATCCTGATCGGCAAAGAGTT
GGAGTTGGCCAATTGTTAACTGGACTTGATATTGCTTTACAATCAATGTG
TAAAAAAGAAAGAGCTAATTTTGTTTTCGATTCTTCAGTTATGTTTGGAG
AATTAGGGGTTCCTCCAAGAATTCCAGGAGGGGCTGATATTTATGCCGAA
GTGGAAGTAATTGATTTTACCGAAAAAAATCTTATTGATGAATTTTTTGA
AAAATCTATCGATGAAAGACTTGAATTGTCTTTCGATGAAATTATTAAAT
TAGTTGTTCAATGTCGAAATGATGCCAATGCTGCTGTTCGAAACAAACGC
TACGGGATTGCACTTAATAAATATTTAAGAGGATTAGATATATTATATGC
AATGCCGTTAGCGACGGACGAAGAGGAGAAAATCCGATGGGGTCATGTTG
TGAAATTATATTTGAATATGGCTCACTGTAATTTGAAATTAAACCGTGGC
CCATCTGCAATCAAATGCTGCAATACGGTACTCGCGAAACAGCCGGCCAA
TGCTAAAGCTCTCTATCGAAAAGGAAGAGGCCTCATGATTATTGGTGAAT
TTGACGACGCCGCGAAATTATTTAAGTCGGCAAACAAGCATCTGCCAAAC
AATAAAGACATTCTTGACGCTATTAGGGAAAATGAAGACCTAAAGCAGCA
GGATTACGAAGCCAAAAAATTGCTTGCCCAGAATATGATCAATATTAAAG
AAAATGTTGTCCCAGCAGCTCCAGTGGCAGCGCCTGACTTGACTTCTGAT
CTTGCGATTGATCTGAGAAATCAAATTAGAGATTTTACGGACTCGGAAGG
AACCAGAATCCTTTCAAATTTGAAAGGATTATCGAAAAATGAAATAGATA
TTGTGAAAGCGCTTTGTAATCAATTTAATCTGCTCTTCAACGAGAAAGAT
GGCATTATTAGGAAGAAATAAATAGTGGACGATTTTTGCATTTAAAATTG
TGGCA
back to top

protein sequence of SMED30029676-orf-1

>SMED30029676-orf-1 ID=SMED30029676-orf-1|Name=SMED30029676-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=456bp
MSTDVSFKFDIEDEKDRMLERKYITELMEQEESKLYNSNDSEETDSFFNG
EGYQLLLKECGLSLPFDNNAVDVEESDSTPFVKYKDLTIKMIDISDDSKL
IFKRLISKGEGSKIPIGSLVIYNYKFYHEDQIEPFDSTRFKRHPDRQRVG
VGQLLTGLDIALQSMCKKERANFVFDSSVMFGELGVPPRIPGGADIYAEV
EVIDFTEKNLIDEFFEKSIDERLELSFDEIIKLVVQCRNDANAAVRNKRY
GIALNKYLRGLDILYAMPLATDEEEKIRWGHVVKLYLNMAHCNLKLNRGP
SAIKCCNTVLAKQPANAKALYRKGRGLMIIGEFDDAAKLFKSANKHLPNN
KDILDAIRENEDLKQQDYEAKKLLAQNMINIKENVVPAAPVAAPDLTSDL
AIDLRNQIRDFTDSEGTRILSNLKGLSKNEIDIVKALCNQFNLLFNEKDG
IIRKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0034587piRNA metabolic process
GO:0006457protein folding
GO:0000413protein peptidyl-prolyl isomerization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR042282FKBP6/shu
IPR019734TPR_repeat
IPR001179PPIase_FKBP_dom
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 283..316
e-value: 0.0085
score: 25.3
coord: 317..350
e-value: 0.37
score: 19.9
coord: 234..267
e-value: 500.0
score: 0.0
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 283..316
score: 5.576
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 317..350
score: 8.378
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 228..385
e-value: 4.5E-28
score: 99.9
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 232..377
IPR001179FKBP-type peptidyl-prolyl cis-trans isomerase domainPFAMPF00254FKBP_Ccoord: 116..203
e-value: 8.6E-9
score: 35.6
IPR001179FKBP-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50059FKBP_PPIASEcoord: 117..206
score: 14.818
NoneNo IPR availableGENE3DG3DSA:3.10.50.40coord: 75..206
e-value: 2.5E-23
score: 84.4
NoneNo IPR availableSUPERFAMILYSSF54534FKBP-likecoord: 88..209
IPR042282Inactive peptidyl-prolyl cis-trans isomerase FKBP6/shutdownPANTHERPTHR46674FAMILY NOT NAMEDcoord: 67..383
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 283..350
score: 12.595