Adenylate kinase isoenzyme 5

Overview
NameAdenylate kinase isoenzyme 5
Smed IDSMED30029668
Uniprot Best hitAdenylate kinase isoenzyme 5 OS=Mus musculus OX=10090 GN=Ak5 PE=1 SV=2 (E=3.69921e-49)
Length (bp)2795
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenylate kinase isoenzyme 5 (SMED30029668) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenylate kinase isoenzyme 5 (SMED30029668) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenylate kinase isoenzyme 5 (SMED30029668) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenylate kinase isoenzyme 5 (SMED30029668) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029668

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029668SMESG000020486.1 SMESG000020480.1 SmedASXL_001795SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029668SMESG000020486.1 SMESG000020480.1 dd_Smed_v4_5119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30029668SMESG000020486.1 SMESG000020480.1 dd_Smed_v4_5119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029668SMESG000020486.1 SMESG000020480.1 dd_Smed_v4_5119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029668SMESG000020486.1 SMESG000020480.1 dd_Smed_v4_5119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30029668SMESG000020486.1 SMESG000020480.1 dd_Smed_v4_5119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029668SMESG000020486.1 SMESG000020480.1 dd_Smed_v6_5119_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029668SMESG000020486.1 SMESG000020480.1 dd_Smed_v4_5119_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30029668SMESG000020486.1 SMESG000020480.1 dd_Smed_v4_5119_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Human
Match: AK5 (adenylate kinase 5 [Source:HGNC Symbol;Acc:HGNC:365])

HSP 1 Score: 183.341 bits (464), Expect = 1.901e-48
Identity = 139/559 (24.87%), Postives = 258/559 (46.15%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIH---EVHSTCKDLEVDDANVPESSIQNDEILEK----ERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDP---DIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSD 1679
            AK+YL++ EIPQLFE L+ GLM  +P D + YL+ CL+K+K+  G + V WD F+  +K  LPP+     + +F              R + LP I    ++ D + S                    I+++ GGPG+GK     +++  +  +  I +G  +R++  + +     KW+ +A++I  G+LAP +  +  + ++L    +++  +IDG+PR   + L FE  I    L  V+ + C  +  ++ LL +   +   D +  A  +R+ N+K N   + KYF E G +   D   + +  + D+    + ++    E  +   DL+      P   +   EI++     E   D+   + G        +DL +C +I ++GGPGSGK     +L ++Y  + H+   ++LR  +           DI +  D       +V + IV +  LK+ + +     +  +++GYP+   +  +    IG    VI +D   D M  RL +R       +D       R++ +    +P+  YY+ + QL+ +N++
Sbjct:    6 AKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKK--IHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDL--VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLD------PSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKY-GFTHLSTGELLREELASESERSKLIRDIMERGD-------LVPSGIV-LELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAE 544          

HSP 2 Score: 73.1738 bits (178), Expect = 1.213e-12
Identity = 51/211 (24.17%), Postives = 102/211 (48.34%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN--------INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIE-SITSTLLKNSNNSA 1754
            P+  +IL++GGPGSGK   ++++ +RY  + +I + ++LR+ +            +   N   S I + +           I  +K++L  + D  + I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D    ++ R+  FK N  PL +Y+ E+  +   ++DRD   V  +I  ++ + L  N   +A
Sbjct:  130 PRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKKI-----------HSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPD-EEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAA 327          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Human
Match: AK5 (adenylate kinase 5 [Source:HGNC Symbol;Acc:HGNC:365])

HSP 1 Score: 152.525 bits (384), Expect = 2.899e-38
Identity = 123/535 (22.99%), Postives = 239/535 (44.67%), Query Frame = 3
Query:  204 MYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIH---EVHSTCKDLEVDDANVPESSIQNDEILEK----ERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSD 1679
            M  +P D + YL+ CL+K+K+  G + V WD F+  +K  LPP+     + +F              R + LP I    ++ D + S                    I+++ GGPG+GK     +++  +  +  I +G  +R++  + +     KW+ +A++I  G+LAP +  +  + ++L    +++  +IDG+PR   + L FE  I    L  V+ + C  +  ++ LL +   +   D +  A  +R+ N+K N   + KYF E G +   D   + +  + D+    + ++    E  +   DL+      P   +   EI++     E   D+   + G        +DL +C +I ++GGPGSGK     +L ++Y  + H+   ++LR  +         I    +  +    +V + IV +  LK+ + +     +  +++GYP+   +  +    IG    VI +D   D M  RL +R       +D       R++ +    +P+  YY+ + QL+ +N++
Sbjct:    1 MCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKK--IHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDL--VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLD------PSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKY-GFTHLSTGELLREELASESERSKLIRDIMERGD----LVPSGIV-LELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAE 518          

HSP 2 Score: 75.0998 bits (183), Expect = 3.007e-13
Identity = 55/179 (30.73%), Postives = 92/179 (51.40%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKE--LNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESE 947
            I+ I GGPG+GK   C +L  ++  +  +  G  +RE   L ++  +SK   + +++  GDL P   VLE L+KE  + +  + + FLIDGYPR  ++  +F R IG  +L  VI +DC  +     LL +  +    D +   I+KR+  Y   ++ V  Y++   +L  I+     E
Sbjct:  352 IIFIIGGPGSGKGTQCEKLVEKY-GFTHLSTGELLRE--ELASESERSKL--IRDIMERGDLVPSGIVLE-LLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQL--VICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPE 522          

HSP 3 Score: 73.1738 bits (178), Expect = 1.155e-12
Identity = 51/211 (24.17%), Postives = 102/211 (48.34%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN--------INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIE-SITSTLLKNSNNSA 1754
            P+  +IL++GGPGSGK   ++++ +RY  + +I + ++LR+ +            +   N   S I + +           I  +K++L  + D  + I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D    ++ R+  FK N  PL +Y+ E+  +   ++DRD   V  +I  ++ + L  N   +A
Sbjct:  104 PRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKKI-----------HSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPD-EEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAA 301          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Human
Match: CMPK1 (cytidine/uridine monophosphate kinase 1 [Source:HGNC Symbol;Acc:HGNC:18170])

HSP 1 Score: 90.8929 bits (224), Expect = 9.221e-20
Identity = 58/202 (28.71%), Postives = 103/202 (50.99%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAE-LIHDGDLAPHDFVLETLIKELNN----NSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKE 986
            +V + GGPG GK   C R+  ++  Y  +  G  +R+    E K+  S++  + E  I +G + P +  +  L +E++     N++K  FLIDG+PR +      + L G+NK       + FV+  DC  E+C +  L +  +    D +  ++ KRI  Y  +T  +   ++E+GK+K ID     +  + +V Q+F+KE
Sbjct:   37 VVFVLGGPGAGKGTQCARIVEKYG-YTHLSAGELLRD----ERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQ------DNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKE 227          

HSP 2 Score: 58.9214 bits (141), Expect = 6.951e-9
Identity = 51/196 (26.02%), Postives = 99/196 (50.51%), Query Frame = 3
Query: 1161 LILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIV----NINALKKQL-KSVDDCAQV--IILEGYPKNKIELNDLNTEI-GKID--FVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            ++ +LGGPG+GK     ++ ++Y  + H+   ++LR     +   +PD +Q  +    E +I E  IV     I+ LK+++ +++   AQ    +++G+P+N+  L   N  + GK D  FV+  D   ++   R  ER    G  +D   + E RIQ +  +  P+   Y+E  ++  +++ + +  V DE+  I
Sbjct:   37 VVFVLGGPGAGKGTQCARIVEKY-GYTHLSAGELLR-----DERKNPD-SQYGEL--IEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQI 223          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Human
Match: AK1 (adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:361])

HSP 1 Score: 68.5514 bits (166), Expect = 1.796e-12
Identity = 49/189 (25.93%), Postives = 90/189 (47.62%), Query Frame = 3
Query:  411 SSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETL----IKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            + I+ + GGPG+GK   C ++  ++  Y  +  G  +R     E     ++   ++E++  G L P + VL+ L    + ++N +   K FLIDGYPR  Q+  +FER IG  +   ++ +D   E   Q LL +       D +   I KR+  Y   T  V  ++++ G ++ ++     +  +  V
Sbjct:    8 TKIIFVVGGPGSGKGTQCEKIVQKY-GYTHLSTGDLLRS----EVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTS---KGFLIDGYPREVQQGEEFERRIG--QPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQV 186          

HSP 2 Score: 54.299 bits (129), Expect = 1.386e-7
Identity = 35/191 (18.32%), Postives = 91/191 (47.64%), Query Frame = 3
Query: 1137 KDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEI 1709
            ++ L +  +I ++GGPGSGK     ++ ++Y  + H+   D+LR  +         +++  ++       +  L   ++ L+  + +  + ++  +++GYP+   +  +    IG+   ++ +D+  + M  RL +R    G  +D     + R++ +     P+  +Y++R  +  VN++  +  V  ++
Sbjct:    2 EEKLKKTKIIFVVGGPGSGKGTQCEKIVQKY-GYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQ-----LVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQV 186          

HSP 3 Score: 49.2914 bits (116), Expect = 7.231e-6
Identity = 36/169 (21.30%), Postives = 75/169 (44.38%), Query Frame = 3
Query: 2205 DHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIES-KFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVD--------LIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVID 2684
            + +V KY  + +    L+ +E++S S     L++ +E  +   +  +L +LR  +V  ++ SK  ++ G+P+  +Q   F   +   + ++Y++   ETM  RL    E   T+  VD         ++ +       I       I  K+N  G+++ V +     +D
Sbjct:   26 EKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGE---TSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLD 191          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Human
Match: AK1 (adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:361])

HSP 1 Score: 68.5514 bits (166), Expect = 1.796e-12
Identity = 49/189 (25.93%), Postives = 90/189 (47.62%), Query Frame = 3
Query:  411 SSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETL----IKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            + I+ + GGPG+GK   C ++  ++  Y  +  G  +R     E     ++   ++E++  G L P + VL+ L    + ++N +   K FLIDGYPR  Q+  +FER IG  +   ++ +D   E   Q LL +       D +   I KR+  Y   T  V  ++++ G ++ ++     +  +  V
Sbjct:    8 TKIIFVVGGPGSGKGTQCEKIVQKY-GYTHLSTGDLLRS----EVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTS---KGFLIDGYPREVQQGEEFERRIG--QPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQV 186          

HSP 2 Score: 54.299 bits (129), Expect = 1.386e-7
Identity = 35/191 (18.32%), Postives = 91/191 (47.64%), Query Frame = 3
Query: 1137 KDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEI 1709
            ++ L +  +I ++GGPGSGK     ++ ++Y  + H+   D+LR  +         +++  ++       +  L   ++ L+  + +  + ++  +++GYP+   +  +    IG+   ++ +D+  + M  RL +R    G  +D     + R++ +     P+  +Y++R  +  VN++  +  V  ++
Sbjct:    2 EEKLKKTKIIFVVGGPGSGKGTQCEKIVQKY-GYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQ-----LVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQV 186          

HSP 3 Score: 49.2914 bits (116), Expect = 7.231e-6
Identity = 36/169 (21.30%), Postives = 75/169 (44.38%), Query Frame = 3
Query: 2205 DHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIES-KFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVD--------LIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVID 2684
            + +V KY  + +    L+ +E++S S     L++ +E  +   +  +L +LR  +V  ++ SK  ++ G+P+  +Q   F   +   + ++Y++   ETM  RL    E   T+  VD         ++ +       I       I  K+N  G+++ V +     +D
Sbjct:   26 EKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGE---TSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLD 191          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Celegans
Match: F13E6.2 (pep chromosome:WBcel235:X:10668280:10674293:-1 gene:WBGene00008746.1 transcript:F13E6.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13E6.2)

HSP 1 Score: 100.138 bits (248), Expect = 2.577e-21
Identity = 49/196 (25.00%), Postives = 107/196 (54.59%), Query Frame = 3
Query:  408 NSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKK-SFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIH 992
            N+ ++++ G PG+ K+ I  R++ ++  +  + +G  +R++ N E  D    W+ V++ +++GD  P       L +EL++       ++I+GYP++  + +D E      +    ILIDC E+ C + +  +    +  D  + A+  R+  +K NTL + K  D+ GKL+++DG  + +  +++V Q+ ++ ++
Sbjct:  512 NAPVILVLGAPGSQKNDISRRIAQKYDGFTMLSMGDILRKKINNEKND--EMWDKVSKKMNNGDPIPTKMCRTVLYEELHSRGTSNWGYVIEGYPKSPDQLVDLEH--SLQRTDLAILIDCTEQFCLEVINKRNRENKRSDDDSDAVRSRMEYFKKNTLPMLKTLDDKGKLRVVDGDADPDTVFKEVVQVIDRTLY 703          

HSP 2 Score: 82.0333 bits (201), Expect = 1.211e-15
Identity = 64/240 (26.67%), Postives = 117/240 (48.75%), Query Frame = 3
Query: 1038 VPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPN--WVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN---INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNS 1742
             PE  +  D+  E+E  +  IP +T  A E AR  D+P   +IL +GGPG GKT  A ++     +   VHI M DI+R  + +     P+  +       E +I   LI N   +  LK ++    D A    LEGYP+   ++ D   ++  ++  ++LD +E  ++    E   R G   +I    + +I+ FK   LP  +Y+D++  L+++  ++D   + ++++++    L+  
Sbjct:  134 TPEPRLSLDDSKEEEMVVHRIPSVTRAA-EVARIPDVP---IILFMGGPGGGKTRHAARVADSLADNGLVHICMPDIIRTALGKYKDKYPEWKEAN-----EHYIRGELIPNQLALTLLKAEMGRHPD-AMGFFLEGYPREARQVEDFERQVKSVNMALILDYDERTLR----EHMERRGLGMEI---IDQKIKEFKQKTLPSAKYFDDQKLLHLIPGEKDDQVIYEKMKALVVKALETG 356          

HSP 3 Score: 77.411 bits (189), Expect = 2.686e-14
Identity = 51/185 (27.57%), Postives = 92/185 (49.73%), Query Frame = 3
Query: 1155 CTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEI 1709
              +IL+LG PGS K + + ++ ++Y  +  + M DILR+  + N  +D    + + + N    I   +   +  L ++L S        ++EGYPK+  +L DL   + + D  IL+D  E      +N+R       +D      +R++YFK N LP+ +  D++ +L +V+ D D   V  E+
Sbjct:  513 APVILVLGAPGSQKNDISRRIAQKYDGFTMLSMGDILRK-KINNEKNDEMWDKVSKKMNNGDPIPTKMCRTV--LYEELHSRGTSNWGYVIEGYPKSPDQLVDLEHSLQRTDLAILIDCTEQFCLEVINKRNRENKRSDDDSDAVRSRMEYFKKNTLPMLKTLDDKGKLRVVDGDADPDTVFKEV 694          

HSP 4 Score: 74.7146 bits (182), Expect = 2.254e-13
Identity = 56/233 (24.03%), Postives = 104/233 (44.64%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGL-NIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIH---EVHSTCKDLEVDDANV-----PESSIQNDEILEKERT 1088
            I++  GGPG GK++   R++    +   + + + +I   A  + KD   +W    E    G+L P+   L  L  E+  + +   F ++GYPR  ++  DFER +    +   +++D +E   ++ +       E +      I ++I  +K  TL   KYFD+   L +I G  + ++ Y  +  L  K +     V +    +  D  ++     PES I +  + E E T
Sbjct:  171 IILFMGGPGGGKTRHAARVADSLADNGLVHICMPDIIRTALGKYKDKYPEWKEANEHYIRGELIPNQLALTLLKAEMGRHPDAMGFFLEGYPREARQVEDFERQV--KSVNMALILDYDERTLREHM-------ERRGLGMEIIDQKIKEFKQKTLPSAKYFDDQKLLHLIPGEKDDQVIYEKMKALVVKALETGVPVLAALPPMAADRHHIASPAAPESVIPSPIMAESELT 394          

HSP 5 Score: 63.5438 bits (153), Expect = 6.256e-10
Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKKQGVNAVHWDMFL----ESKKTPLPPIAP 338
            A+ YL  + IPQLFE LMTGL+Y RP D + +L+E + KI+      + WDMF+     ++    PP AP
Sbjct:    7 ARIYLQDHRIPQLFEGLMTGLIYSRPADPLKFLEESIVKIRSTPGITLSWDMFIGPEAGTQGRQYPPGAP 76          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 68.1662 bits (165), Expect = 8.495e-13
Identity = 44/196 (22.45%), Postives = 90/196 (45.92%), Query Frame = 3
Query:  414 SIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFN 980
            ++V + G PG+GK  IC ++      Y  +  G  +R     E  +  +    +   I +G + P +     L   +    + K FL+DG+PR E      + L G+NK       ++FV+ + C   +C +  L++   +   D +  ++ KR+  Y   T  + ++F++ G ++ +      ++ Y DV ++F+
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLRAERQREGSEFGAL---IESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNE------DNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGR--TDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFD 186          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 68.1662 bits (165), Expect = 8.495e-13
Identity = 44/196 (22.45%), Postives = 90/196 (45.92%), Query Frame = 3
Query:  414 SIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFN 980
            ++V + G PG+GK  IC ++      Y  +  G  +R     E  +  +    +   I +G + P +     L   +    + K FL+DG+PR E      + L G+NK       ++FV+ + C   +C +  L++   +   D +  ++ KR+  Y   T  + ++F++ G ++ +      ++ Y DV ++F+
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLRAERQREGSEFGAL---IESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNE------DNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGR--TDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFD 186          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 68.1662 bits (165), Expect = 8.495e-13
Identity = 44/196 (22.45%), Postives = 90/196 (45.92%), Query Frame = 3
Query:  414 SIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFN 980
            ++V + G PG+GK  IC ++      Y  +  G  +R     E  +  +    +   I +G + P +     L   +    + K FL+DG+PR E      + L G+NK       ++FV+ + C   +C +  L++   +   D +  ++ KR+  Y   T  + ++F++ G ++ +      ++ Y DV ++F+
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLRAERQREGSEFGAL---IESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNE------DNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGR--TDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFD 186          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 68.1662 bits (165), Expect = 8.495e-13
Identity = 44/196 (22.45%), Postives = 90/196 (45.92%), Query Frame = 3
Query:  414 SIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFN 980
            ++V + G PG+GK  IC ++      Y  +  G  +R     E  +  +    +   I +G + P +     L   +    + K FL+DG+PR E      + L G+NK       ++FV+ + C   +C +  L++   +   D +  ++ KR+  Y   T  + ++F++ G ++ +      ++ Y DV ++F+
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENL-NYVHLSAGDLLRAERQREGSEFGAL---IESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNE------DNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGR--TDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFD 186          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Fly
Match: CG9541 (gene:FBgn0032083 transcript:FBtr0332206)

HSP 1 Score: 97.4413 bits (241), Expect = 1.684e-20
Identity = 110/480 (22.92%), Postives = 198/480 (41.25%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISK-RIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEV------DDANVPESSIQNDEILEKERTIDEI-----------------------------PELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIV--------NINA-LKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLD-SEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            ++ + GGPG+GK   C     E             R   ++   DL  ++  +   + D        V E L+ E+      K++LI GYPR+ ++ +++   I    +  VILI   + V Q+ +           H  L+++K  + N+  N + V  YFD+   L  ++G    E A  +VY+ F   + ++ ST ++ E       +D +V  +S     +L ++  I+ +                             P+L   A       DLP   +I ++GGPGS K    ++     P W HI +  +LR           +I  +A   N ESF V+  +         ++N  L+  L+ + D   +I+ +GYP+N  ++     +  +   +ILLD S+  + + R+++  S F            R++ F+   LP+ +  D   +L IV+ D D   V  E E +
Sbjct:   70 VIFVLGGPGSGKVTHCDTFMQER------------RGVTHINMMDLLQQY-AMGNDMQDFSQLSSKTVTEVLMLEMKMAPAAKAYLISGYPRSMRDVVEYSEKI--QVVNGVILISWRQSVLQKQI----DYGAKLGHVVLSLAKMELENFFKNVMPVADYFDQSDMLLAVNG----ERAPTEVYKDFRTAVLDILSTLENQEAVMNGVTEDNDVTNASETAGTVLARDLAIERMDGGPNGAVTALKTGTTSADDDSGVVVTQQPKLRQAAGPDESGSDLP--PIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLR-----------NITDSAPRANTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRTGIIV-DGYPRNLQQVKYFENKYKQRPPIILLDCSKLQLGRGRIDDTVSSF----------RRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERL 502          

HSP 2 Score: 72.7886 bits (177), Expect = 8.500e-13
Identity = 55/223 (24.66%), Postives = 104/223 (46.64%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRE------RANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDE 1067
            I+ + GGPG+ K+ +C +     P +A I +G  +R       RAN E+  +K       E +  GD+AP   + + L   L    ++   ++DGYPR  Q+   FE    + +   +IL+DC +    +  +         D +  +  +R+  ++  TL + K  D   +L+I+DG  +S    R+  +L    I  + +   D++ D AN+    ++N++
Sbjct:  329 IIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVK-------EALAAGDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFEN--KYKQRPPIILLDCSKLQLGRGRI---------DDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERLIRNHIQRLLNKTDDID-DSANLGNQMMRNEQ 532          

HSP 3 Score: 57.7658 bits (138), Expect = 4.218e-8
Identity = 43/184 (23.37%), Postives = 90/184 (48.91%), Query Frame = 3
Query: 1137 KDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSK--EDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDR 1682
            K D P+  +I +LGGPGSGK        +      HI+M D+L++  + N +   D +Q + +   E  ++E               +   A+  ++ GYP++  ++ + + +I  ++ VIL+   + V++ +++     +G+K    + S ++  ++ F  N +P+  Y+D+   L  VN +R
Sbjct:   62 KFDPPKVPVIFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLLQQYAMGNDMQ--DFSQLSSKTVTEVLMLE-------------MKMAPAAKAYLISGYPRSMRDVVEYSEKIQVVNGVILISWRQSVLQKQID-----YGAKLGHVVLSLAKMELENFFKNVMPVADYFDQSDMLLAVNGER 225          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Fly
Match: Dak1 (gene:FBgn0028833 transcript:FBtr0084976)

HSP 1 Score: 90.8929 bits (224), Expect = 7.686e-20
Identity = 59/195 (30.26%), Postives = 103/195 (52.82%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNL-AISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLF 977
            IV + GGPG GK   C R+   F ++  +  G  +RE  + E  +     N + + I +G + P + V  +L++     S K  FLIDG+PR  Q+ LD     G+N+        +FV+  DC E+VC +  L +  +   +   NL ++ KRI+ Y +++L + K+F+  G++K ID   ++E  + +V ++F
Sbjct:   65 IVFVLGGPGAGKGTQCSRIVDRF-QFTHLSAGDLLREERSREGSEFG---NLIEDYIRNGKIVPVE-VTCSLLENAMKASGKSRFLIDGFPRN-QDNLD-----GWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEVEKIF 248          

HSP 2 Score: 60.077 bits (144), Expect = 1.922e-9
Identity = 51/198 (25.76%), Postives = 93/198 (46.97%), Query Frame = 3
Query: 1161 LILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNI--------NALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIG-KIDF--VILLDSEEDV-MKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            ++ +LGGPG+GK     ++  R+  + H+   D+LR    + G        +   N  E +I    IV +        NA+K   KS        +++G+P+N+  L+  N ++  K+DF  V+  D  EDV +K  L    S  G  +D   + + RI  +  + LP+ ++++   Q+  +++  D   V  E+E I
Sbjct:   65 IVFVLGGPGAGKGTQCSRIVDRF-QFTHLSAGDLLREERSREG--------SEFGNLIEDYIRNGKIVPVEVTCSLLENAMKASGKSR------FLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEVEKI 247          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Fly
Match: CG9541 (gene:FBgn0032083 transcript:FBtr0332207)

HSP 1 Score: 85.1149 bits (209), Expect = 1.371e-16
Identity = 109/506 (21.54%), Postives = 198/506 (39.13%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISK-RIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRD--------VYQLFNKE------------IHEVHSTCKDLE------------VDDANVPESSIQNDEILEKERTIDEI-----------------------------PELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIV--------NINA-LKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLD-SEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            ++ + GGPG+GK   C     E             R   ++   DL  ++  +   + D        V E L+ E+      K++LI GYPR+ ++ +++   I    +  VILI   + V Q+ +           H  L+++K  + N+  N + V  YFD+   L  ++G       Y+D        +  L N+E            IH++  +   ++             +D +V  +S     +L ++  I+ +                             P+L   A       DLP   +I ++GGPGS K    ++     P W HI +  +LR           +I  +A   N ESF V+  +         ++N  L+  L+ + D   +I+ +GYP+N  ++     +  +   +ILLD S+  + + R+++  S F            R++ F+   LP+ +  D   +L IV+ D D   V  E E +
Sbjct:   70 VIFVLGGPGSGKVTHCDTFMQER------------RGVTHINMMDLLQQY-AMGNDMQDFSQLSSKTVTEVLMLEMKMAPAAKAYLISGYPRSMRDVVEYSEKI--QVVNGVILISWRQSVLQKQI----DYGAKLGHVVLSLAKMELENFFKNVMPVADYFDQSDMLLAVNGERAPTEVYKDFRTAVLDILSTLENQEAVMNGVTGMGRGIHDIPGSIVSVDTAPSQAQQGTQIAEDNDVTNASETAGTVLARDLAIERMDGGPNGAVTALKTGTTSADDDSGVVVTQQPKLRQAAGPDESGSDLP--PIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLR-----------NITDSAPRANTESFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRTGIIV-DGYPRNLQQVKYFENKYKQRPPIILLDCSKLQLGRGRIDDTVSSF----------RRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERL 532          

HSP 2 Score: 72.7886 bits (177), Expect = 9.504e-13
Identity = 55/223 (24.66%), Postives = 104/223 (46.64%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIR------ERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDE 1067
            I+ + GGPG+ K+ +C +     P +A I +G  +R       RAN E+  +K       E +  GD+AP   + + L   L    ++   ++DGYPR  Q+   FE    + +   +IL+DC +    +  +         D +  +  +R+  ++  TL + K  D   +L+I+DG  +S    R+  +L    I  + +   D++ D AN+    ++N++
Sbjct:  359 IIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVK-------EALAAGDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENK--YKQRPPIILLDCSKLQLGRGRI---------DDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERLIRNHIQRLLNKTDDID-DSANLGNQMMRNEQ 562          

HSP 3 Score: 57.7658 bits (138), Expect = 4.012e-8
Identity = 43/184 (23.37%), Postives = 90/184 (48.91%), Query Frame = 3
Query: 1137 KDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSK--EDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDR 1682
            K D P+  +I +LGGPGSGK        +      HI+M D+L++  + N +   D +Q + +   E  ++E               +   A+  ++ GYP++  ++ + + +I  ++ VIL+   + V++ +++     +G+K    + S ++  ++ F  N +P+  Y+D+   L  VN +R
Sbjct:   62 KFDPPKVPVIFVLGGPGSGKVTHCDTFMQERRGVTHINMMDLLQQYAMGNDMQ--DFSQLSSKTVTEVLMLE-------------MKMAPAAKAYLISGYPRSMRDVVEYSEKIQVVNGVILISWRQSVLQKQID-----YGAKLGHVVLSLAKMELENFFKNVMPVADYFDQSDMLLAVNGER 225          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Fly
Match: Adk1 (gene:FBgn0022709 transcript:FBtr0076017)

HSP 1 Score: 58.5362 bits (140), Expect = 2.986e-9
Identity = 45/167 (26.95%), Postives = 74/167 (44.31%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSE--FPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNN-NSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWK--DHSNLAISKRIANYKSNTLAVCKYFD 902
            I+ I GGPG GK   C ++  +  F   ++ DL  N       E      K   +  ++  G L  +D VL  L   +       K FLIDGYPR + + ++FE  I    L   +  +C E+   Q ++++      K  D +   I  R+  +K NT A+ + ++
Sbjct:    6 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRN-------EVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADL--ALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYE 163          

HSP 2 Score: 53.5286 bits (127), Expect = 1.440e-7
Identity = 47/214 (21.96%), Postives = 95/214 (44.39%), Query Frame = 3
Query: 1143 DLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVEN--LIVN---INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNS--ENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDE-IESITSTLLKNSNNSALE 1760
            D+P   +I +LGGPG GK     ++ ++Y  + H+   D+LR           ++A  +D+      ++ +  L+ N   ++ L   +      ++  +++GYP+ K +  +    I   D  +  +  ED M  R+  R +    K D  +      R+  FK N   +   Y+ +     +N++RD+  +  E +++I   L K   N+A +
Sbjct:    3 DIP---IIWILGGPGCGKGTQCAKIVEKY-GFTHLSSGDLLRN----------EVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAERDVDDIFLEVVQAIDCVLKKKQQNAAAQ 200          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Fly
Match: Adk1 (gene:FBgn0022709 transcript:FBtr0076018)

HSP 1 Score: 58.151 bits (139), Expect = 6.016e-9
Identity = 45/167 (26.95%), Postives = 74/167 (44.31%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSE--FPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNN-NSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWK--DHSNLAISKRIANYKSNTLAVCKYFD 902
            I+ I GGPG GK   C ++  +  F   ++ DL  N       E      K   +  ++  G L  +D VL  L   +       K FLIDGYPR + + ++FE  I    L   +  +C E+   Q ++++      K  D +   I  R+  +K NT A+ + ++
Sbjct:   34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRN-------EVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADL--ALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYE 191          

HSP 2 Score: 53.9138 bits (128), Expect = 1.767e-7
Identity = 47/214 (21.96%), Postives = 95/214 (44.39%), Query Frame = 3
Query: 1143 DLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVEN--LIVN---INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNS--ENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDE-IESITSTLLKNSNNSALE 1760
            D+P   +I +LGGPG GK     ++ ++Y  + H+   D+LR           ++A  +D+      ++ +  L+ N   ++ L   +      ++  +++GYP+ K +  +    I   D  +  +  ED M  R+  R +    K D  +      R+  FK N   +   Y+ +     +N++RD+  +  E +++I   L K   N+A +
Sbjct:   31 DIP---IIWILGGPGCGKGTQCAKIVEKY-GFTHLSSGDLLRN----------EVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAERDVDDIFLEVVQAIDCVLKKKQQNAAAQ 228          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Zebrafish
Match: ak5 (adenylate kinase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-8256])

HSP 1 Score: 177.563 bits (449), Expect = 1.151e-46
Identity = 136/511 (26.61%), Postives = 243/511 (47.55%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLF-NKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDIL---RRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWS 1553
            AK+YLS+ EIPQLFE L+TGLMY+RP D + YL+ CL+K++   G + V WD F+  +K  LPP+     + +F              R E LP I    ++ D + S                    +++I GGPG+GK   C +++  +  +  + +G  +R++    A     KW+ +A +I +G+LAP +  +  + +++    E    +IDG+PR   + L FE  +    L  V+ + C  +  ++ L  +   +   D +  AI +R+ N+K N + + KYF E G +  +D   + E  + D+     NK            E+D + + +SS   D   + +   DE       AI  +   +  +  +I ++GGPGSGK   + ++ +RY +   +   DIL    +   + G    D+ +   E  PE  +++ L   + +  +Q K         ++ G+PKN+ +  +   ++G+ D V+LL+   D+M  RL +R +
Sbjct:    6 AKEYLSRREIPQLFESLLTGLMYYRPDDPLEYLETCLKKVRDLGGTDKVRWDTFVGQEKKSLPPLNGGQSRRSFFRNVLPDSPNFPYRRYERLPPINQFSIESDSDLSETAELIEEYEVFDPSRPRPKVILIIGGPGSGKGTQCLKIAERY-GFEYVSVGELLRKKMIHNATS-NRKWSLIARIITNGELAPQETTITEIKQKIMKIPEASGIVIDGFPRDVGQALSFEDQVCTPDL--VVFLACSNQRLKERLEKRAEQQGRPDDNPKAIDRRLTNFKQNAIPLVKYFQEKGLIVTLDADRDEEEVFYDISMTVDNKLFPTKEPVAGPSELDLSLIADSSSLTDVPAKFDEQADEEVAEYAEAIGESFPMETKKSKVIFVIGGPGSGKALQSEKIEERY-SLKRLCPGDILCSELQSHSERGRFLRDLLERG-EQLPEDTLLDLLCEAMASTVRQGKG-------FLVTGFPKNEKQAQEYEAKMGQPDIVLLLECSADIMSRRLQQRAT 503          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Zebrafish
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 144.05 bits (362), Expect = 3.571e-37
Identity = 93/313 (29.71%), Postives = 151/313 (48.24%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPIAPTPKENF----------------RPEPLPEIG---TLHLKIDLNSS------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            AKDYLSK +IP LFE ++TGLMYH+P D + +L+ CL+K +   G   V WD F+   + PLPPI P   +                  R + LP I    ++    D+  S                  I+ I GGPG+GK     +++  + ++  + +G  +R +  L       KW  +A++I +G+LAP +  +E L ++     + K F++DG+PR   +   FE  IG   L  VIL+ C  +  +Q L  +   +   D ++ AI KR+  +K N   + KY+ E G +  +D   E +  + D+
Sbjct:    6 AKDYLSKRQIPHLFESMLTGLMYHKPEDPLAFLEICLQKTRDLGGPECVVWDTFITPDRKPLPPITPAQGKKAPCKLDGGPGPGPGPYRRYDRLPPIQAQFSIESDSDMTESSGLIQEYDVFDPSKPRPHIIFIIGGPGSGKGTQTAKIALRY-DFEHVSVGEILRNQL-LHHAPSDRKWELIAQIIANGELAPQETTIEELKQQFIKKQDAKGFIVDGFPREISQAFTFEEQIGSPDL--VILLACSNQQLRQRLEKRASQQGRPDDNSHAIEKRLDTFKHNINLIAKYYQERGLIVRVDADREEDDIFTDI 314          

HSP 2 Score: 81.6481 bits (200), Expect = 4.501e-16
Identity = 63/213 (29.58%), Postives = 104/213 (48.83%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPD---IAQ--TADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESL 1772
            P+  +I ++GGPGSGK     ++  RY ++ H+ + +ILR  ++ +  SD     IAQ     E  P+   +E L       K+Q     D A+  I++G+P+   +      +IG  D VILL      ++ RL +R S+ G  +D     E R+  FK N   + +YY ER  +  V++DR+   +  +I +I    L  S+ +A   E L
Sbjct:  132 PRPHIIFIIGGPGSGKGTQTAKIALRY-DFEHVSVGEILRNQLLHHAPSDRKWELIAQIIANGELAPQETTIEEL-------KQQFIKKQD-AKGFIVDGFPREISQAFTFEEQIGSPDLVILLACSNQQLRQRLEKRASQQGRPDDNSHAIEKRLDTFKHNINLIAKYYQERGLIVRVDADREEDDIFTDISAIVKERLFPSSTNASGTEDL 335          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 79.337 bits (194), Expect = 4.651e-16
Identity = 60/222 (27.03%), Postives = 101/222 (45.50%), Query Frame = 3
Query:  363 EPLPEIGTLH-LKIDLNSSIVIIQGGPGTGKSQICHRL--SSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKEL----NNNSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKE 986
            E LP +  LH L++ +   +V + GGPG GK   C R+  +  +   +A DL    R R + E   L      +   I +G + P    +  L K +      + +K  FLIDG+PR +      + L G+N        +KFV+  DC  EVC    L +  +    D +  ++ KRI  Y  +T  + + +++ GK++ ID     +  + DV  +  K+
Sbjct:   17 EKLPRV--LHRLRVIMKPQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQL------IDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQ------DNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNILEKD 224          

HSP 2 Score: 71.633 bits (174), Expect = 1.818e-13
Identity = 53/196 (27.04%), Postives = 100/196 (51.02%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLK---SVDDCAQVIILEGYPKNKIELNDLNTEI-GKID--FVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            PQ  ++ +LGGPG+GK     ++ + Y ++ H+   D+LR    +   +D +  Q  D    E  IV  + + IN L+K ++     D+     +++G+P+N+  L   NTE+ GK D  FV+  D   +V   R  ER    G  +D   + E RIQ +  +  P+   Y+++ ++  +++ R +  V  ++++I
Sbjct:   32 PQ--VVFVLGGPGAGKGTQCARIVENY-SYTHLSAGDLLRE---ERSRTDSEFGQLIDSYIKEGKIVP-VQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNI 220          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 78.5666 bits (192), Expect = 7.037e-16
Identity = 60/222 (27.03%), Postives = 101/222 (45.50%), Query Frame = 3
Query:  363 EPLPEIGTLH-LKIDLNSSIVIIQGGPGTGKSQICHRL--SSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKEL----NNNSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKE 986
            E LP +  LH L++ +   +V + GGPG GK   C R+  +  +   +A DL    R R + E   L      +   I +G + P    +  L K +      + +K  FLIDG+PR +      + L G+N        +KFV+  DC  EVC    L +  +    D +  ++ KRI  Y  +T  + + +++ GK++ ID     +  + DV  +  K+
Sbjct:   13 EKLPRV--LHRLRVIMKPQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQL------IDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQ------DNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNILEKD 220          

HSP 2 Score: 72.0182 bits (175), Expect = 1.567e-13
Identity = 53/196 (27.04%), Postives = 100/196 (51.02%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLK---SVDDCAQVIILEGYPKNKIELNDLNTEI-GKID--FVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            PQ  ++ +LGGPG+GK     ++ + Y ++ H+   D+LR    +   +D +  Q  D    E  IV  + + IN L+K ++     D+     +++G+P+N+  L   NTE+ GK D  FV+  D   +V   R  ER    G  +D   + E RIQ +  +  P+   Y+++ ++  +++ R +  V  ++++I
Sbjct:   28 PQ--VVFVLGGPGAGKGTQCARIVENY-SYTHLSAGDLLRE---ERSRTDSEFGQLIDSYIKEGKIVP-VQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNI 216          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 78.5666 bits (192), Expect = 7.647e-16
Identity = 60/222 (27.03%), Postives = 101/222 (45.50%), Query Frame = 3
Query:  363 EPLPEIGTLH-LKIDLNSSIVIIQGGPGTGKSQICHRL--SSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKEL----NNNSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKE 986
            E LP +  LH L++ +   +V + GGPG GK   C R+  +  +   +A DL    R R + E   L      +   I +G + P    +  L K +      + +K  FLIDG+PR +      + L G+N        +KFV+  DC  EVC    L +  +    D +  ++ KRI  Y  +T  + + +++ GK++ ID     +  + DV  +  K+
Sbjct:   11 EKLPRV--LHRLRVIMKPQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQL------IDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQ------DNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNILEKD 218          

HSP 2 Score: 72.0182 bits (175), Expect = 1.374e-13
Identity = 53/196 (27.04%), Postives = 100/196 (51.02%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLK---SVDDCAQVIILEGYPKNKIELNDLNTEI-GKID--FVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            PQ  ++ +LGGPG+GK     ++ + Y ++ H+   D+LR    +   +D +  Q  D    E  IV  + + IN L+K ++     D+     +++G+P+N+  L   NTE+ GK D  FV+  D   +V   R  ER    G  +D   + E RIQ +  +  P+   Y+++ ++  +++ R +  V  ++++I
Sbjct:   26 PQ--VVFVLGGPGAGKGTQCARIVENY-SYTHLSAGDLLRE---ERSRTDSEFGQLIDSYIKEGKIVP-VQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNI 214          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Xenopus
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:100127649])

HSP 1 Score: 162.155 bits (409), Expect = 2.030e-41
Identity = 139/562 (24.73%), Postives = 260/562 (46.26%), Query Frame = 3
Query:  129 TAKSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDL-EVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDD--LPQCTLILLL-GGPGSGKTETAIQLCKRYPNWVHIDMNDILRR---CMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNS-ENRIQYFKTNGLPLCRYYDERCQLNIVNSDR 1682
            T+   K+YL++ EIPQLFE L+ GLMY+RP D ++YL+ CL+K+K+  G   V WD F+   K  LPP+     + +F              R + LP I    ++ D + S                    I+++ GGPG+GK     +++  +  +  I +G  +R++  + +     KW+ +A++I  G+LAP +  +  + ++L    + +  +IDG+PR   + L FE  I    L  V+ + C     ++ L  +   +   D +  AI +R+ N+K N + +  YF E G +   D   E E  + D+    + ++    +   +  E+D + + +S    D  L  E    E+ +  G        DD  L  C   L + GGPGSGK     +L  RY     + ++++L+       +      DI +  D+      +  ++I+ I  +K+ + S    ++  + +G+P+   +  +   +I K + V+ LD   + M  RL +R S+   + DI + +   R++ +     P+  YY+ +  L  +N+++
Sbjct:    2 TSGDPKEYLARREIPQLFEGLLNGLMYYRPDDPVDYLENCLQKVKELGGTEKVRWDTFVGPDKRNLPPLNGGQARRSFFRNVMPDGGNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPSRPHPKIILVIGGPGSGKGTQSLKIAERY-GFEYISVGELLRKK--IHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDSEGIVIDGFPRDVAQALSFEDQICTPDL--VVFLACASHKLKERLQKRAEQQGRPDDNLKAIQRRLMNFKQNAVPLVNYFQEKGLIITFDADREEEEVFCDISAAVDNKLFPAKTPVAEPSELDLSLIIDSGDTCDLELNFEDQRHELMQPFG--------DDCRLRVCNFFLCIKGGPGSGKGTQCEKLAHRY-GLSPLAVSELLQSDLATFTERSKLIKDIMEHGDQ------VPMDIILEI--VKETMSSCLGNSKGFLFDGFPRETKQAEEFECKISKPNIVLYLDCSAETMTSRLQKR-SKASHRNDINTETIRRRLEAYYQAINPIITYYERKSLLYKINAEK 540          

HSP 2 Score: 70.0922 bits (170), Expect = 1.050e-11
Identity = 50/216 (23.15%), Postives = 99/216 (45.83%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN--------INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESL 1772
            P   +IL++GGPGSGK   ++++ +RY  + +I + ++LR+ +            +   N   S I + +           I  +K++L  + D ++ I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D     + R+  FK N +PL  Y+ E+  +   ++DR+   V  +I +     L  +     E   L
Sbjct:  130 PHPKIILVIGGPGSGKGTQSLKIAERY-GFEYISVGELLRKKI-----------HSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPD-SEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACASHKLKERLQKRAEQQGRPDDNLKAIQRRLMNFKQNAVPLVNYFQEKGLIITFDADREEEEVFCDISAAVDNKLFPAKTPVAEPSEL 332          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 134.806 bits (338), Expect = 1.988e-33
Identity = 95/312 (30.45%), Postives = 150/312 (48.08%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI--------------APTPKENFRPEPLPEIGTLHLKIDLNS----------------------SIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            AKDYL+   IP+LFE L+TGLMY+RP D I+Y++ CL+K++   G   V WD FL      LPPI               P P+   R E LP I +    ID +S                       I+ + GGPG+GK     +++S F  +  + +G  +R++    A   + KW  +A++I  GDLAP +  +E L ++  N+ +   F++DG+PR   +   FE  IG   L  VI + C  +  +Q L  +       D +  AI +R++ +K N   + KY+ + G +   D   E +  + D+
Sbjct:    6 AKDYLTDRHIPRLFESLLTGLMYYRPEDPISYMEMCLQKVRDIGGPEKVQWDTFLSRN---LPPINGGQGKKTPHRAEGLPAPQMR-RYERLPPIQS-QFSIDSDSDMTESSGLIQEYDVFDPNRERPKIIFVIGGPGSGKGTQSTKMASHF-GFICVSVGDILRKQLIHHASSDR-KWELIAQIISKGDLAPPETTIEELKQQFINHQDATGFVVDGFPRDIGQAFTFEEQIGSPDL--VIFLACSSQRLRQRLERRASLHGRPDDNAHAIDRRLSTFKQNLPLIVKYYQDKGLIARFDADREEDSIFEDI 308          

HSP 2 Score: 62.3882 bits (150), Expect = 1.626e-9
Identity = 56/211 (26.54%), Postives = 100/211 (47.39%), Query Frame = 3
Query: 1161 LILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSD------PDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPL-CRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESL 1772
            +I ++GGPGSGK   + ++   +  ++ + + DILR+ ++ +  SD        I    D   PE+ I E        LK+Q  +  D A   +++G+P++  +      +IG  D VI L      ++ RL  R S  G  +D     + R+  FK N LPL  +YY ++  +   ++DR+   + ++I      LL   N   ++E S+
Sbjct:  130 IIFVIGGPGSGKGTQSTKMASHF-GFICVSVGDILRKQLIHHASSDRKWELIAQIISKGDLAPPETTIEE--------LKQQFINHQD-ATGFVVDGFPRDIGQAFTFEEQIGSPDLVIFLACSSQRLRQRLERRASLHGRPDDNAHAIDRRLSTFKQN-LPLIVKYYQDKGLIARFDADREEDSIFEDICCAVQGLL-FPNGLGVQEFSM 328          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 114.005 bits (284), Expect = 9.444e-26
Identity = 85/298 (28.52%), Postives = 139/298 (46.64%), Query Frame = 3
Query:  183 ECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI--------------APTPKENFRPEPLPEIGTLHLKIDLNS----------------------SIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            + L+TGLMY+RP D I+Y++ CL+K++   G   V WD FL      LPPI               P P+   R E LP I +    ID +S                       I+ + GGPG+GK     +++S F  +  + +G  +R++    A   + KW  +A++I  GDLAP +  +E L ++  N+ +   F++DG+PR   +   FE  IG   L  VI + C  +  +Q L  +       D +  AI +R++ +K N   + KY+ + G +   D   E +  + D+
Sbjct:   18 DSLLTGLMYYRPEDPISYMEMCLQKVRDIGGPEKVQWDTFLSRN---LPPINGGQGKKTPHRAEGLPAPQMR-RYERLPPIQS-QFSIDSDSDMTESSGLIQEYDVFDPNRERPKIIFVIGGPGSGKGTQSTKMASHF-GFICVSVGDILRKQLIHHASSDR-KWELIAQIISKGDLAPPETTIEELKQQFINHQDATGFVVDGFPRDIGQAFTFEEQIGSPDL--VIFLACSSQRLRQRLERRASLHGRPDDNAHAIDRRLSTFKQNLPLIVKYYQDKGLIARFDADREEDSIFEDI 306          

HSP 2 Score: 67.781 bits (164), Expect = 4.399e-11
Identity = 47/181 (25.97%), Postives = 86/181 (47.51%), Query Frame = 3
Query:  426 IQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSE-KKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            +QGGPG+GK   C ++  ++  Y  +  G  +R     E      +  H++ ++  G+L P D VL+ L + +   ++  K +LIDGYPR  ++  +FE+ IG   L  ++ ID   +   + LL +       D +   I KR+  Y   T  V   ++  G ++ I+     +  ++ V
Sbjct:  321 VQGGPGSGKGTQCEKIVHQY-GYTHLSTGDLLRA----EVSSGSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSL--LLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFKQV 494          

HSP 3 Score: 61.6178 bits (148), Expect = 3.956e-9
Identity = 53/198 (26.77%), Postives = 94/198 (47.47%), Query Frame = 3
Query: 1161 LILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSD------PDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPL-CRYYDERCQLNIVNSDRDIAYVIDEIESITSTLL 1733
            +I ++GGPGSGK   + ++   +  ++ + + DILR+ ++ +  SD        I    D   PE+ I E        LK+Q  +  D A   +++G+P++  +      +IG  D VI L      ++ RL  R S  G  +D     + R+  FK N LPL  +YY ++  +   ++DR+   + ++I      LL
Sbjct:  128 IIFVIGGPGSGKGTQSTKMASHF-GFICVSVGDILRKQLIHHASSDRKWELIAQIISKGDLAPPETTIEE--------LKQQFINHQD-ATGFVVDGFPRDIGQAFTFEEQIGSPDLVIFLACSSQRLRQRLERRASLHGRPDDNAHAIDRRLSTFKQN-LPLIVKYYQDKGLIARFDADREEDSIFEDICCAVQGLL 314          

HSP 4 Score: 55.4546 bits (132), Expect = 3.821e-7
Identity = 39/190 (20.53%), Postives = 86/190 (45.26%), Query Frame = 3
Query: 1176 GGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVEN-----LIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTL 1730
            GGPGSGK     ++  +Y  + H+   D+LR           +++  ++     S I+E      L   ++ LK+ + +  D ++  +++GYP+   +  +   +IG    ++ +D+  D M  RL +R    G  +D  +  + R++ +     P+   Y+ R  +  +N++  +  V  ++ +    L
Sbjct:  323 GGPGSGKGTQCEKIVHQY-GYTHLSTGDLLRA----------EVSSGSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFKQVSTALDAL 501          

HSP 5 Score: 51.9878 bits (123), Expect = 4.307e-6
Identity = 36/164 (21.95%), Postives = 73/164 (44.51%), Query Frame = 3
Query: 2211 LVIKYAMSFIHVDQLISNEINSNSEHADALNQCIE-SKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRL----ENEPEPDFTTNTV-DLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVID 2684
            +V +Y  + +    L+  E++S SE    L+  +E  +   +  +L +L++ ++     SK  ++ G+P+  +Q   F   +   S ++Y++  S+TM  RL    E     D    T+   ++ +       I       I  KIN  G++++V    S  +D
Sbjct:  336 IVHQYGYTHLSTGDLLRAEVSSGSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFKQVSTALD 499          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Xenopus
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:100127649])

HSP 1 Score: 112.849 bits (281), Expect = 1.553e-25
Identity = 95/430 (22.09%), Postives = 203/430 (47.21%), Query Frame = 3
Query:  408 NSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDL-EVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRR---CMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNS-ENRIQYFKTNGLPLCRYYDERCQLNIVNSDR 1682
            +  I+++ GGPG+GK     +++  +  +  I +G  +R++  + +     KW+ +A++I  G+LAP +  +  + ++L    + +  +IDG+PR   + L FE  I    L  V+ + C     ++ L  +   +   D +  AI +R+ N+K N + +  YF E G +   D   E E  + D+    + ++    +   +  E+D + + +S    D  L  E    E+  +     +   +++L +  +I +LGGPGSGK     +L  RY     + ++++L+       +      DI +  D+      +  ++I+ I  +K+ + S    ++  + +G+P+   +  +   +I K + V+ LD   + M  RL +R S+   + DI + +   R++ +     P+  YY+ +  L  +N+++
Sbjct:   48 HPKIILVIGGPGSGKGTQSLKIAERY-GFEYISVGELLRKK--IHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDSEGIVIDGFPRDVAQALSFEDQICTPDL--VVFLACASHKLKERLQKRAEQQGRPDDNLKAIQRRLMNFKQNAVPLVNYFQEKGLIITFDADREEEEVFCDISAAVDNKLFPAKTPVAEPSELDLSLIIDSGDTCDLELNFEDQRHEL--MQPFGDDCRLREELKKAKVIFVLGGPGSGKGTQCEKLAHRY-GLSPLAVSELLQSDLATFTERSKLIKDIMEHGDQ------VPMDIILEI--VKETMSSCLGNSKGFLFDGFPRETKQAEEFECKISKPNIVLYLDCSAETMTSRLQKR-SKASHRNDINTETIRRRLEAYYQAINPIITYYERKSLLYKINAEK 460          

HSP 2 Score: 71.2478 bits (173), Expect = 4.045e-12
Identity = 45/187 (24.06%), Postives = 91/187 (48.66%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN--------INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRD 1685
            P   +IL++GGPGSGK   ++++ +RY  + +I + ++LR+ +            +   N   S I + +           I  +K++L  + D ++ I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D     + R+  FK N +PL  Y+ E+  +   ++DR+
Sbjct:   47 PHPKIILVIGGPGSGKGTQSLKIAERY-GFEYISVGELLRKKI-----------HSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPD-SEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACASHKLKERLQKRAEQQGRPDDNLKAIQRRLMNFKQNAVPLVNYFQEKGLIITFDADRE 220          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Xenopus
Match: ncan (neurocan [Source:Xenbase;Acc:XB-GENE-961217])

HSP 1 Score: 83.9593 bits (206), Expect = 1.622e-17
Identity = 53/196 (27.04%), Postives = 94/196 (47.96%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAE-LIHDGDLAPHDFVLETLIKELNN----NSEKKSFLIDGYPRTEQERLDFERLI-GFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKE 986
            +V + GGPG GK   C R+  ++  Y  +  G  +R+    E K   S++  + E  I DG + P +  +  L + +      +  K  FLIDG+PR E     +ER + G   + FV+  DC+ E C +  L +  +    D +  ++ KRI  Y  +T  +   +++ GK+K +D     +  +  V  +F++E
Sbjct:   28 VVFVLGGPGAGKGTQCERIVQKYG-YTHLSAGDLLRD----ERKKPDSQYGELIESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQSTRPIIDLYEKTGKVKKVDASKSVDEVFTKVQDIFDRE 218          

HSP 2 Score: 58.5362 bits (140), Expect = 6.934e-9
Identity = 52/222 (23.42%), Postives = 106/222 (47.75%), Query Frame = 3
Query: 1083 RTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIV----NINALKK---QLKSVDDCAQVIILEGYPKNKIELNDLNTEI-GKID--FVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            R +  +P ++  +  + R+   P   ++ +LGGPG+GK     ++ ++Y  + H+   D+LR     +    PD +Q  +    ES+I +  IV     I+ L++   Q  ++D      +++G+P+N+  L      + GK D  FV+  D + +    R  ER    G  +D   + E RIQ +  +  P+   Y++  ++  V++ + +  V  +++ I
Sbjct:    4 RLLRTLPRISAASFHSVRQIMKP--FVVFVLGGPGAGKGTQCERIVQKY-GYTHLSAGDLLR-----DERKKPD-SQYGEL--IESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQSTRPIIDLYEKTGKVKKVDASKSVDEVFTKVQDI 214          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Mouse
Match: Ak5 (adenylate kinase 5 [Source:MGI Symbol;Acc:MGI:2677491])

HSP 1 Score: 187.193 bits (474), Expect = 5.288e-50
Identity = 139/557 (24.96%), Postives = 260/557 (46.68%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANV-PESSIQNDEILEKERTIDEIPE----LTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDP---DIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSD 1679
            AK+YL++ +IPQLFE L+ GLM  +P D I YL+ CL+K+K+  G + V WD F+  +K  LPP+     + +F              R + LP I    ++ D + S                    I+++ GGPG+GK     +++  +  +  I +G  +R++  + +     KW+ +A++I +G+LAP +  +  + ++L    +++  +IDG+PR   + L FE  I    L  V+ + C  +  ++ L  +   +   D +  A  +R+ N+K N   + KYF E G +   D   + +  + D+    + ++       K+  +D +++ P       EI++     D   +    + G   E    +DL +C +I L+GGPGSGK     +L ++Y  + H+   ++LR+ +           DI +  D       +V + +V +  LK+ + +     +  +++GYP+   +  +    IG    VI +D   D M  RL +R       ED   +   R++ +    +P+  YY+ + QL  VN++
Sbjct:    6 AKEYLARRDIPQLFESLLNGLMCSKPEDPIEYLETCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKK--IHSASSNRKWSLIAKIITNGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDL--VVFLACANQRLKERLQKRAEQQGRPDDNLKATQRRLVNFKQNAAPLVKYFQEKGLIVTFDADRDEDAVFHDISVAVDSKLF----PNKEAPMDSSDLDPSMMFDAGEIIDTGSDYDNQDDDQLNVFGEDTEGGFMEDLRKCKIIFLMGGPGSGKGTQCEKLAEKY-GFTHLSTGELLRQELTSESERSKLIRDIMERGD-------LVPSGVV-LELLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMTNRLLQRSQSSQRGEDGAKSIAKRLEAYHRASIPVVTYYERKTQLRKVNAE 544          

HSP 2 Score: 78.1814 bits (191), Expect = 2.405e-14
Identity = 52/184 (28.26%), Postives = 92/184 (50.00%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETL----IKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAY 956
            I+ + GGPG+GK   C +L+ ++  +  +  G  +R+    E++  +SK   + +++  GDL P   VLE L    +  L N    K FLIDGYPR  ++  +F R IG   L  VI +DC  +     LL +  + +  +    +I+KR+  Y   ++ V  Y++   +L+ ++     E  +
Sbjct:  378 IIFLMGGPGSGKGTQCEKLAEKY-GFTHLSTGELLRQELTSESE--RSKL--IRDIMERGDLVPSGVVLELLKEAMVASLGNT---KGFLIDGYPREVKQGEEFGRRIGDPHL--VICMDCSADTMTNRLLQRSQSSQRGEDGAKSIAKRLEAYHRASIPVVTYYERKTQLRKVNAEGTPEQVF 551          

HSP 3 Score: 77.0258 bits (188), Expect = 6.033e-14
Identity = 61/237 (25.74%), Postives = 116/237 (48.95%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN---------INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIE-SITSTLLKNS----NNSALEEESLF----LGDDQSKYDD 1805
            P+  +IL++GGPGSGK   ++++ +RY  + +I + ++LR+ +            +A  N   S I + +I N         I  +K++L  + D  + I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D    ++ R+  FK N  PL +Y+ E+  +   ++DRD   V  +I  ++ S L  N     ++S L+   +F    + D  S YD+
Sbjct:  130 PRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKKI-----------HSASSNRKWSLIAK-IITNGELAPQETTITEIKQKLMQIPD-EEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLQKRAEQQGRPDDNLKATQRRLVNFKQNAAPLVKYFQEKGLIVTFDADRDEDAVFHDISVAVDSKLFPNKEAPMDSSDLDPSMMFDAGEIIDTGSDYDN 352          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Mouse
Match: Cmpk1 (cytidine monophosphate (UMP-CMP) kinase 1 [Source:MGI Symbol;Acc:MGI:1913838])

HSP 1 Score: 89.7373 bits (221), Expect = 1.278e-19
Identity = 65/234 (27.78%), Postives = 112/234 (47.86%), Query Frame = 3
Query:  321 LPPIAPTPKENFRPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAE-LIHDGDLAPHDFVLETLIKELNN----NSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKE 986
            L P  P      R  PL      HL   +   +V + GGPG GK   C R+  ++  Y  +  G  +R+    E K+  S++  + E  I +G + P +  +  L +E++     N++K  FLIDG+PR +      + L G+NK       + FV+  DC  E+C +  L +  +    D +  ++ KRI  Y  +T  +   ++E+GK+K ID     +  + +V ++F+KE
Sbjct:   13 LVPSCPPLTRTLRLFPL------HL---MKPLVVFVLGGPGAGKGTQCARIVEKY-GYTHLSAGELLRD----ERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQ------DNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDASKSVDEVFGEVVKIFDKE 226          

HSP 2 Score: 56.6102 bits (135), Expect = 2.789e-8
Identity = 50/196 (25.51%), Postives = 98/196 (50.00%), Query Frame = 3
Query: 1161 LILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIV----NINALKKQL-KSVDDCAQV--IILEGYPKNKIELNDLNTEI-GKID--FVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            ++ +LGGPG+GK     ++ ++Y  + H+   ++LR     +   +PD +Q  +    E +I E  IV     I+ LK+++ +++   AQ    +++G+P+N+  L   N  + GK D  FV+  D   ++   R  ER    G  +D   + E RIQ +  +  P+   Y+E  ++  +++ + +  V  E+  I
Sbjct:   36 VVFVLGGPGAGKGTQCARIVEKY-GYTHLSAGELLR-----DERKNPD-SQYGELI--EKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDASKSVDEVFGEVVKI 222          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Mouse
Match: Gm17949 (predicted gene, 17949 [Source:MGI Symbol;Acc:MGI:5010134])

HSP 1 Score: 73.9442 bits (180), Expect = 2.463e-14
Identity = 44/163 (26.99%), Postives = 82/163 (50.31%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDE 905
            I+ + GGPG GK   C  ++ ++  Y  ++LG  +RE    EA+    +   + +++  G L P   +L+ +   L +  + + FLIDG+PR  ++  +FER++G      VI+ DC  E   + +L +   +   D S  AI KR+  + +    V  ++ +
Sbjct:   28 IIFVVGGPGCGKGTQCRNMALKYGFYH-VELGQLLRE----EAQRSTQRGRQIRDIMQKGLLVPTGLILDMISDNLLSYPKIRGFLIDGFPRELEQAKEFERIVG-RAPNMVIVFDCSMETMVRRVLRRGQVEHRADDSEPAIRKRLETHYTLCEPVLTFYQQ 184          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Mouse
Match: Ak5 (adenylate kinase 5 [Source:MGI Symbol;Acc:MGI:2677491])

HSP 1 Score: 71.633 bits (174), Expect = 1.205e-13
Identity = 52/170 (30.59%), Postives = 86/170 (50.59%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKE--LNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLK 920
            I+ + GGPG+GK   C +L+ +   Y    L      R  L ++  +SK   + +++  GDL P   VLE L+KE  + +    K FLIDGYPR  ++  +F R IG   L  VI +DC  +     LL +  + +  +    +I+KR+  Y   ++ V  Y++   +L+
Sbjct:   37 IIFLMGGPGSGKGTQCEKLAEK---YGFTHLSTGELLRQELTSESERSKL--IRDIMERGDLVPSGVVLE-LLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGDPHL--VICMDCSADTMTNRLLQRSQSSQRGEDGAKSIAKRLEAYHRASIPVVTYYERKTQLR 198          

HSP 2 Score: 65.0846 bits (157), Expect = 2.081e-11
Identity = 43/176 (24.43%), Postives = 80/176 (45.45%), Query Frame = 3
Query: 1140 DDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENN--PESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQL 1661
            +DL +C +I L+GGPGSGK     +L ++Y  + H+   ++LR+ +         I    +  +  P   ++E        LK+ + +     +  +++GYP+   +  +    IG    VI +D   D M  RL +R       ED   +   R++ +    +P+  YY+ + QL
Sbjct:   30 EDLRKCKIIFLMGGPGSGKGTQCEKLAEKY-GFTHLSTGELLRQELTSESERSKLIRDIMERGDLVPSGVVLE-------LLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMTNRLLQRSQSSQRGEDGAKSIAKRLEAYHRASIPVVTYYERKTQL 197          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Mouse
Match: Ak1 (adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:87977])

HSP 1 Score: 65.855 bits (159), Expect = 1.631e-11
Identity = 47/186 (25.27%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  411 SSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKE-LNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            + I+ + GGPG+GK   C ++  ++  Y  +  G  +R     E      +   ++ ++  G+L P D VL+ L    L        FLIDGYPR  ++  +FE+ IG  +   ++ +D   E   Q LL +       D +   I KR+  Y + T  V  ++D+ G ++ ++     +  + +V
Sbjct:   24 AKIIFVVGGPGSGKGTQCEKIVQKY-GYTHLSTGDLLRA----EVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIG--QPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEV 202          

HSP 2 Score: 60.8474 bits (146), Expect = 8.351e-10
Identity = 45/209 (21.53%), Postives = 98/209 (46.89%), Query Frame = 3
Query: 1125 ETARK--DDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVEN-----LIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTL 1730
            E  RK  + L +  +I ++GGPGSGK     ++ ++Y  + H+   D+LR           +++  ++     S I+E      L   ++ L+  + +  D +   +++GYP+   +  +   +IG+   ++ +D+  + M  RL +R    G  +D     + R++ +     P+  +YD+R  +  VN++  +  V  E+ +   +L
Sbjct:   12 EGGRKTGEKLKKAKIIFVVGGPGSGKGTQCEKIVQKY-GYTHLSTGDLLR----------AEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSL 209          

HSP 3 Score: 48.9062 bits (115), Expect = 9.624e-6
Identity = 36/169 (21.30%), Postives = 74/169 (43.79%), Query Frame = 3
Query: 2205 DHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIES-KFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVD--------LIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVID 2684
            + +V KY  + +    L+  E++S SE    L+  +E  +   +  +L +LR  ++  +  S   ++ G+P+  +Q   F   +   + ++Y++  +ETM  RL    E   T+  VD         ++ + +     I       I  K+N  GT++ V +     +D
Sbjct:   42 EKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGE---TSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLD 207          
BLAST of Adenylate kinase isoenzyme 5 vs. UniProt
Match: sp|Q920P5|KAD5_MOUSE (Adenylate kinase isoenzyme 5 OS=Mus musculus OX=10090 GN=Ak5 PE=1 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 3.699e-49
Identity = 139/557 (24.96%), Postives = 260/557 (46.68%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANV-PESSIQNDEILEKERTIDEIPE----LTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDP---DIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSD 1679
            AK+YL++ +IPQLFE L+ GLM  +P D I YL+ CL+K+K+  G + V WD F+  +K  LPP+     + +F              R + LP I    ++ D + S                    I+++ GGPG+GK     +++  +  +  I +G  +R++  + +     KW+ +A++I +G+LAP +  +  + ++L    +++  +IDG+PR   + L FE  I    L  V+ + C  +  ++ L  +   +   D +  A  +R+ N+K N   + KYF E G +   D   + +  + D+    + ++       K+  +D +++ P       EI++     D   +    + G   E    +DL +C +I L+GGPGSGK     +L ++Y  + H+   ++LR+ +           DI +  D       +V + +V +  LK+ + +     +  +++GYP+   +  +    IG    VI +D   D M  RL +R       ED   +   R++ +    +P+  YY+ + QL  VN++
Sbjct:    6 AKEYLARRDIPQLFESLLNGLMCSKPEDPIEYLETCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKK--IHSASSNRKWSLIAKIITNGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDL--VVFLACANQRLKERLQKRAEQQGRPDDNLKATQRRLVNFKQNAAPLVKYFQEKGLIVTFDADRDEDAVFHDISVAVDSKLF----PNKEAPMDSSDLDPSMMFDAGEIIDTGSDYDNQDDDQLNVFGEDTEGGFMEDLRKCKIIFLMGGPGSGKGTQCEKLAEKY-GFTHLSTGELLRQELTSESERSKLIRDIMERGD-------LVPSGVV-LELLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMTNRLLQRSQSSQRGEDGAKSIAKRLEAYHRASIPVVTYYERKTQLRKVNAE 544          

HSP 2 Score: 78.1814 bits (191), Expect = 1.683e-13
Identity = 52/184 (28.26%), Postives = 92/184 (50.00%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETL----IKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAY 956
            I+ + GGPG+GK   C +L+ ++  +  +  G  +R+    E++  +SK   + +++  GDL P   VLE L    +  L N    K FLIDGYPR  ++  +F R IG   L  VI +DC  +     LL +  + +  +    +I+KR+  Y   ++ V  Y++   +L+ ++     E  +
Sbjct:  378 IIFLMGGPGSGKGTQCEKLAEKY-GFTHLSTGELLRQELTSESE--RSKL--IRDIMERGDLVPSGVVLELLKEAMVASLGNT---KGFLIDGYPREVKQGEEFGRRIGDPHL--VICMDCSADTMTNRLLQRSQSSQRGEDGAKSIAKRLEAYHRASIPVVTYYERKTQLRKVNAEGTPEQVF 551          

HSP 3 Score: 77.0258 bits (188), Expect = 4.220e-13
Identity = 61/237 (25.74%), Postives = 116/237 (48.95%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN---------INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIE-SITSTLLKNS----NNSALEEESLF----LGDDQSKYDD 1805
            P+  +IL++GGPGSGK   ++++ +RY  + +I + ++LR+ +            +A  N   S I + +I N         I  +K++L  + D  + I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D    ++ R+  FK N  PL +Y+ E+  +   ++DRD   V  +I  ++ S L  N     ++S L+   +F    + D  S YD+
Sbjct:  130 PRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKKI-----------HSASSNRKWSLIAK-IITNGELAPQETTITEIKQKLMQIPD-EEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLQKRAEQQGRPDDNLKATQRRLVNFKQNAAPLVKYFQEKGLIVTFDADRDEDAVFHDISVAVDSKLFPNKEAPMDSSDLDPSMMFDAGEIIDTGSDYDN 352          
BLAST of Adenylate kinase isoenzyme 5 vs. UniProt
Match: sp|A4IFD0|KAD5_BOVIN (Adenylate kinase isoenzyme 5 OS=Bos taurus OX=9913 GN=Ak5 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 9.044e-48
Identity = 141/564 (25.00%), Postives = 259/564 (45.92%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEI---HEVHSTCKDLEVDDANVPESSIQNDEILEK----ERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDP--------DIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSD 1679
            AK+YL++ EIPQLFE L+ GLM  +P D + YL+ CL+K+K+  G + V WD F+  +K  LPP+     + +F              R + LP I    ++ D + S                    I+++ GGPG+GK     +++  +  +  I +G  +R++  + +     KW+ +A++I  G+LAP +  +  + ++L    ++   +IDG+PR   + L FE  I    L  V+ + C  +  ++ LL +   +   D +  A  +R+ N+K N   + KYF E G +   D   + +  + D+    + ++    E  +   DL+      P   +   E+++     E   D+   + G        +DL +C +I ++GGPGSGK     +L ++Y  + H+  +++L     QN LS          DI +   E  P   I+E        LK+ + +     +  +++GYP+   +  +    IG    VI +D   D M  RL +R       +D  +    R++ +    +P+  YY+ + QL+ +N++
Sbjct:    6 AKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKK--IHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQMPDEVGIVIDGFPRDVAQALSFEDQICTPDL--VVFLACTNQRLKERLLKRAEQQGRPDDNLKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDSKLFPNKEAAAGSSDLD------PSMMLDTGEVIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLKKCKIIFMIGGPGSGKGTQCGKLAEKY-GFTHLSTDELL-----QNELSSESGRSKLIRDIMERG-ELVPSGIILE-------LLKEAMVASLSNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMTNRLLQRSRNSPQADDNTTTIAKRLETYYRASIPVVAYYETKTQLHKINAE 544          

HSP 2 Score: 75.485 bits (184), Expect = 1.013e-12
Identity = 54/182 (29.67%), Postives = 90/182 (49.45%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKE--LNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAY 956
            I+ + GGPG+GK   C +L+ +   Y    L  +   +  L ++  +SK   + +++  G+L P   +LE L+KE  + + S  K FLIDGYPR  ++  +F R IG   L  VI +DC  +     LL +  N    D +   I+KR+  Y   ++ V  Y++   +L  I+     E  +
Sbjct:  378 IIFMIGGPGSGKGTQCGKLAEK---YGFTHLSTDELLQNELSSESGRSKL--IRDIMERGELVPSGIILE-LLKEAMVASLSNTKGFLIDGYPREVKQGEEFGRRIGDPHL--VICMDCSADTMTNRLLQRSRNSPQADDNTTTIAKRLETYYRASIPVVAYYETKTQLHKINAEGTPEEVF 551          

HSP 3 Score: 73.1738 bits (178), Expect = 5.577e-12
Identity = 52/211 (24.64%), Postives = 101/211 (47.87%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN--------INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIE-SITSTLLKNSNNSA 1754
            P+  +IL++GGPGSGK   ++++ +RY  + +I + ++LR+ +            +   N   S I + +           I  +K++L  + D   ++I +G+P++  +      +I   D V+ L      +K RL +R  + G  +D    ++ R+  FK N  PL +Y+ E+  +   ++DRD   V  +I  ++ S L  N   +A
Sbjct:  130 PRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKKI-----------HSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQMPDEVGIVI-DGFPRDVAQALSFEDQICTPDLVVFLACTNQRLKERLLKRAEQQGRPDDNLKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDSKLFPNKEAAA 327          

HSP 4 Score: 65.855 bits (159), Expect = 1.182e-9
Identity = 88/349 (25.21%), Postives = 155/349 (44.41%), Query Frame = 3
Query: 1680 RDIAYVI---DEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEE---DTSLALKNENENVENDFIAEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIIXXXXXXXXXXXXXXDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITP---ILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRL----ENEPEPDFTTNTVDLIQEFNDRNS-AFIEEISTMDIFNKINGNGTIEEVLAGASEVID 2684
            RD+A  +   D+I +    +     N  L+E  L   + Q + DD+ KA    +    +      +  +E+GL    + + + +E   D S+A       V++      E      ++ D + ++   EVI+ G   E    + +++ G +        DL    II ++GGPGSGK +    L  KY  + +  D+L+ NE++S S  +  +   +E    ++ P   IL LL++ +V S+S +K  ++ G+P+  +Q   F   +     +I ++  ++TM +RL     N P+ D  T T+    E   R S   +    T    +KIN  GT EEV       ID
Sbjct:  222 RDVAQALSFEDQICTPDLVVFLACTNQRLKERLLKRAEQQGRPDDNLKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMA-------VDSKLFPNKEAAAGSSDL-DPSMMLDTGEVIDTGSDYEDQGDDQLNVFG-EDTMGGFMEDLKKCKIIFMIGGPGSGKGTQCGKLAEKYGFTHLSTDELLQNELSSESGRSKLIRDIMERG--ELVPSGIILELLKEAMVASLSNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMTNRLLQRSRNSPQADDNTTTIAKRLETYYRASIPVVAYYETKTQLHKINAEGTPEEVFLQLCTAID 559          
BLAST of Adenylate kinase isoenzyme 5 vs. UniProt
Match: sp|Q9Y6K8|KAD5_HUMAN (Adenylate kinase isoenzyme 5 OS=Homo sapiens OX=9606 GN=AK5 PE=1 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 9.130e-48
Identity = 139/559 (24.87%), Postives = 258/559 (46.15%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIH---EVHSTCKDLEVDDANVPESSIQNDEILEK----ERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDP---DIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSD 1679
            AK+YL++ EIPQLFE L+ GLM  +P D + YL+ CL+K+K+  G + V WD F+  +K  LPP+     + +F              R + LP I    ++ D + S                    I+++ GGPG+GK     +++  +  +  I +G  +R++  + +     KW+ +A++I  G+LAP +  +  + ++L    +++  +IDG+PR   + L FE  I    L  V+ + C  +  ++ LL +   +   D +  A  +R+ N+K N   + KYF E G +   D   + +  + D+    + ++    E  +   DL+      P   +   EI++     E   D+   + G        +DL +C +I ++GGPGSGK     +L ++Y  + H+   ++LR  +           DI +  D       +V + IV +  LK+ + +     +  +++GYP+   +  +    IG    VI +D   D M  RL +R       +D       R++ +    +P+  YY+ + QL+ +N++
Sbjct:    6 AKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKK--IHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDL--VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLD------PSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKY-GFTHLSTGELLREELASESERSKLIRDIMERGD-------LVPSGIV-LELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAE 544          

HSP 2 Score: 73.1738 bits (178), Expect = 5.824e-12
Identity = 51/211 (24.17%), Postives = 102/211 (48.34%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVN--------INALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIE-SITSTLLKNSNNSA 1754
            P+  +IL++GGPGSGK   ++++ +RY  + +I + ++LR+ +            +   N   S I + +           I  +K++L  + D  + I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D    ++ R+  FK N  PL +Y+ E+  +   ++DRD   V  +I  ++ + L  N   +A
Sbjct:  130 PRPKIILVIGGPGSGKGTQSLKIAERY-GFQYISVGELLRKKI-----------HSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPD-EEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAA 327          
BLAST of Adenylate kinase isoenzyme 5 vs. UniProt
Match: sp|Q5VRN0|KCY1_ORYSJ (UMP-CMP kinase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0109600 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.199e-20
Identity = 58/198 (29.29%), Postives = 109/198 (55.05%), Query Frame = 3
Query:  414 SIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNL-AISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLF----NKEIH 992
            +IV + GGPG+GK   C ++  +F  +  +  G  +RE    EAK    +   +  L+++G L   D +++ L K +  +   K FL+DG+PR E+ R  +E +I     +F++ IDC +E  ++ +L++    + +D  N+  I +R   ++  TL V +Y+++ GKL+ +DG  + +  + DV  +F    N++IH
Sbjct:   20 TIVFVIGGPGSGKGTQCAKIVKQFG-FTHLSAGDLLRE----EAKYDTEQGTMIKNLMNEGKLVSSDLIVKLLFKAMRESGNDK-FLVDGFPRNEENRHAYENIIHIEP-EFLLFIDCSKEEMERRILNR---NQGRDDDNIDTIRRRFDVFQQQTLPVIQYYEKRGKLRKVDGNRQVDEVFEDVKAIFAQLNNQKIH 207          

HSP 2 Score: 59.3066 bits (142), Expect = 2.607e-8
Identity = 45/194 (23.20%), Postives = 96/194 (49.48%), Query Frame = 3
Query: 1152 QCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIG-KIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTL 1730
            + T++ ++GGPGSGK     ++ K++  + H+   D+LR     +      I    +E      +  +LIV +   K   +S +D     +++G+P+N+   +     I  + +F++ +D  ++ M+ R+  R    G  +D       R   F+   LP+ +YY++R +L  V+ +R +  V +++++I + L
Sbjct:   18 KITIVFVIGGPGSGKGTQCAKIVKQF-GFTHLSAGDLLREEAKYDTEQGTMIKNLMNEG---KLVSSDLIVKL-LFKAMRESGNDK---FLVDGFPRNEENRHAYENIIHIEPEFLLFIDCSKEEMERRILNRNQ--GRDDDNIDTIRRRFDVFQQQTLPVIQYYEKRGKLRKVDGNRQVDEVFEDVKAIFAQL 201          
BLAST of Adenylate kinase isoenzyme 5 vs. UniProt
Match: sp|Q29561|KCY_PIG (UMP-CMP kinase OS=Sus scrofa OX=9823 GN=CMPK1 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 6.676e-20
Identity = 58/206 (28.16%), Postives = 104/206 (50.49%), Query Frame = 3
Query:  405 LNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAE-LIHDGDLAPHDFVLETLIKELNN----NSEKKSFLIDGYPRTEQERLDFERLIGFNK-------LKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKE 986
            +   +V + GGPG GK   C R+  ++  Y  +  G  +R+    E K+  S++  + E  I DG + P +  +  L +E++     N++K  FLIDG+PR +      + L G+NK       + FV+  DC  E+C +  L +  +    D +  ++ KRI  Y  +T  +   ++E+GK+K ID     +  + +V ++F+KE
Sbjct:    1 MRPKVVFVLGGPGAGKGTQCARIVEKYG-YTHLSAGELLRD----ERKNPDSQYGELIEKYIKDGKIVPVEITISLLRREMDQTMAANAQKNKFLIDGFPRNQ------DNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVKIFDKE 195          

HSP 2 Score: 56.9954 bits (136), Expect = 1.014e-7
Identity = 49/196 (25.00%), Postives = 99/196 (50.51%), Query Frame = 3
Query: 1161 LILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIV----NINALKKQL-KSVDDCAQV--IILEGYPKNKIELNDLNTEI-GKID--FVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESI 1718
            ++ +LGGPG+GK     ++ ++Y  + H+   ++LR     +   +PD +Q  +    E +I +  IV     I+ L++++ +++   AQ    +++G+P+N+  L   N  + GK D  FV+  D   ++   R  ER    G  +D   + E RIQ +  +  P+   Y+E  ++  +++ + +  V DE+  I
Sbjct:    5 VVFVLGGPGAGKGTQCARIVEKY-GYTHLSAGELLR-----DERKNPD-SQYGEL--IEKYIKDGKIVPVEITISLLRREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVKI 191          
BLAST of Adenylate kinase isoenzyme 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|21507661 (tr|A0A074ZDL2|A0A074ZDL2_9TREM Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_10351 PE=4 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 7.094e-116
Identity = 216/586 (36.86%), Postives = 335/586 (57.17%), Query Frame = 3
Query:  102 MQVQQKSVTTAKSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKKQGVNAVHWDMFLESKKTPLPPIA-------PTPKENFRP-------EPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKE-WKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV-----YQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEI-LEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQN--GLSDPD---IAQTADENNP----ESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLK----NSNNSAL 1757
            M+V ++++T A++ K+YLSKN IPQLFECLMTGLMYHRPTDY+NYLQECLEK+K++GV  V WD+FLE++ +P PP+        PT   N           PLP I +L ++I  N+SI+ + GGPG  KS     L + +P +  I +G  +R RA LE +   SKW    E I+ G+L P D V+E+LI  LN +++   F+IDG+PRT+Q+  +F+  I    L  + LID  EE CQQ L+ +  + + WKD+   AI+ RI  +K  TL +CK  D  GKL+++DG  + E   RD+     Y L  K       + K       + P + I +  +    +  +  IP +     +  R +DLP C +ILL GGPGSG++E A  LC+R P   H ++ + LR  ++ +  G S  D   +A+    ++P    +  I E   V ++ L+++  +V +  + +++EG+P ++ +LN  N  IG  D  +LLD EE+ ++ RL +R++R    ED  + + +RI +FK   LP+ R+YDER  L  + +DRD   V++++ ++    L      +NNSA+
Sbjct:    1 MEVMKRTITPAET-KEYLSKNGIPQLFECLMTGLMYHRPTDYLNYLQECLEKVKRKGVTEVRWDLFLENRTSPPPPVVTKRGMTIPTANANSSALNSMSSYMPLPGIDSLKVRIRPNASIICVLGGPGVNKSSYSQGLINHYPTFVHISMGHLLRCRAKLEVERKGSKWTKSVEQINAGELLPQDMVIESLIWHLNQHADASGFIIDGFPRTQQQYEEFKAHINLENLACIFLIDATEEYCQQQLVERGQSDDYWKDYLPAAIANRICMFKLQTLPMCKTIDADGKLRVVDGEIKPEHIARDMRTVCEYVLSGK---VTGPSSKPTPGSVPDRPMTKIGHGMMGCPGQPPVFNIPRIVPAFADNGRVEDLPTCPIILLFGGPGSGRSEQARALCERLPGLKHFNVTEFLRNRVLDHIEGDSQKDWDVVARRVHSSDPPMPKDRIIPEYWNVQVDILRQEFNTVAENTKAVVIEGFPNDETQLNIFNQHIGGADLAVLLDCEENTLQKRLLKRYTRLSRTEDEETVALHRILFFKHCTLPVIRHYDERSTLVTIPADRDQELVLNDVVTVVEYFLGKQECQNNNSAV 582          

HSP 2 Score: 73.9442 bits (180), Expect = 1.400e-9
Identity = 83/320 (25.94%), Postives = 135/320 (42.19%), Query Frame = 3
Query:  321 LPPIAPTPKENFRPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERA--NLEAKDLKSKWNHVAELIHDGDLA-PHDFVL--------ETLIKELNNNSE-KKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV-----YQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRY 1229
            +P I P   +N R E LP              I+++ GGPG+G+S+    L    P     ++   +R R   ++E  D +  W+ VA  +H  D   P D ++        + L +E N  +E  K+ +I+G+P  E +   F + IG   L   +L+DCEE   Q+ LL +       +        RI  +K  TL V +++DE   L  I    + EL   DV     Y L  +E    +S           VP   IQ   + E+ ++ + +  + G   E           +I ++G P SGKT  A +L + +
Sbjct:  350 IPRIVPAFADNGRVEDLP-----------TCPIILLFGGPGSGRSEQARALCERLPGLKHFNVTEFLRNRVLDHIEG-DSQKDWDVVARRVHSSDPPMPKDRIIPEYWNVQVDILRQEFNTVAENTKAVVIEGFPNDETQLNIFNQHIGGADL--AVLLDCEENTLQKRLLKRYTRLSRTEDEETVALHRILFFKHCTLPVIRHYDERSTLVTIPADRDQELVLNDVVTVVEYFLGKQECQNNNSA--------VTVPSHEIQ--PLSEETKSPNGV--VGGHPSEPV---------VIFVVGDPQSGKTTQARKLAEHF 634          
BLAST of Adenylate kinase isoenzyme 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|20420806 (tr|A0A3R7JNZ7|A0A3R7JNZ7_CLOSI Adenylate kinase isoenzyme 5 OS=Clonorchis sinensis OX=79923 GN=Ak5 PE=4 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.878e-113
Identity = 212/574 (36.93%), Postives = 332/574 (57.84%), Query Frame = 3
Query:  102 MQVQQKSVTTAKSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKKQGVNAVHWDMFLESKKTPLPPIAPTPKENFRPE--PLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKE-WKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV-----YQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEI-LEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQN--GLSDPD---IAQTADENNP----ESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLK----NSNNSAL 1757
            M+V + +++ A++ K+YLSKN IPQLFECLMTGLMYHRPTDY+NYLQECLEK+K++GV AV WD+FLE++ +P PP+      N      P+  I +L ++I  N+SI+ + GGPG  KS     L + +P +  I +G  +R RA LE +   SKW    E I+ G+L P + V+E+LI  LN +++   F+IDG+PRT+Q+  +F+  I    L  V LID  EE CQQ L+ +  + + WKD+   AI+ RI  +K  TL +CK  D  GKL+++DG  + E   RD+     Y L  K       + K       + P + I +  +    +  +  IP +T    +  R + LP C +ILL GGPGSG++E A  LC++ P   H ++ + LR  ++ +  G S  D   +A+    ++P    +  I E   V ++ L+++  +V +  + +++EG+P ++ +LN  N  IG  D  ILLD EE+ ++ RL +R++R    ED  + + +RI +FK   LP+ R+YDER  L  + +DRD   V++++ ++    L      +NNSA+
Sbjct:    1 MEVMKHTISPAET-KEYLSKNGIPQLFECLMTGLMYHRPTDYLNYLQECLEKVKRKGVTAVRWDLFLENRTSPPPPVVTKRALNSMSSYVPMSGIDSLKVRIRPNASIICVLGGPGVNKSSYSRGLINHYPTFVHISMGQLLRCRAKLEFERKGSKWTKSVEQINAGELLPQEMVIESLIWHLNQHADASGFIIDGFPRTQQQYEEFKAHINLENLACVFLIDATEEYCQQQLVERGQSDDYWKDYLPAAITNRICMFKLQTLPMCKAIDVDGKLRVVDGEIKPEHIARDMRTVCEYVLSGK---VTGPSSKPTPGSVPDRPMTKIGHGMVGCPGQPPVFNIPRITPAFADNGRVEGLPTCPIILLFGGPGSGRSEQARALCEKLPGLKHFNVTEFLRNRVLDHIEGDSQKDWDVVARRVHSSDPPMPKDRIIPEYWNVQVDILRQEFNTVAENTKAVVIEGFPNDETQLNIFNQHIGGADLAILLDCEENTLQKRLLKRYTRLSRTEDEETVALHRILFFKHCTLPVIRHYDERSTLVTIPADRDQELVLNDVVTVVEYFLGKQECQNNNSAV 570          

HSP 2 Score: 80.4925 bits (197), Expect = 1.275e-11
Identity = 85/322 (26.40%), Postives = 134/322 (41.61%), Query Frame = 3
Query:  321 LPPIAPTPKENFRPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERA--NLEAKDLKSKWNHVAELIHDGDLA-PHDFVL--------ETLIKELNNNSE-KKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV-----YQLFNKEIHEVHSTCKDLEVDDANVPESSIQ--NDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRY 1229
            +P I P   +N R E LP              I+++ GGPG+G+S+    L  + P     ++   +R R   ++E  D +  W+ VA  +H  D   P D ++        + L +E N  +E  K+ +I+G+P  E +   F + IG   L   IL+DCEE   Q+ LL +       +        RI  +K  TL V +++DE   L  I    + EL   DV     Y L  +E    +S           VP   +Q  N EI      + + P                +  +I ++G PGSGKT  A +L + +
Sbjct:  338 IPRITPAFADNGRVEGLP-----------TCPIILLFGGPGSGRSEQARALCEKLPGLKHFNVTEFLRNRVLDHIEG-DSQKDWDVVARRVHSSDPPMPKDRIIPEYWNVQVDILRQEFNTVAENTKAVVIEGFPNDETQLNIFNQHIGGADL--AILLDCEENTLQKRLLKRYTRLSRTEDEETVALHRILFFKHCTLPVIRHYDERSTLVTIPADRDQELVLNDVVTVVEYFLGKQECQNNNSA--------VTVPTHELQPLNGEIKSPNGVVGDHPS---------------EPVVIFVVGDPGSGKTTQARKLAEHF 622          
BLAST of Adenylate kinase isoenzyme 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|22542463 (tr|A0A5J4NBT0|A0A5J4NBT0_9TREM Adenylate kinase OS=Paragonimus westermani OX=34504 GN=DEA37_0002617 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 1.491e-109
Identity = 204/575 (35.48%), Postives = 329/575 (57.22%), Query Frame = 3
Query:   96 YKMQVQQKSVTTAKSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKKQGVNAVHWDMFLESKKTPLPPIAPTPKENF--RPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKE-WKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV-----YQLFNKEIHEVHSTCKDLEVDDANVPESSI--QNDEIL--EKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPD-----IAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLL----KNSNNSAL 1757
            + M V++ ++T  ++ KDYL+KN+IPQLFECLMTGLMYHRP DY+NYLQECLEKIK+QG++ V WD+FLE++ T  P +A     +   + +PLP +     +I  ++S++ + GGPG  ++     L S +P +  + +G  +R R  +EA+   SKW ++ E I+ G+L PH+ V+E+LI  LN +S+   F+IDG+PRT+Q+  + +  +G   L  V LID  E+ C++ L  +  + + WKD    AI  RI  +K  TL +CK  D  GKL+++DG  + E   RD+     Y L  K         +       ++P+  +   N E++    +  +  IP +    ++  R  DL  C +ILL GGPGSG+TE A  LC+R P   H  + + LR+ ++ +   D       +A+    ++P   +++++ V+I  L+++  SV + A+ +I+EG+P +  +LN  N  IG  D  ILLD EE  ++ RL +R++R    ED  + + +RI +FK   LP+ R+YDER  L  +  DRD   V++++ ++    L       NNSA+
Sbjct:    4 FAMDVKKVTMTPTET-KDYLAKNKIPQLFECLMTGLMYHRPADYVNYLQECLEKIKRQGLSGVRWDLFLETRPTSSPTVASNEAADLTSKYDPLPGVDFSKARIRSDASVICVLGGPGINRTSYSQGLISHYPNFVHLCMGDLLRNRTKMEAQREGSKWANLVEQINAGELLPHEIVVESLISSLNQHSQASGFIIDGFPRTQQQYEEMKNQVGLENLACVFLIDTAEDFCRKQLKERGTSDDLWKDQVLKAIDNRICLFKLQTLPMCKCIDADGKLRVVDGEIKPEHIARDMRTVCEYVLSGKITGPATRPVR------GSIPDRPLVKVNQEMMGCPGQPPVFNIPRIVPTFVDKGRVADLHTCPVILLFGGPGSGRTEQAQALCERLPGLKHFSVTEFLRKRVLDHIEDDEQKDWDVVARRVHSSDPP--MIKDVQVDI--LRQEFDSVAEDAKAVIIEGFPNDGNQLNTFNQHIGGADLAILLDCEESTLQKRLLKRYARLSRTEDEETVALHRIIFFKHCTLPVVRHYDERSILVTIPGDRDRELVLNDVVTVAEYFLGKQETQGNNSAV 567          
BLAST of Adenylate kinase isoenzyme 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|19118823 (tr|A0A4E0RMN6|A0A4E0RMN6_FASHE Adenylate kinase isoenzyme 5 OS=Fasciola hepatica OX=6192 GN=D915_007311 PE=4 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 6.203e-106
Identity = 206/561 (36.72%), Postives = 312/561 (55.61%), Query Frame = 3
Query:  120 SVTTAKSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKKQGVNAVHWDMFLESKKTPLPPIAP-TPKENF-RPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKE-WKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQL--FNKEIHEVHSTCKDLEVDDANVPESSIQNDEI-LEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMV----QNGLSDPD-IAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLL----KNSNNSAL 1757
            SV +    K+YL+KN +PQLFECLMTGLMYHRP D++NYLQECLEKIKKQG++ V WD+FLE + +   PI+P    EN  + +PLP I TL +KI  N+SI+ +  GPG  KS+    L + +P +  + +G  +R RA LE +   S+W      I+ G+L PH+ V+E+LI  LN +S+   F+IDG+PRT+++  D +  IG + L  V LID  EE C+  L  +    E WKD++  AI  RI  +K  TL VCK  D  GKL++IDG  + E   RD+  +  F         T +       + P   + +       +  +  IP +     +  R  DL  C +ILL GGPGSG+TE A  LC R     H ++ D LR+ ++    ++   D D +A+    ++P +         ++ ++++ + V + ++ +++EG+P ++ +LN  N  IG  D  ILLD EE  ++ RL  R++R G  ED    S  RI +FK   LP+ R+YDER  L  +  DR+   V++++ ++    L       NNSA+
Sbjct:    6 SVVSPSETKEYLTKNGVPQLFECLMTGLMYHRPADHLNYLQECLEKIKKQGISGVRWDLFLERQHSSPKPISPHKGGENLSKYDPLPGIDTLRVKIRPNTSIICVLAGPGVNKSRYSQGLINHYPTFVHLHMGDLLRNRAKLETQRKSSRWVDSHLKINAGELLPHEMVMESLIWNLNQHSDASGFIIDGFPRTDKQYEDLKSQIGLDSLACVFLIDAAEEFCKFQLKERGQQDEFWKDNTPDAIDNRICLFKLQTLPVCKCIDNDGKLRVIDGEIKPEHIARDMLTVCEFVLSGKVTGPTSRPTPGSIPDRPPDRVSHGMTGCPGQPPVFNIPRIVPQFPDKGRVADLYTCPVILLFGGPGSGRTEQAQALCGRLAGLKHFNVTDFLRQRVLYHIEEDSAKDWDVVARRVHSSDPPN----KRDTQVDIIRQEFEGVANKSRAVVIEGFPNDENQLNTFNQHIGGADLAILLDCEESTLQKRLLSRYTRLGRMEDEDMVSLQRILFFKNCTLPVVRHYDERSILVTIPGDRERDLVLNDLVTVVEYFLSKQESQGNNSAV 562          

HSP 2 Score: 70.0922 bits (170), Expect = 2.201e-8
Identity = 54/221 (24.43%), Postives = 104/221 (47.06%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSK-WNHVAELIHDGDLA-PHDFVLETLIKELNNNSEK-KSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEI 1070
            ++++ GGPG+G+++    L          ++   +R+R     ++  +K W+ VA  +H  D     D  ++ + +E    + K ++ +I+G+P  E +   F + IG   L   IL+DCEE   Q+ LLS+       +  ++   +RI  +K+ TL V +++DE   L  I G  E +L   D+  +    + +  S   +  V     P+  + ND +
Sbjct:  359 VILLFGGPGSGRTEQAQALCGRLAGLKHFNVTDFLRQRVLYHIEEDSAKDWDVVARRVHSSDPPNKRDTQVDIIRQEFEGVANKSRAVVIEGFPNDENQLNTFNQHIGGADL--AILLDCEESTLQKRLLSRYTRLGRMEDEDMVSLQRILFFKNCTLPVVRHYDERSILVTIPGDRERDLVLNDLVTVVEYFLSKQESQGNNSAVTALEHPKECVVNDAL 577          
BLAST of Adenylate kinase isoenzyme 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|18730752 (tr|A0A0X3PXV5|A0A0X3PXV5_SCHSO Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR100940 PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 7.995e-103
Identity = 214/648 (33.02%), Postives = 350/648 (54.01%), Query Frame = 3
Query:  114 QKSVTTAKSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKKQGVNAVHWDMFLESKKTPLPPI-APTPKENF-RPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKD--HSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEK-------ERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRR----CMVQNGLSDPD-IAQTADENNP----ESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLL----KNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDFIAE 1985
            ++ +   K  K+YL+K+EIPQLFECLMTGLMYHRP D + YLQEC+EKIK+QG   V WD+FLE+K++ LPP+ +    E F + EPLP I +L LK+   +S++ I  GPG  KS    ++ + +P +  +++G   +  A +E +   S++ +    I  GD AP + + E LI  LN       F++DGYPRT Q+  D +  +G  +L  V+LID  EE C Q L++     +  D   S   I +R+ N+K+ TL +CK  D+  KL++IDG  + +   R++  +F + +     T      +   +P++ +  +  +E+        R  D I  +T    +  R+  LP+C +++LLGGPGSG+T+ A+ LC   P   H ++ D+LR      +V     D D +A+    + P    +  I E   + ++ L+++   + + A ++I+EGY  ++ ++   N  IG  D ++LLD EE  +  RL++R +R    ED G     RI +FK   LP+ RY+DE  +L IV +DR+   V  ++  +    L    + +NNSA  E  L   ++ S      ++AA  IQA+ RG++ RK++++       +   +N E     ALK+E  N E   I++
Sbjct:    4 KRPIIPPKETKEYLAKHEIPQLFECLMTGLMYHRPVDPLQYLQECIEKIKRQGSQNVRWDLFLETKRSCLPPLTSKRAAEGFSKYEPLPGIDSLRLKMRPQTSVICILAGPGIDKSGFAEKMLTHYPSFIHLNMGDLAKNCARIEERKPSSRFQNAHAFIQAGDFAPEEMIFELLIWNLNQYPASNGFIVDGYPRTFQQYEDLKTHVGLERLAAVVLIDAPEEKCLQRLMNADQMNDPVDMIQSASVIRRRLCNFKNLTLPMCKTIDDDNKLRVIDGDMKDDHIAREMLTIF-EFVLSGKVTGPATRPEPGTIPDAPV--NRTMERIVGCVGNPRAFD-IARITPEFKDCGRRPHLPKCPILVLLGGPGSGRTKQALALCSMIPGIKHFNITDLLRTKVLDSLVGGAQKDWDVVAKRVHSSEPPLEYDRLIPEYWDIQVDILREEFIKLANTATMVIIEGYLNDESQIITFNQNIGGADLIVLLDCEESTLNQRLSKRGARIRRVEDEGHIINQRINFFKQVTLPVVRYFDELGKLVIVPADREADLVTKDLVYLIEYFLAKGRRQANNSAHVEVPLM--ENYSNCVLDKESAAKRIQANFRGYICRKQIQQ-------VGPRQNNE-----ALKSELHNQERQIISD 633          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Cavefish
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:103029093])

HSP 1 Score: 166.392 bits (420), Expect = 4.325e-43
Identity = 142/570 (24.91%), Postives = 269/570 (47.19%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVY-----QLFNKEIHEVHSTCKDLEV--DDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDIL---RRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNER-WSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEI 1709
            AK+YLS+ EIPQLFE L+TGLMY+RP D I+YL+ CL+K+++  G   V WD F+  +K  LPP+     + +F              R + LP I    ++ D + S                    +++I GGPG+GK     +++  +  +  + +G  +R+R    A     KW+ +A++I +G+LAP +  +  + +++    +    +IDG+PR   + L FE  I    L  V+ + C  +  ++ L  +   +   D +  A  +R+AN+K N + + KYF E G +  +D   + E  + D+      +LF  +      +  DL +  D+ +V +   + +E   +E    E  E    ++E  +        +I ++GGPGSGK     ++ ++Y     +   DIL    +   + G    D+ +   E  PE  +++ L  ++ +  +  K         ++ G+P++  +  +   ++GK   V+LL+   D M  RL +R  S   S+E    ++  R+  F +   P+  +Y+ +  L+ +++++    V ++I
Sbjct:    6 AKEYLSRREIPQLFESLLTGLMYYRPDDPIDYLECCLKKVRELGGTEKVRWDTFVGQEKKSLPPLNGGQSRRSFFRNVLPDSPNFPYRRYDRLPPIHQFSIESDSDLSETAELIEEYEVFDPSRPRPKVILIIGGPGSGKGTQSLKIAERY-GFEYVSVGELLRKRMIHNATS-NRKWSLIAKIITNGELAPQETTITEIKQKIMKIPDANGIVIDGFPRDVGQALSFEDQICTPDL--VVFLACSNQRLKERLEKRAEQQGRPDDNPKATERRLANFKQNAVPLVKYFQEKGLIVTLDADRDEEEVFYDISMTVDNKLFPTKEPVAGPSELDLSLLGDNTSVADVPCKFEEQAAEEVGFTEQSE-ESFSVEKKKP------KVIFVIGGPGSGKALQCEKIEEQY-GLKRLCPRDILCSELQSHSERGRFFRDVLERG-EQLPEDTLLDLLCESMESTVRHGKG-------FLVSGFPRDLRQAEEYEAKMGKPCVVLLLECCSDTMSRRLQQRTCSSLRSREARDRDAHRRVDSFCSTITPVIHHYEHKGVLHKIDAEQPPDEVFEQI 555          

HSP 2 Score: 83.5741 bits (205), Expect = 4.309e-16
Identity = 61/230 (26.52%), Postives = 112/230 (48.70%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPD---IAQ--TADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESL---FLGDDQSKYDDSAK 1814
            P+  +IL++GGPGSGK   ++++ +RY  + ++ + ++LR+ M+ N  S+     IA+  T  E  P+          I  +K+++  + D A  I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D    +E R+  FK N +PL +Y+ E+  +  +++DRD   V  +I       L  +         L    LGD+ S  D   K
Sbjct:  130 PRPKVILIIGGPGSGKGTQSLKIAERY-GFEYVSVGELLRKRMIHNATSNRKWSLIAKIITNGELAPQE-------TTITEIKQKIMKIPD-ANGIVIDGFPRDVGQALSFEDQICTPDLVVFLACSNQRLKERLEKRAEQQGRPDDNPKATERRLANFKQNAVPLVKYFQEKGLIVTLDADRDEEEVFYDISMTVDNKLFPTKEPVAGPSELDLSLLGDNTSVADVPCK 350          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Cavefish
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:103029093])

HSP 1 Score: 166.392 bits (420), Expect = 4.325e-43
Identity = 142/570 (24.91%), Postives = 269/570 (47.19%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI-APTPKENF--------------RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVY-----QLFNKEIHEVHSTCKDLEV--DDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDIL---RRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNER-WSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEI 1709
            AK+YLS+ EIPQLFE L+TGLMY+RP D I+YL+ CL+K+++  G   V WD F+  +K  LPP+     + +F              R + LP I    ++ D + S                    +++I GGPG+GK     +++  +  +  + +G  +R+R    A     KW+ +A++I +G+LAP +  +  + +++    +    +IDG+PR   + L FE  I    L  V+ + C  +  ++ L  +   +   D +  A  +R+AN+K N + + KYF E G +  +D   + E  + D+      +LF  +      +  DL +  D+ +V +   + +E   +E    E  E    ++E  +        +I ++GGPGSGK     ++ ++Y     +   DIL    +   + G    D+ +   E  PE  +++ L  ++ +  +  K         ++ G+P++  +  +   ++GK   V+LL+   D M  RL +R  S   S+E    ++  R+  F +   P+  +Y+ +  L+ +++++    V ++I
Sbjct:    6 AKEYLSRREIPQLFESLLTGLMYYRPDDPIDYLECCLKKVRELGGTEKVRWDTFVGQEKKSLPPLNGGQSRRSFFRNVLPDSPNFPYRRYDRLPPIHQFSIESDSDLSETAELIEEYEVFDPSRPRPKVILIIGGPGSGKGTQSLKIAERY-GFEYVSVGELLRKRMIHNATS-NRKWSLIAKIITNGELAPQETTITEIKQKIMKIPDANGIVIDGFPRDVGQALSFEDQICTPDL--VVFLACSNQRLKERLEKRAEQQGRPDDNPKATERRLANFKQNAVPLVKYFQEKGLIVTLDADRDEEEVFYDISMTVDNKLFPTKEPVAGPSELDLSLLGDNTSVADVPCKFEEQAAEEVGFTEQSE-ESFSVEKKKP------KVIFVIGGPGSGKALQCEKIEEQY-GLKRLCPRDILCSELQSHSERGRFFRDVLERG-EQLPEDTLLDLLCESMESTVRHGKG-------FLVSGFPRDLRQAEEYEAKMGKPCVVLLLECCSDTMSRRLQQRTCSSLRSREARDRDAHRRVDSFCSTITPVIHHYEHKGVLHKIDAEQPPDEVFEQI 555          

HSP 2 Score: 83.5741 bits (205), Expect = 4.309e-16
Identity = 61/230 (26.52%), Postives = 112/230 (48.70%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPD---IAQ--TADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESL---FLGDDQSKYDDSAK 1814
            P+  +IL++GGPGSGK   ++++ +RY  + ++ + ++LR+ M+ N  S+     IA+  T  E  P+          I  +K+++  + D A  I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D    +E R+  FK N +PL +Y+ E+  +  +++DRD   V  +I       L  +         L    LGD+ S  D   K
Sbjct:  130 PRPKVILIIGGPGSGKGTQSLKIAERY-GFEYVSVGELLRKRMIHNATSNRKWSLIAKIITNGELAPQE-------TTITEIKQKIMKIPD-ANGIVIDGFPRDVGQALSFEDQICTPDLVVFLACSNQRLKERLEKRAEQQGRPDDNPKATERRLANFKQNAVPLVKYFQEKGLIVTLDADRDEEEVFYDISMTVDNKLFPTKEPVAGPSELDLSLLGDNTSVADVPCK 350          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Cavefish
Match: ak5l (adenylate kinase isoenzyme 5-like [Source:NCBI gene;Acc:103023903])

HSP 1 Score: 149.443 bits (376), Expect = 3.640e-39
Identity = 97/326 (29.75%), Postives = 158/326 (48.47%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI--------------APTPKENFRPEPLPEIG---TLHLKIDLNSS------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVY-----QLFNKEIHE 995
            AK+YLSK +IP LFE ++TGLMYHRP D + +L+ CL+K ++  G  +V WD F+   + PLPPI               P P    R + LP I    ++    D+  S                  I+ + GGPG+GK     ++++ + ++  + +G  +R +  L       KW  +A++I +G+LAP +  +E L  +     + K F++DG+PR   +   FE  IG   L  VIL+ C  +  +Q L  +   +   D +  AI KR+  +K N   + KY+ E G +  +D   E +  + D+      +LF  E+ E
Sbjct:    6 AKEYLSKTQIPHLFESMLTGLMYHRPEDPLGFLENCLQKTRELGGPESVAWDTFIMPDRKPLPPITSGQGKKAPSKIDSGPGPGPYRRYDRLPPIQAQFSIESDSDMTESSGLIQEYDVFDPSKPRPHIIFVIGGPGSGKGTQTAKIAAHY-DFQCVSVGEILRNQL-LHHAPSDRKWELIAQIIANGELAPQETTIEELKHQFIKKQDAKGFIVDGFPREISQAFTFEEQIGSPDL--VILLACSNQQLRQRLEKRASLQGRPDDNTHAIEKRLETFKHNISLIAKYYQERGLIIRVDADREEDGIFTDIKAVVKERLFPNELKE 327          

HSP 2 Score: 72.0182 bits (175), Expect = 4.962e-13
Identity = 56/200 (28.00%), Postives = 96/200 (48.00%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPD---IAQ--TADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLL 1733
            P+  +I ++GGPGSGK     ++   Y ++  + + +ILR  ++ +  SD     IAQ     E  P+   +E L       K Q     D A+  I++G+P+   +      +IG  D VILL      ++ RL +R S  G  +D     E R++ FK N   + +YY ER  +  V++DR+   +  +I+++    L
Sbjct:  130 PRPHIIFVIGGPGSGKGTQTAKIAAHY-DFQCVSVGEILRNQLLHHAPSDRKWELIAQIIANGELAPQETTIEEL-------KHQFIKKQD-AKGFIVDGFPREISQAFTFEEQIGSPDLVILLACSNQQLRQRLEKRASLQGRPDDNTHAIEKRLETFKHNISLIAKYYQERGLIIRVDADREEDGIFTDIKAVVKERL 320          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Cavefish
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:103029093])

HSP 1 Score: 133.65 bits (335), Expect = 1.463e-32
Identity = 88/293 (30.03%), Postives = 148/293 (50.51%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI------------APTPKENF---RPEPLPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELG 911
            AK+YLS+ EIPQLFE L+TGLMY+RP D I+YL+ CL+K+++  G   V WD F+  +K  LPP+              +   NF   R + LP I    ++ D + S                    +++I GGPG+GK     +++  +  +  + +G  +R+R    A     KW+ +A++I +G+LAP +  +  + +++    +    +IDG+PR   + L FE  I    L  V+ + C  +  ++ L  +   +   D +  A  +R+AN+K N + + KYF E G
Sbjct:    6 AKEYLSRREIPQLFESLLTGLMYYRPDDPIDYLECCLKKVRELGGTEKVRWDTFVGQEKKSLPPLNGGQSRRSFFRNGMSNSPNFPYRRYDRLPPIHQFSIESDSDLSETAELIEEYEVFDPSRPRPKVILIIGGPGSGKGTQSLKIAERY-GFEYVSVGELLRKRMIHNATS-NRKWSLIAKIITNGELAPQETTITEIKQKIMKIPDANGIVIDGFPRDVGQALSFEDQICTPDL--VVFLACSNQRLKERLEKRAEQQGRPDDNPKATERRLANFKQNAVPLVKYFQEKG 294          

HSP 2 Score: 77.0258 bits (188), Expect = 3.885e-14
Identity = 48/173 (27.75%), Postives = 92/173 (53.18%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPD---IAQ--TADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDER 1652
            P+  +IL++GGPGSGK   ++++ +RY  + ++ + ++LR+ M+ N  S+     IA+  T  E  P+          I  +K+++  + D A  I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D    +E R+  FK N +PL +Y+ E+
Sbjct:  130 PRPKVILIIGGPGSGKGTQSLKIAERY-GFEYVSVGELLRKRMIHNATSNRKWSLIAKIITNGELAPQE-------TTITEIKQKIMKIPD-ANGIVIDGFPRDVGQALSFEDQICTPDLVVFLACSNQRLKERLEKRAEQQGRPDDNPKATERRLANFKQNAVPLVKYFQEK 293          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Cavefish
Match: ak5l (adenylate kinase isoenzyme 5-like [Source:NCBI gene;Acc:103023903])

HSP 1 Score: 126.716 bits (317), Expect = 4.707e-31
Identity = 87/314 (27.71%), Postives = 147/314 (46.82%), Query Frame = 3
Query:  177 LFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI--------------APTPKENFRPEPLPEIG---TLHLKIDLNSS------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVY-----QLFNKEIHE 995
            L + ++TGLMYHRP D + +L+ CL+K ++  G  +V WD F+   + PLPPI               P P    R + LP I    ++    D+  S                  I+ + GGPG+GK     ++++ + ++  + +G  +R +  L       KW  +A++I +G+LAP +  +E L  +     + K F++DG+PR   +   FE  IG   L  VIL+ C  +  +Q L  +   +   D +  AI KR+  +K N   + KY+ E G +  +D   E +  + D+      +LF  E+ E
Sbjct:   50 LSQSMLTGLMYHRPEDPLGFLENCLQKTRELGGPESVAWDTFIMPDRKPLPPITSGQGKKAPSKIDSGPGPGPYRRYDRLPPIQAQFSIESDSDMTESSGLIQEYDVFDPSKPRPHIIFVIGGPGSGKGTQTAKIAAHY-DFQCVSVGEILRNQL-LHHAPSDRKWELIAQIIANGELAPQETTIEELKHQFIKKQDAKGFIVDGFPREISQAFTFEEQIGSPDL--VILLACSNQQLRQRLEKRASLQGRPDDNTHAIEKRLETFKHNISLIAKYYQERGLIIRVDADREEDGIFTDIKAVVKERLFPNELKE 359          

HSP 2 Score: 71.2478 bits (173), Expect = 1.320e-12
Identity = 56/200 (28.00%), Postives = 96/200 (48.00%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPD---IAQTA--DENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLL 1733
            P+  +I ++GGPGSGK     ++   Y ++  + + +ILR  ++ +  SD     IAQ     E  P+   +E L       K Q     D A+  I++G+P+   +      +IG  D VILL      ++ RL +R S  G  +D     E R++ FK N   + +YY ER  +  V++DR+   +  +I+++    L
Sbjct:  162 PRPHIIFVIGGPGSGKGTQTAKIAAHY-DFQCVSVGEILRNQLLHHAPSDRKWELIAQIIANGELAPQETTIEEL-------KHQFIKKQD-AKGFIVDGFPREISQAFTFEEQIGSPDLVILLACSNQQLRQRLEKRASLQGRPDDNTHAIEKRLETFKHNISLIAKYYQERGLIIRVDADREEDGIFTDIKAVVKERL 352          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Sea Lamprey
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 80.8777 bits (198), Expect = 1.142e-17
Identity = 50/178 (28.09%), Postives = 86/178 (48.31%), Query Frame = 3
Query:  432 GGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            GGPG+GK     +LS  +     + LG  +R+   L+      KW  +A++I  G+LAP +  +  L +    N +   F+IDG+PR   + L FE  +G      VIL+ C  E  +Q L  +       D +  A+ +R+A ++ +T+ + +++ E G L   D   E    + D+
Sbjct:    1 GGPGSGKGTQSRKLSESY-GLVCVSLGEVLRQHV-LQRAPSNRKWRLIAQIISKGELAPQETAIWELKQHFLQNPDAPGFVIDGFPREISQALAFEEQVGAPDA--VILLACASERLRQRLGERADRHGRPDDNPRAVERRLATFRQHTVPLVQHYQERGLLLTFDADREEGELFGDI 174          

HSP 2 Score: 65.855 bits (159), Expect = 2.024e-12
Identity = 56/204 (27.45%), Postives = 98/204 (48.04%), Query Frame = 3
Query: 1176 GGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPD---IAQ--TADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEI-ESITSTLLKNSNNSALEEES 1769
            GGPGSGK   + +L + Y   V + + ++LR+ ++Q   S+     IAQ  +  E  P+          I  LK+      D A   +++G+P+   +      ++G  D VILL    + ++ RL ER  R G  +D     E R+  F+ + +PL ++Y ER  L   ++DR+   +  +I  ++ S L  ++  +A E  S
Sbjct:    1 GGPGSGKGTQSRKLSESY-GLVCVSLGEVLRQHVLQRAPSNRKWRLIAQIISKGELAPQE-------TAIWELKQHFLQNPD-APGFVIDGFPREISQALAFEEQVGAPDAVILLACASERLRQRLGERADRHGRPDDNPRAVERRLATFRQHTVPLVQHYQERGLLLTFDADREEGELFGDIGAAVESRLFCSTTPAAGETRS 195          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Yeast
Match: URA6 (Uridylate kinase; catalyzes the seventh enzymatic step in the de novo biosynthesis of pyrimidines, converting uridine monophosphate (UMP) into uridine-5'-diphosphate (UDP) [Source:SGD;Acc:S000001507])

HSP 1 Score: 80.4925 bits (197), Expect = 1.143e-17
Identity = 54/188 (28.72%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  414 SIVIIQGGPGTGKSQICHRLSSE--FPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNN--SEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV 965
            S++ + GGPG GK   C +L  +  F   +A DL    + RA  +  +L      +   I +G + P +  L  L   +++N  + K  FLIDG+PR   + + FER I   + KF++  DC E++  + LL +       D +  +I KR   +K  ++ V +YF+   K+  +      E  Y+DV
Sbjct:   17 SVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGEL------IKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDI--VESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDV 196          

HSP 2 Score: 68.5514 bits (166), Expect = 1.777e-13
Identity = 48/190 (25.26%), Postives = 89/190 (46.84%), Query Frame = 3
Query: 1152 QCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVE---NLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIE 1712
            Q ++I +LGGPG+GK     +L K Y ++VH+   D+LR    + G +     +       E  IV     L +  NA+   +K+        +++G+P+   +      +I +  F++  D  ED+M  RL ER    G  +D   + + R   FK   +P+  Y++ + ++  V  DR +  V  +++
Sbjct:   15 QVSVIFVLGGPGAGKGTQCEKLVKDY-SFVHLSAGDLLR---AEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKA---NKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQ 197          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Nematostella
Match: EDO38863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK8])

HSP 1 Score: 76.2554 bits (186), Expect = 8.772e-16
Identity = 50/186 (26.88%), Postives = 84/186 (45.16%), Query Frame = 3
Query:  420 VIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLF 977
            +I  GGPG GK  IC  +  ++  Y  +  G  +RE    E      +   + E++ +G L P +  +  L   +  + +   FLIDG+PR   + + FE  +      FV+ ++C EEV Q+ LL +       D +   I KR   +   T+ V +++++  K   ID     E  Y  +  LF
Sbjct:    4 IITLGGPGAGKGTICDSVVKKY-NYCHLSAGDLLRE----EVTRGNERGQMITEMMREGKLVPKEITIGLLQDAMREHKDMPGFLIDGFPRDIDQGITFEEQV--TDSDFVLYLECTEEVMQERLLKRAETSGRPDDNIETIKKRFVTFLEKTVPVVEHYEKQSKAHRIDASRPLEEVYNAISSLF 182          

HSP 2 Score: 60.077 bits (144), Expect = 2.809e-10
Identity = 48/191 (25.13%), Postives = 92/191 (48.17%), Query Frame = 3
Query: 1164 ILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLK 1736
            I+ LGGPG+GK      + K+Y N+ H+   D+LR  + +      +  Q   E   E  +V   I  I  L+  ++   D    +I +G+P++  +      ++   DFV+ L+  E+VM+ RL +R    G  +D     + R   F    +P+  +Y+++ + + +++ R +  V + I S+ + L K
Sbjct:    4 IITLGGPGAGKGTICDSVVKKY-NYCHLSAGDLLREEVTRGN----ERGQMITEMMREGKLVPKEIT-IGLLQDAMREHKDMPGFLI-DGFPRDIDQGITFEEQVTDSDFVLYLECTEEVMQERLLKRAETSGRPDDNIETIKKRFVTFLEKTVPVVEHYEKQSKAHRIDASRPLEEVYNAISSLFAELPK 187          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Nematostella
Match: EDO38864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK9])

HSP 1 Score: 69.707 bits (169), Expect = 9.935e-14
Identity = 45/184 (24.46%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  432 GGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNK 983
            GGPG+GK   C R+  +F  Y     G  +RE  N  ++    +  ++  ++  G+L P+  +LE L   +        FLIDG+PR  ++ L+FE+ +   +L  ++  +C  +  +  LL +       D +   I  R+  + + T+ V +++ E GK+K I      +  ++ V ++  +
Sbjct:    2 GGPGSGKGTQCARIVEKF-GYTHFSTGDLLREEVNSGSE----RGKNIVAMMEKGELVPNGIILELLRLAMVKQPNTTGFLIDGFPRELEQGLEFEKELALCEL--LLYFECSPDTMKARLLKRGETSGRVDDNEETILSRLETFITQTMPVIEHYQEEGKVKKISAEGGPDEVFKKVSRVLEE 178          

HSP 2 Score: 49.6766 bits (117), Expect = 9.545e-7
Identity = 42/168 (25.00%), Postives = 72/168 (42.86%), Query Frame = 3
Query: 2211 LVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITP---ILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEP-----DFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRF 2690
            +V K+  +      L+  E+NS SE    +   +E    ++ P   IL LLR  +V   + +   ++ GFP+  EQ   F  ++AL   ++Y E   +TM++RL    E      D     +  ++ F  +    IE         KI+  G  +EV    S V++  
Sbjct:   15 IVEKFGYTHFSTGDLLREEVNSGSERGKNIVAMMEKG--ELVPNGIILELLRLAMVKQPNTT-GFLIDGFPRELEQGLEFEKELALCELLLYFECSPDTMKARLLKRGETSGRVDDNEETILSRLETFITQTMPVIEHYQEEGKVKKISAEGGPDEVFKKVSRVLEEL 179          

HSP 3 Score: 48.1358 bits (113), Expect = 2.932e-6
Identity = 37/171 (21.64%), Postives = 78/171 (45.61%), Query Frame = 3
Query: 1173 LGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENN--PESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSD 1679
            LGGPGSGK     ++ +++  + H    D+LR  +        +I    ++    P   I+E L +   A+ KQ  +        +++G+P+   +  +   E+   + ++  +   D MK RL +R    G  +D      +R++ F T  +P+  +Y E  ++  ++++
Sbjct:    1 LGGPGSGKGTQCARIVEKF-GYTHFSTGDLLREEVNSGSERGKNIVAMMEKGELVPNGIILELLRL---AMVKQPNTTG-----FLIDGFPRELEQGLEFEKELALCELLLYFECSPDTMKARLLKRGETSGRVDDNEETILSRLETFITQTMPVIEHYQEEGKVKKISAE 162          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Nematostella
Match: EDO36160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH0])

HSP 1 Score: 70.0922 bits (170), Expect = 1.065e-13
Identity = 45/188 (23.94%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  417 IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFE-RLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLF 977
            ++ + GGPG GK   C R+  E+  Y  +  G  +RE     +KD     + +   + +G + P    + +L+++    S+ + FLIDG+PR E     +E R+     +K V+  +C E++C   ++S+  +    D +  ++ KR   ++++T+ + +++   G +K I G    +  +  V ++F
Sbjct:    9 VIFVLGGPGAGKGTQCERIVKEY-GYVHLSAGELLREERRSGSKD----GDLIENCMTEGKIVPVAITV-SLLQKAMAKSDVQKFLIDGFPRNEDNLQGWESRMNDKVDVKAVLFFECPEDICIGRIMSRGQSSGRPDDNIESLRKRFHTHENSTMPIIEHYRRQGLVKPISGAPTPDEVFLQVKRVF 190          

HSP 2 Score: 50.8322 bits (120), Expect = 4.310e-7
Identity = 39/165 (23.64%), Postives = 78/165 (47.27%), Query Frame = 3
Query: 1158 TLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIG-KIDF--VILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYY 1643
             +I +LGGPG+GK     ++ K Y  +VH+   ++LR    ++G  D D+     EN      +  + + ++ L+K +   D   Q  +++G+P+N+  L    + +  K+D   V+  +  ED+   R+  R    G  +D   +   R    + + +P+  +Y
Sbjct:    8 VVIFVLGGPGAGKGTQCERIVKEY-GYVHLSAGELLRE-ERRSGSKDGDLI----ENCMTEGKIVPVAITVSLLQKAMAKSD--VQKFLIDGFPRNEDNLQGWESRMNDKVDVKAVLFFECPEDICIGRIMSRGQSSGRPDDNIESLRKRFHTHENSTMPIIEHY 164          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Nematostella
Match: EDO29897 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV62])

HSP 1 Score: 57.7658 bits (138), Expect = 2.194e-10
Identity = 24/56 (42.86%), Postives = 43/56 (76.79%), Query Frame = 3
Query:  135 KSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKKQGVNAVHWDMFL 302
            + AK Y+++ ++ QLFE ++TGL++++P D +++LQ+CL+K+ K+  N V WD FL
Sbjct:    8 EDAKGYMARKQVYQLFESMLTGLVHNQPEDPVDFLQQCLQKV-KENRNGVKWDSFL 62          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Nematostella
Match: EDO44695 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV62])

HSP 1 Score: 57.7658 bits (138), Expect = 2.194e-10
Identity = 24/56 (42.86%), Postives = 43/56 (76.79%), Query Frame = 3
Query:  135 KSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKKQGVNAVHWDMFL 302
            + AK Y+++ ++ QLFE ++TGL++++P D +++LQ+CL+K+ K+  N V WD FL
Sbjct:    8 EDAKGYMARKQVYQLFESMLTGLVHNQPEDPVDFLQQCLQKV-KENRNGVKWDSFL 62          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Medaka
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:101172192])

HSP 1 Score: 157.147 bits (396), Expect = 6.988e-40
Identity = 134/509 (26.33%), Postives = 237/509 (46.56%), Query Frame = 3
Query:  141 AKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI--APTPKENFR---PEP----------LPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV-YQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELT--GIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDP-----DIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYR 1535
            AK+YL++ EIPQLFE L+TGLMY+RP D I++L+ CL+K ++  G   V WD F+  +K  LPP+    + +  FR   PE           LP I    ++ D + S                    ++++ GGPG+GK     +++  +  +  + +G  +R++    A     KW+ +A++I +G+LAP +  +  + +++    E    +IDG+PR   + L FE  I    L  V+ + C     ++ L  +   +   D +  AI +R+ N+K NT+ + KYF E G +  +D     E  + D+   L NK            E+D   + E+S   D + + +   +E   +   G A    ++   P+  +I ++GGPGSGKT    ++ +R+     + + D+L  C      SD      DI +   E  PE  ++E L   + +  +Q K        +++  +P++  +  +   ++G    VILL    + M  R
Sbjct:    6 AKEYLARREIPQLFESLLTGLMYYRPDDPIDFLESCLKKARELGGPEKVRWDTFVGQEKKSLPPLNGGQSRRSLFRNVLPESPNFPYRRYDRLPPISQFSIESDSDLSETAELIEEYEVFDPCRPRPKVILVIGGPGSGKGTQSLKIAERY-GFQYVSVGELLRKKMIHNATS-NRKWSLIAKIITNGELAPQETTITEIKQKIMKIPEANGIVIDGFPRDVGQALSFEDQICTPDL--VVFLACANHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTLDADRNEEEVFCDISMTLDNKLFSSKEPAAGPSELDLCLLGEASSLADFVWKDDEVEEEEESVYAEGSAESFCKEQKKPK--VIFMMGGPGSGKTLQCERMEERF-GLRRVALGDLL--CSELQSHSDRGRHLLDILERG-EKLPEVALLELLCDAVASSARQGKG-------LVVSSFPRDLSQAQEYEAKMGDPSAVILLTCSPETMSSR 497          

HSP 2 Score: 76.6406 bits (187), Expect = 5.530e-14
Identity = 52/193 (26.94%), Postives = 100/193 (51.81%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADE-NNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDR-------DIAYVID 1703
            P+  +IL++GGPGSGK   ++++ +RY  + ++ + ++LR+ M+ N  S+   +  A    N E    E  I  I   K+++  + + A  I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D     + R+  FK N +PL +Y+ ER  +  +++DR       DI+  +D
Sbjct:  130 PRPKVILVIGGPGSGKGTQSLKIAERY-GFQYVSVGELLRKKMIHNATSNRKWSLIAKIITNGELAPQETTITEI---KQKIMKIPE-ANGIVIDGFPRDVGQALSFEDQICTPDLVVFLACANHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTLDADRNEEEVFCDISMTLD 317          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Medaka
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:101172192])

HSP 1 Score: 130.954 bits (328), Expect = 4.384e-31
Identity = 131/542 (24.17%), Postives = 242/542 (44.65%), Query Frame = 3
Query:  195 TGLMYHRPTDYINYLQECLEKIKK-QGVNAVHWDMFLESKKTPLPPI--APTPKENFR---PEP----------LPEIGTLHLKIDLNSS--------------------IVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDV-YQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELT--GIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDP-----DIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERW---SRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSD 1679
            TGLMY+RP D I++L+ CL+K ++  G   V WD F+  +K  LPP+    + +  FR   PE           LP I    ++ D + S                    ++++ GGPG+GK     +++  +  +  + +G  +R++    A   + KW+ +A++I +G+LAP +  +  + +++    E    +IDG+PR   + L FE  I    L  V+ + C     ++ L  +   +   D +  AI +R+ N+K NT+ + KYF E G +  +D     E  + D+   L NK            E+D   + E+S   D + + +   +E   +   G A    ++   P+  +I ++GGPGSGKT    ++ +R+     + + D+L  C      SD      DI +   E  PE  ++E L   + +  +Q K        +++  +P++  +  +   ++G    VILL    + M  R   R    S   +  D   +   R + F ++   +  YY+ +  L  V+++
Sbjct:   69 TGLMYYRPDDPIDFLESCLKKARELGGPEKVRWDTFVGQEKKSLPPLNGGQSRRSLFRNVLPESPNFPYRRYDRLPPISQFSIESDSDLSETAELIEEYEVFDPCRPRPKVILVIGGPGSGKGTQSLKIAERY-GFQYVSVGELLRKKMIHNATSNR-KWSLIAKIITNGELAPQETTITEIKQKIMKIPEANGIVIDGFPRDVGQALSFEDQICTPDL--VVFLACANHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTLDADRNEEEVFCDISMTLDNKLFSSKEPAAGPSELDLCLLGEASSLADFVWKDDEVEEEEESVYAEGSAESFCKEQKKPK--VIFMMGGPGSGKTLQCERMEERF-GLRRVALGDLL--CSELQSHSDRGRHLLDILERG-EKLPEVALLELLCDAVASSARQGKG-------LVVSSFPRDLSQAQEYEAKMGDPSAVILLTCSPETMSSRSLHRGRSSSSLLASSDTEGSLSRRSESFCSDSQEVTAYYERKKLLYTVDAE 593          

HSP 2 Score: 77.0258 bits (188), Expect = 4.869e-14
Identity = 59/222 (26.58%), Postives = 109/222 (49.10%), Query Frame = 3
Query: 1149 PQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADE-NNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESL---FLGDDQSKYD 1802
            P+  +IL++GGPGSGK   ++++ +RY  + ++ + ++LR+ M+ N  S+   +  A    N E    E  I  I   K+++  + + A  I+++G+P++  +      +I   D V+ L      +K RL +R  + G  +D     + R+  FK N +PL +Y+ ER  +  +++DR+   V  +I       L +S   A     L    LG+  S  D
Sbjct:  175 PRPKVILVIGGPGSGKGTQSLKIAERY-GFQYVSVGELLRKKMIHNATSNRKWSLIAKIITNGELAPQETTITEI---KQKIMKIPE-ANGIVIDGFPRDVGQALSFEDQICTPDLVVFLACANHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTLDADRNEEEVFCDISMTLDNKLFSSKEPAAGPSELDLCLLGEASSLAD 391          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 67.781 bits (164), Expect = 2.103e-12
Identity = 51/188 (27.13%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  408 NSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSE-KKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVY 968
            ++ I+ + GGPG+GK   C R+ +++  Y  +  G  +R     E      +   +  ++  G+L P D VL+ +   +   ++  K FLIDGYPR  ++  +FE+ IG  K   ++ +D + E   + LL +       D +   I KR+  Y   T  V  +++  G +K +D    SEL   +V+
Sbjct:    7 DAKIIFVVGGPGSGKGTQCERIVAKY-GYTHLSSGDLLRA----EVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIG--KPCLLLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVD----SELPVDEVF 183          

HSP 2 Score: 55.8398 bits (133), Expect = 2.093e-8
Identity = 41/202 (20.30%), Postives = 91/202 (45.05%), Query Frame = 3
Query: 1140 DDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVEN-----LIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTL 1730
            D +    +I ++GGPGSGK     ++  +Y  + H+   D+LR           ++A  +D       I++      L   ++ +K  + +  D ++  +++GYP+   +  +   +IGK   ++ +D++ + M  RL +R    G  +D     + R+  +     P+  +Y+ R  +  V+S+  +  V  ++     +L
Sbjct:    3 DKIKDAKIIFVVGGPGSGKGTQCERIVAKY-GYTHLSSGDLLR----------AEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSL 193          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 67.3958 bits (163), Expect = 2.356e-12
Identity = 51/188 (27.13%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  408 NSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSE-KKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVY 968
            ++ I+ + GGPG+GK   C R+ +++  Y  +  G  +R     E      +   +  ++  G+L P D VL+ +   +   ++  K FLIDGYPR  ++  +FE+ IG  K   ++ +D + E   + LL +       D +   I KR+  Y   T  V  +++  G +K +D    SEL   +V+
Sbjct:    7 DAKIIFVVGGPGSGKGTQCERIVAKY-GYTHLSSGDLLRA----EVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIG--KPCLLLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVD----SELPVDEVF 183          

HSP 2 Score: 55.8398 bits (133), Expect = 2.263e-8
Identity = 41/202 (20.30%), Postives = 91/202 (45.05%), Query Frame = 3
Query: 1140 DDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVEN-----LIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTL 1730
            D +    +I ++GGPGSGK     ++  +Y  + H+   D+LR           ++A  +D       I++      L   ++ +K  + +  D ++  +++GYP+   +  +   +IGK   ++ +D++ + M  RL +R    G  +D     + R+  +     P+  +Y+ R  +  V+S+  +  V  ++     +L
Sbjct:    3 DKIKDAKIIFVVGGPGSGKGTQCERIVAKY-GYTHLSSGDLLR----------AEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSL 193          
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 67.0106 bits (162), Expect = 4.063e-12
Identity = 51/188 (27.13%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  408 NSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSE-KKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVY 968
            ++ I+ + GGPG+GK   C R+ +++  Y  +  G  +R     E      +   +  ++  G+L P D VL+ +   +   ++  K FLIDGYPR  ++  +FE+ IG  K   ++ +D + E   + LL +       D +   I KR+  Y   T  V  +++  G +K +D    SEL   +V+
Sbjct:   13 DAKIIFVVGGPGSGKGTQCERIVAKY-GYTHLSSGDLLRA----EVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIG--KPCLLLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVD----SELPVDEVF 189          

HSP 2 Score: 55.8398 bits (133), Expect = 2.347e-8
Identity = 41/203 (20.20%), Postives = 92/203 (45.32%), Query Frame = 3
Query: 1137 KDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVEN-----LIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTL 1730
            +D +    +I ++GGPGSGK     ++  +Y  + H+   D+LR           ++A  +D       I++      L   ++ +K  + +  D ++  +++GYP+   +  +   +IGK   ++ +D++ + M  RL +R    G  +D     + R+  +     P+  +Y+ R  +  V+S+  +  V  ++     +L
Sbjct:    8 QDKIKDAKIIFVVGGPGSGKGTQCERIVAKY-GYTHLSSGDLLR----------AEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSL 199          
BLAST of Adenylate kinase isoenzyme 5 vs. Planmine SMEST
Match: SMESG000020480.1 (SMESG000020480.1)

HSP 1 Score: 1378.62 bits (3567), Expect = 0.000e+0
Identity = 707/746 (94.77%), Postives = 716/746 (95.98%), Query Frame = 3
Query:  486 PEYAAIDL----GLNIRERANLEAKDLKSKWNH-VAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDFIAEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIIXXXXXXXXXXXXXXDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 2708
            PE+ A  +    G+NI E   +   +++   N  VA  I        DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDL+VDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKK LKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDF+AEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE
Sbjct:   30 PEFLATKIYHFTGINIEELLEIHYDNVQGSGNRCVANCI--------DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLKVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDFVAEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 767          

HSP 2 Score: 75.485 bits (184), Expect = 1.321e-13
Identity = 65/246 (26.42%), Postives = 116/246 (47.15%), Query Frame = 3
Query:  276 NAVHWDMFLESKKT--PLPPIAPTPKENFRPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLA-------PHDFVLETLIKELNNNSEKKSF----------LIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAY 956
            +++  D  LE ++T   +P +     E  R + LP+            +++++ GGPG+GK++   +L   +P +  ID+  +I  R              V   + D D+A       P  F++E LI  +N N+ KK            +++GYP+ + E  D    IG  K+ FVIL+D EE+V +  L  +      K+        RI  +K+N L +C+Y+DE  +L I++  ++ ++AY
Sbjct:  214 SSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQ-----------CTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMN-DILRRC------------MVQNGLSDPDIAQTADENNPESFIVENLI--VNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIG--KIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVN--SDRDIAY 429          
BLAST of Adenylate kinase isoenzyme 5 vs. Planmine SMEST
Match: SMESG000020480.1 (SMESG000020480.1)

HSP 1 Score: 1378.23 bits (3566), Expect = 0.000e+0
Identity = 696/699 (99.57%), Postives = 698/699 (99.86%), Query Frame = 3
Query:  612 DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDFIAEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIIXXXXXXXXXXXXXXDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 2708
            DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDL+VDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKK LKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDF+AEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE
Sbjct:   11 DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLKVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDFVAEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 709          

HSP 2 Score: 75.485 bits (184), Expect = 1.258e-13
Identity = 65/246 (26.42%), Postives = 116/246 (47.15%), Query Frame = 3
Query:  276 NAVHWDMFLESKKT--PLPPIAPTPKENFRPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLA-------PHDFVLETLIKELNNNSEKKSF----------LIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAY 956
            +++  D  LE ++T   +P +     E  R + LP+            +++++ GGPG+GK++   +L   +P +  ID+  +I  R              V   + D D+A       P  F++E LI  +N N+ KK            +++GYP+ + E  D    IG  K+ FVIL+D EE+V +  L  +      K+        RI  +K+N L +C+Y+DE  +L I++  ++ ++AY
Sbjct:  156 SSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQ-----------CTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMN-DILRRC------------MVQNGLSDPDIAQTADENNPESFIVENLI--VNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIG--KIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVN--SDRDIAY 371          
BLAST of Adenylate kinase isoenzyme 5 vs. Planmine SMEST
Match: SMESG000020480.1 (SMESG000020480.1)

HSP 1 Score: 1377.84 bits (3565), Expect = 0.000e+0
Identity = 696/699 (99.57%), Postives = 698/699 (99.86%), Query Frame = 3
Query:  612 DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDFIAEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIIXXXXXXXXXXXXXXDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 2708
            DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDL+VDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKK LKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDF+AEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE
Sbjct:   21 DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLKVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAMLEKNENAEEDTSLALKNENENVENDFVAEDENNPLDENIEDENKLIANDEVIEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 719          

HSP 2 Score: 75.485 bits (184), Expect = 1.178e-13
Identity = 65/246 (26.42%), Postives = 116/246 (47.15%), Query Frame = 3
Query:  276 NAVHWDMFLESKKT--PLPPIAPTPKENFRPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLA-------PHDFVLETLIKELNNNSEKKSF----------LIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAY 956
            +++  D  LE ++T   +P +     E  R + LP+            +++++ GGPG+GK++   +L   +P +  ID+  +I  R              V   + D D+A       P  F++E LI  +N N+ KK            +++GYP+ + E  D    IG  K+ FVIL+D EE+V +  L  +      K+        RI  +K+N L +C+Y+DE  +L I++  ++ ++AY
Sbjct:  166 SSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQ-----------CTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMN-DILRRC------------MVQNGLSDPDIAQTADENNPESFIVENLI--VNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIG--KIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVN--SDRDIAY 381          
BLAST of Adenylate kinase isoenzyme 5 vs. Planmine SMEST
Match: SMESG000020480.1 (SMESG000020480.1)

HSP 1 Score: 877.47 bits (2266), Expect = 0.000e+0
Identity = 436/476 (91.60%), Postives = 445/476 (93.49%), Query Frame = 3
Query:  486 PEYAAIDL----GLNIRERANLEAKDLKSKWNH-VAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAM 1898
            PE+ A  +    G+NI E   +   +++   N  VA  I        DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDL+VDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKK LKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLN +
Sbjct:   30 PEFLATKIYHFTGINIEELLEIHYDNVQGSGNRCVANCI--------DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLKVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNGV 497          

HSP 2 Score: 369.007 bits (946), Expect = 3.516e-115
Identity = 199/202 (98.51%), Postives = 200/202 (99.01%), Query Frame = 3
Query: 2103 QGYKGVRTSSQMDLMNANIIXXXXXXXXXXXXXXDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 2708
            +G  GVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE
Sbjct:  492 RGLNGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 693          

HSP 3 Score: 101.293 bits (251), Expect = 1.210e-21
Identity = 111/478 (23.22%), Postives = 212/478 (44.35%), Query Frame = 3
Query:  276 NAVHWDMFLESKKT--PLPPIAPTPKENFRPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLA-------PHDFVLETLIKELNNNSEKKSF----------LIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEV-----------DDANVPESSIQNDEILEKERTIDEIPELTGI-AIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYP-NWVHIDMNDILRRCMVQNGL-SDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYF 1610
            +++  D  LE ++T   +P +     E  R + LP+            +++++ GGPG+GK++   +L   +P +  ID+  +I  R              V   + D D+A       P  F++E LI  +N N+ KK            +++GYP+ + E  D    IG  K+ FVIL+D EE+V +  L  +      K+        RI  +K+N L +C+Y+DE  +L I++   +      ++  + +  +   +++  + E            D A    ++IQ    +    T   + E  G+  + T+ + DL    +ILLLGGPGSGK      L  +Y  +++H+D        ++ N + S+ + A   ++     F  E++   +  L+K L +    ++ I++ G+PK   +      ++  +  +I L+ + + M+ RL         + D  +N+ + IQ F
Sbjct:  214 SSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQ-----------CTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMN-DILRRC------------MVQNGLSDPDIAQTADENNPESFIVENLI--VNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIG--KIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQAS--IRGHLTRKRLKEERGLNGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQ-------LISNEINSNSEHADALNQCIESKF--EDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENE-----PEPDFTTNTVDLIQEF 647          
BLAST of Adenylate kinase isoenzyme 5 vs. Planmine SMEST
Match: SMESG000020480.1 (SMESG000020480.1)

HSP 1 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 425/429 (99.07%), Postives = 427/429 (99.53%), Query Frame = 3
Query:  612 DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAM 1898
            DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDL+VDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKK LKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLN +
Sbjct:   21 DFVLETLIKELNNNSEKKSFLIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLKVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDPDIAQTADENNPESFIVENLIVNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNGV 449          

HSP 2 Score: 369.392 bits (947), Expect = 5.036e-116
Identity = 199/202 (98.51%), Postives = 200/202 (99.01%), Query Frame = 3
Query: 2103 QGYKGVRTSSQMDLMNANIIXXXXXXXXXXXXXXDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 2708
            +G  GVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE
Sbjct:  444 RGLNGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIEEVLAGASEVIDRFSFIHSE 645          

HSP 3 Score: 101.679 bits (252), Expect = 8.351e-22
Identity = 111/478 (23.22%), Postives = 212/478 (44.35%), Query Frame = 3
Query:  276 NAVHWDMFLESKKT--PLPPIAPTPKENFRPEPLPEIGTLHLKIDLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKDLKSKWNHVAELIHDGDLA-------PHDFVLETLIKELNNNSEKKSF----------LIDGYPRTEQERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISKRIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVHSTCKDLEV-----------DDANVPESSIQNDEILEKERTIDEIPELTGI-AIETARKDDLPQCTLILLLGGPGSGKTETAIQLCKRYP-NWVHIDMNDILRRCMVQNGL-SDPDIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKIELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYF 1610
            +++  D  LE ++T   +P +     E  R + LP+            +++++ GGPG+GK++   +L   +P +  ID+  +I  R              V   + D D+A       P  F++E LI  +N N+ KK            +++GYP+ + E  D    IG  K+ FVIL+D EE+V +  L  +      K+        RI  +K+N L +C+Y+DE  +L I++   +      ++  + +  +   +++  + E            D A    ++IQ    +    T   + E  G+  + T+ + DL    +ILLLGGPGSGK      L  +Y  +++H+D        ++ N + S+ + A   ++     F  E++   +  L+K L +    ++ I++ G+PK   +      ++  +  +I L+ + + M+ RL         + D  +N+ + IQ F
Sbjct:  166 SSIQNDEILEKERTIDEIPELTGIAIETARKDDLPQ-----------CTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMN-DILRRC------------MVQNGLSDPDIAQTADENNPESFIVENLI--VNINALKKHLKSVDDCAQVIILEGYPKNKIELNDLNTEIG--KIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRIQYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNSALEEESLFLGDDQSKYDDSAKAAATTIQAS--IRGHLTRKRLKEERGLNGVRTSSQMDLMNANIILLLGGPGSGKKSLGDHLVIKYAMSFIHVDQ-------LISNEINSNSEHADALNQCIESKF--EDITPILTLLRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETMQSRLENE-----PEPDFTTNTVDLIQEF 599          
The following BLAST results are available for this feature:
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AK51.901e-4824.87adenylate kinase 5 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK52.899e-3822.99adenylate kinase 5 [Source:HGNC Symbol;Acc:HGNC:36... [more]
CMPK19.221e-2028.71cytidine/uridine monophosphate kinase 1 [Source:HG... [more]
AK11.796e-1225.93adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK11.796e-1225.93adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:36... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F13E6.22.577e-2125.00pep chromosome:WBcel235:X:10668280:10674293:-1 gen... [more]
F40F8.18.495e-1322.45UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.18.495e-1322.45UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.18.495e-1322.45UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.18.495e-1322.45UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG95411.684e-2022.92gene:FBgn0032083 transcript:FBtr0332206[more]
Dak17.686e-2030.26gene:FBgn0028833 transcript:FBtr0084976[more]
CG95411.371e-1621.54gene:FBgn0032083 transcript:FBtr0332207[more]
Adk12.986e-926.95gene:FBgn0022709 transcript:FBtr0076017[more]
Adk16.016e-926.95gene:FBgn0022709 transcript:FBtr0076018[more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak51.151e-4626.61adenylate kinase 5 [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
ak5l3.571e-3729.71adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
cmpk4.651e-1627.03cytidylate kinase [Source:NCBI gene;Acc:406383][more]
cmpk7.037e-1627.03cytidylate kinase [Source:NCBI gene;Acc:406383][more]
cmpk7.647e-1627.03cytidylate kinase [Source:NCBI gene;Acc:406383][more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak52.030e-4124.73adenylate kinase 5 [Source:NCBI gene;Acc:100127649... [more]
ak11.988e-3330.45adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak19.444e-2628.52adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak51.553e-2522.09adenylate kinase 5 [Source:NCBI gene;Acc:100127649... [more]
ncan1.622e-1727.04neurocan [Source:Xenbase;Acc:XB-GENE-961217][more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ak55.288e-5024.96adenylate kinase 5 [Source:MGI Symbol;Acc:MGI:2677... [more]
Cmpk11.278e-1927.78cytidine monophosphate (UMP-CMP) kinase 1 [Source:... [more]
Gm179492.463e-1426.99predicted gene, 17949 [Source:MGI Symbol;Acc:MGI:5... [more]
Ak51.205e-1330.59adenylate kinase 5 [Source:MGI Symbol;Acc:MGI:2677... [more]
Ak11.631e-1125.27adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:8797... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q920P5|KAD5_MOUSE3.699e-4924.96Adenylate kinase isoenzyme 5 OS=Mus musculus OX=10... [more]
sp|A4IFD0|KAD5_BOVIN9.044e-4825.00Adenylate kinase isoenzyme 5 OS=Bos taurus OX=9913... [more]
sp|Q9Y6K8|KAD5_HUMAN9.130e-4824.87Adenylate kinase isoenzyme 5 OS=Homo sapiens OX=96... [more]
sp|Q5VRN0|KCY1_ORYSJ5.199e-2029.29UMP-CMP kinase 1 OS=Oryza sativa subsp. japonica O... [more]
sp|Q29561|KCY_PIG6.676e-2028.16UMP-CMP kinase OS=Sus scrofa OX=9823 GN=CMPK1 PE=1... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|215076617.094e-11636.86tr|A0A074ZDL2|A0A074ZDL2_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|204208061.878e-11336.93tr|A0A3R7JNZ7|A0A3R7JNZ7_CLOSI Adenylate kinase is... [more]
gnl|BL_ORD_ID|225424631.491e-10935.48tr|A0A5J4NBT0|A0A5J4NBT0_9TREM Adenylate kinase OS... [more]
gnl|BL_ORD_ID|191188236.203e-10636.72tr|A0A4E0RMN6|A0A4E0RMN6_FASHE Adenylate kinase is... [more]
gnl|BL_ORD_ID|187307527.995e-10333.02tr|A0A0X3PXV5|A0A0X3PXV5_SCHSO Uncharacterized pro... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak54.325e-4324.91adenylate kinase 5 [Source:NCBI gene;Acc:103029093... [more]
ak54.325e-4324.91adenylate kinase 5 [Source:NCBI gene;Acc:103029093... [more]
ak5l3.640e-3929.75adenylate kinase isoenzyme 5-like [Source:NCBI gen... [more]
ak51.463e-3230.03adenylate kinase 5 [Source:NCBI gene;Acc:103029093... [more]
ak5l4.707e-3127.71adenylate kinase isoenzyme 5-like [Source:NCBI gen... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ak5l1.142e-1728.09adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
URA61.143e-1728.72Uridylate kinase; catalyzes the seventh enzymatic ... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388638.772e-1626.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388649.935e-1424.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361601.065e-1323.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298972.194e-1042.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446952.194e-1042.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak56.988e-4026.33adenylate kinase 5 [Source:NCBI gene;Acc:101172192... [more]
ak54.384e-3124.17adenylate kinase 5 [Source:NCBI gene;Acc:101172192... [more]
ak12.103e-1227.13adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak12.356e-1227.13adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak14.063e-1227.13adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
back to top
BLAST of Adenylate kinase isoenzyme 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020480.11.321e-1394.77SMESG000020480.1[more]
SMESG000020480.11.258e-1399.57SMESG000020480.1[more]
SMESG000020480.11.178e-1399.57SMESG000020480.1[more]
SMESG000020480.13.516e-11591.60SMESG000020480.1[more]
SMESG000020480.15.036e-11699.07SMESG000020480.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029668 ID=SMED30029668|Name=Adenylate kinase isoenzyme 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2795bp
CATAAAATAAGTTCAACCTTCTTTTATAATTTAAAGTTTAAATGAATCAA
TAATATTTATGTTACTATGACGATTTTGTAATTTTTATTAAATATTATAA
AATGCAAGTTCAACAAAAAAGTGTTACAACAGCTAAAAGTGCGAAGGATT
ATTTATCGAAAAATGAAATTCCGCAATTATTTGAATGCTTGATGACAGGC
CTAATGTACCACAGGCCAACAGATTATATAAATTATCTACAAGAGTGTTT
GGAAAAGATCAAAAAACAAGGTGTAAATGCAGTACATTGGGACATGTTCT
TAGAATCGAAAAAGACACCGTTACCGCCTATTGCTCCTACACCAAAAGAA
AACTTTAGACCAGAACCTCTTCCAGAAATCGGAACATTACATTTGAAAAT
CGATTTAAATTCATCCATAGTAATTATTCAGGGTGGTCCTGGCACTGGGA
AATCTCAAATTTGTCACAGATTAAGTTCAGAGTTCCCAGAATATGCTGCC
ATTGATCTTGGTTTGAATATTCGTGAACGAGCAAATTTAGAGGCAAAGGA
TTTGAAATCGAAATGGAATCACGTTGCTGAACTGATTCATGATGGGGATT
TGGCGCCTCATGACTTTGTACTTGAAACACTTATTAAAGAATTAAACAAT
AATTCGGAAAAGAAAAGTTTCCTAATTGACGGGTATCCCCGGACAGAGCA
AGAACGGCTAGATTTCGAGAGATTAATTGGATTTAATAAATTGAAATTCG
TTATTTTAATTGACTGTGAAGAGGAAGTTTGTCAGCAATTTCTATTGAGT
AAGCCACCCAACAAAGAATGGAAAGATCACAGTAATCTCGCCATTTCCAA
ACGTATCGCTAATTATAAATCAAATACCTTGGCAGTTTGCAAATACTTCG
ATGAACTGGGGAAATTGAAAATTATTGATGGCGGTAATGAATCTGAACTG
GCATATCGTGATGTTTATCAACTGTTCAACAAGGAGATTCACGAGGTACA
TTCTACTTGTAAAGATTTGGAGGTTGATGATGCCAATGTACCGGAATCAT
CAATACAAAATGATGAAATACTAGAAAAAGAAAGAACAATTGATGAAATT
CCAGAACTTACTGGTATAGCAATAGAAACTGCAAGAAAAGATGATTTGCC
TCAGTGTACTCTTATCTTATTATTAGGAGGTCCTGGAAGTGGAAAAACAG
AAACTGCGATACAACTTTGCAAAAGATATCCCAATTGGGTTCATATTGAC
ATGAATGACATTTTAAGAAGATGCATGGTGCAAAATGGGTTATCCGATCC
AGATATTGCTCAAACAGCGGATGAAAATAATCCGGAATCCTTCATTGTCG
AAAACTTGATAGTCAATATAAATGCCCTGAAAAAACAATTGAAATCGGTT
GATGATTGTGCCCAGGTAATCATATTAGAAGGATATCCTAAAAATAAAAT
AGAACTCAATGATCTCAATACAGAGATTGGTAAAATAGATTTCGTTATTC
TATTAGACAGTGAAGAAGATGTAATGAAATACAGATTAAATGAGAGATGG
TCAAGGTTTGGATCTAAAGAGGATATTGGATCAAATTCTGAAAATAGAAT
TCAGTACTTTAAAACAAATGGTCTTCCTCTGTGTAGATATTATGATGAAA
GATGTCAACTAAATATTGTAAATTCTGATCGAGACATAGCCTATGTTATA
GATGAAATCGAAAGTATTACTTCAACTCTGTTGAAAAATTCTAATAATTC
GGCTTTGGAAGAAGAGTCATTGTTTTTGGGCGACGATCAGTCTAAATATG
ATGACTCGGCCAAGGCAGCTGCAACTACTATTCAAGCGTCAATTAGAGGC
CATTTGACGAGGAAACGTCTGAAAGAAGAACGTGGTTTAAATGCTATGTT
GGAGAAAAATGAGAACGCTGAAGAAGACACTTCCTTAGCATTGAAAAATG
AAAATGAAAACGTTGAGAATGATTTTATCGCTGAAGATGAAAATAATCCA
CTCGATGAGAATATTGAGGATGAAAATAAACTCATTGCAAACGATGAAGT
AATTGAAGAAGGAGACGTTGAAGAGCATATTGACGCCGAGTCTGTTTCAC
TTCAAGGTTACAAAGGTGTTAGAACTTCCTCTCAAATGGATTTAATGAAC
GCAAACATTATTCTTTTGTTGGGTGGTCCAGGAAGTGGTAAAAAATCTTT
GGGTGATCATTTGGTCATTAAATACGCCATGTCGTTTATCCACGTTGACC
AATTAATAAGCAATGAAATCAACTCAAATTCCGAACATGCCGATGCCCTT
AATCAGTGCATTGAATCAAAATTTGAAGACATTACCCCTATTTTAACTTT
ACTACGTAAAGTATTGGTGAACTCAATGAGTGTAAGCAAGAATATAGTTG
TGGCAGGATTTCCGAAAACGTTTGAACAGTATTGTTTATTTGTTCACGAT
GTCGCACTTGTATCAGGAATCATTTATTTAGAAGTAGATTCAGAAACTAT
GCAAAGTCGTTTAGAGAATGAACCGGAACCAGATTTTACCACTAATACTG
TTGATCTTATTCAGGAGTTCAATGACCGGAACTCCGCATTCATTGAAGAG
ATTAGCACAATGGACATATTTAACAAGATTAATGGTAATGGTACCATAGA
AGAGGTTTTGGCTGGGGCCAGTGAAGTTATTGACCGTTTTTCTTTTATTC
ACTCAGAATAGAACATTATAAATGAACGAAATATGTTATATTATTTAGAG
TACTTATCTGTATTTCTATTAAATTATTGACTTGTCTTTCTAAAA
back to top

protein sequence of SMED30029668-orf-1

>SMED30029668-orf-1 ID=SMED30029668-orf-1|Name=SMED30029668-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=870bp
MQVQQKSVTTAKSAKDYLSKNEIPQLFECLMTGLMYHRPTDYINYLQECL
EKIKKQGVNAVHWDMFLESKKTPLPPIAPTPKENFRPEPLPEIGTLHLKI
DLNSSIVIIQGGPGTGKSQICHRLSSEFPEYAAIDLGLNIRERANLEAKD
LKSKWNHVAELIHDGDLAPHDFVLETLIKELNNNSEKKSFLIDGYPRTEQ
ERLDFERLIGFNKLKFVILIDCEEEVCQQFLLSKPPNKEWKDHSNLAISK
RIANYKSNTLAVCKYFDELGKLKIIDGGNESELAYRDVYQLFNKEIHEVH
STCKDLEVDDANVPESSIQNDEILEKERTIDEIPELTGIAIETARKDDLP
QCTLILLLGGPGSGKTETAIQLCKRYPNWVHIDMNDILRRCMVQNGLSDP
DIAQTADENNPESFIVENLIVNINALKKQLKSVDDCAQVIILEGYPKNKI
ELNDLNTEIGKIDFVILLDSEEDVMKYRLNERWSRFGSKEDIGSNSENRI
QYFKTNGLPLCRYYDERCQLNIVNSDRDIAYVIDEIESITSTLLKNSNNS
ALEEESLFLGDDQSKYDDSAKAAATTIQASIRGHLTRKRLKEERGLNAML
EKNENAEEDTSLALKNENENVENDFIAEDENNPLDENIEDENKLIANDEV
IEEGDVEEHIDAESVSLQGYKGVRTSSQMDLMNANIILLLGGPGSGKKSL
GDHLVIKYAMSFIHVDQLISNEINSNSEHADALNQCIESKFEDITPILTL
LRKVLVNSMSVSKNIVVAGFPKTFEQYCLFVHDVALVSGIIYLEVDSETM
QSRLENEPEPDFTTNTVDLIQEFNDRNSAFIEEISTMDIFNKINGNGTIE
EVLAGASEVIDRFSFIHSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000850Adenylat/UMP-CMP_kin
IPR000048IQ_motif_EF-hand-BS
IPR027417P-loop_NTPase
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
Vocabulary: biological process
TermDefinition
GO:0006139nucleobase-containing compound metabolic process
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0019205nucleobase-containing compound kinase activity
GO:0005515protein binding
GO:0016301kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 589..609
NoneNo IPR availablePFAMPF00406ADKcoord: 110..269
e-value: 2.4E-17
score: 63.4
NoneNo IPR availablePFAMPF00406ADKcoord: 689..832
e-value: 3.0E-9
score: 37.2
NoneNo IPR availablePFAMPF00406ADKcoord: 357..517
e-value: 1.9E-13
score: 50.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 103..295
e-value: 1.9E-33
score: 117.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 678..863
e-value: 1.5E-25
score: 92.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 343..542
e-value: 3.6E-32
score: 113.5
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 570..605
e-value: 4.8E-6
score: 28.2
NoneNo IPR availablePANTHERPTHR23359:SF70ADENYLATE KINASE ISOENZYME 1coord: 620..854
coord: 25..288
coord: 331..537
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 12..56
IPR000850Adenylate kinase/UMP-CMP kinasePRINTSPR00094ADENYLTKNASEcoord: 257..271
score: 20.68
coord: 108..121
score: 42.74
coord: 190..206
score: 41.97
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 620..854
coord: 25..288
coord: 331..537
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 106..282
e-value: 3.91502E-21
score: 89.9886
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 569..591
e-value: 8.6E-4
score: 28.6
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 572..591
e-value: 2.6E-5
score: 23.6
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 570..598
score: 10.255
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 350..539
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 685..860
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 106..293