Cation-transporting ATPase

Overview
NameCation-transporting ATPase
Smed IDSMED30029665
Length (bp)4180
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cation-transporting ATPase (SMED30029665) t-SNE clustered cells

Violin plots show distribution of expression levels for Cation-transporting ATPase (SMED30029665) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cation-transporting ATPase (SMED30029665) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cation-transporting ATPase (SMED30029665) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029665

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30029665h1SMcG0008597 Contig48834newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029665h1SMcG0008597 Contig48834uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30029665h1SMcG0008597 dd_Smed_v4_1640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029665h1SMcG0008597 dd_Smed_v4_1640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029665h1SMcG0008597 dd_Smed_v4_1640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029665h1SMcG0008597 dd_Smed_v4_1640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029665h1SMcG0008597 dd_Smed_v4_1640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cation-transporting ATPase vs. Ensembl Human
Match: ATP13A3 (ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113])

HSP 1 Score: 847.81 bits (2189), Expect = 0.000e+0
Identity = 494/1187 (41.62%), Postives = 709/1187 (59.73%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGE-SVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPE-QVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAF-----------RRNREGK------DVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP----------------HSQKEVIHRAH-----ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVID 3485
            + I +G   + +IYGY  + +K+ +     I +   L L+ +WMP W +  +    ++++ +++L +  D+++ ++  +++ L+L+    S   S  N     H++    +  +  + R+    Q E Q  RYF H  +KY WN  I +F+ L G+++  +CT  Y   S  LT+     R  L+G N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR  +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+  V                  K + DE+++ + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L   A +GFIYTII  +   ++V  I+I SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P ++     L     +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +               N+E +        +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PE ++ LC+ ET+P DF + L  FT  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGD+MLTA+SVARDCG+I   DKVI+ +A L   +     I +HYA+ L +  S  S +       ++V+DS         ++   +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQLIE+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q I    FQ + +F+V  QPWY V  P                H   E     H      N  +F +S FQY+++AI FSKG PFR P YKNY F+ ++I +  F L+I+  P   +  +LQ+   P     + +   V+ N  +S  +E  +D
Sbjct:    7 KTINQGQEDEMEIYGYNLSRWKLAIVSLGVICSGGFLLLLLYWMPEWRVKATCVRAAIKDCEVVLLRTTDEFKMWFCAKIRVLSLETYPVSSPKSMSNKLSNGHAVCLIENPTEENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLTKGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVVMSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLNGTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDV------------------KGIGDELYNPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NARFLSPEENVCNEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPESTPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAGLCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYADSLTQ-CSHPSAIDPEAIPVKLVHDSLED------LQMTRYHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGFQSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFISSFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPYQW-RVTMLIIVLVNAFVSITVEESVD 1165          
BLAST of Cation-transporting ATPase vs. Ensembl Human
Match: ATP13A3 (ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113])

HSP 1 Score: 847.81 bits (2189), Expect = 0.000e+0
Identity = 494/1187 (41.62%), Postives = 709/1187 (59.73%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGE-SVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPE-QVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAF-----------RRNREGK------DVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP----------------HSQKEVIHRAH-----ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVID 3485
            + I +G   + +IYGY  + +K+ +     I +   L L+ +WMP W +  +    ++++ +++L +  D+++ ++  +++ L+L+    S   S  N     H++    +  +  + R+    Q E Q  RYF H  +KY WN  I +F+ L G+++  +CT  Y   S  LT+     R  L+G N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR  +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+  V                  K + DE+++ + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L   A +GFIYTII  +   ++V  I+I SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P ++     L     +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +               N+E +        +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PE ++ LC+ ET+P DF + L  FT  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGD+MLTA+SVARDCG+I   DKVI+ +A L   +     I +HYA+ L +  S  S +       ++V+DS         ++   +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQLIE+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q I    FQ + +F+V  QPWY V  P                H   E     H      N  +F +S FQY+++AI FSKG PFR P YKNY F+ ++I +  F L+I+  P   +  +LQ+   P     + +   V+ N  +S  +E  +D
Sbjct:    7 KTINQGQEDEMEIYGYNLSRWKLAIVSLGVICSGGFLLLLLYWMPEWRVKATCVRAAIKDCEVVLLRTTDEFKMWFCAKIRVLSLETYPVSSPKSMSNKLSNGHAVCLIENPTEENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLTKGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVVMSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLNGTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDV------------------KGIGDELYNPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NARFLSPEENVCNEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPESTPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAGLCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYADSLTQ-CSHPSAIDPEAIPVKLVHDSLED------LQMTRYHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGFQSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFISSFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPYQW-RVTMLIIVLVNAFVSITVEESVD 1165          
BLAST of Cation-transporting ATPase vs. Ensembl Human
Match: ATP13A3 (ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113])

HSP 1 Score: 847.81 bits (2189), Expect = 0.000e+0
Identity = 494/1187 (41.62%), Postives = 709/1187 (59.73%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGE-SVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPE-QVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAF-----------RRNREGK------DVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP----------------HSQKEVIHRAH-----ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVID 3485
            + I +G   + +IYGY  + +K+ +     I +   L L+ +WMP W +  +    ++++ +++L +  D+++ ++  +++ L+L+    S   S  N     H++    +  +  + R+    Q E Q  RYF H  +KY WN  I +F+ L G+++  +CT  Y   S  LT+     R  L+G N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR  +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+  V                  K + DE+++ + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L   A +GFIYTII  +   ++V  I+I SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P ++     L     +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +               N+E +        +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PE ++ LC+ ET+P DF + L  FT  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGD+MLTA+SVARDCG+I   DKVI+ +A L   +     I +HYA+ L +  S  S +       ++V+DS         ++   +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQLIE+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q I    FQ + +F+V  QPWY V  P                H   E     H      N  +F +S FQY+++AI FSKG PFR P YKNY F+ ++I +  F L+I+  P   +  +LQ+   P     + +   V+ N  +S  +E  +D
Sbjct:    7 KTINQGQEDEMEIYGYNLSRWKLAIVSLGVICSGGFLLLLLYWMPEWRVKATCVRAAIKDCEVVLLRTTDEFKMWFCAKIRVLSLETYPVSSPKSMSNKLSNGHAVCLIENPTEENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLTKGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVVMSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLNGTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDV------------------KGIGDELYNPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NARFLSPEENVCNEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPESTPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAGLCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYADSLTQ-CSHPSAIDPEAIPVKLVHDSLED------LQMTRYHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGFQSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFISSFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPYQW-RVTMLIIVLVNAFVSITVEESVD 1165          
BLAST of Cation-transporting ATPase vs. Ensembl Human
Match: ATP13A3 (ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113])

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 488/1192 (40.94%), Postives = 704/1192 (59.06%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGE-SVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPE-QVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAF-----------RRNREGK------DVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP----------------HSQKEVIHRAH-----ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFP-----SLLVNLILFSFV---IANFLISYFIEFVIDN 3488
            + I +G   + +IYGY  + +K+ +     I +   L L+ +WMP W +  +    ++++ +++L +  D+++ ++  +++ L+L+    S   S  N     H++    +  +  + R+    Q E Q  RYF H  +KY WN  I +F+ L  +                       L+G N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR  +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+  V                  K + DE+++ + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L   A +GFIYTII  +   ++V  I+I SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P ++     L     +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +               N+E +        +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PE ++ LC+ ET+P DF + L  FT  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGD+MLTA+SVARDCG+I   DKVI+ +A L   +     I +HYA+ L +  S  S +       ++V+DS         ++   +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQLIE+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q I    FQ + +F+V  QPWY V  P                H   E     H      N  +F +S FQY+++AI FSKG PFR P YKNY F+ ++I +  F L+I+  P   +  +LQ+   P     ++L+ +++ +FV   + NF +   +  V+ N
Sbjct:    7 KTINQGQEDEMEIYGYNLSRWKLAIVSLGVICSGGFLLLLLYWMPEWRVKATCVRAAIKDCEVVLLRTTDEFKMWFCAKIRVLSLETYPVSSPKSMSNKLSNGHAVCLIENPTEENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKKL-----------------------LYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVVMSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLNGTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDV------------------KGIGDELYNPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NARFLSPEENVCNEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPESTPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAGLCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYADSLTQ-CSHPSAIDPEAIPVKLVHDSLED------LQMTRYHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGFQSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFISSFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPYQWRVTMLIIVLVNAFVSITVENFFLDMVLWKVVFN 1148          
BLAST of Cation-transporting ATPase vs. Ensembl Human
Match: ATP13A3 (ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113])

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 475/1093 (43.46%), Postives = 664/1093 (60.75%), Query Frame = 3
Query:  396 HSIIKCNDKLKTKKTRLLIDYQPE-QVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAF-----------RRNREGK------DVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP----------------HSQKEVIHRAH-----ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFP-----SLLVNLILFSFV---IANFLISYFIEFVIDN 3488
            H++    +  +  + R+    Q E Q  RYF H  +KY WN  I +F+ L G+++  +CT  Y   S  LT+     R  L+G N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR  +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+  V                  K + DE+++ + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L   A +GFIYTII  +   ++V  I+I SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P ++     L     +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +               N+E +        +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PE ++ LC+ ET+P DF + L  FT  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGD+MLTA+SVARDCG+I   DKVI+ +A L   +     I +HYA+ L +  S  S +       ++V+DS         ++   +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQLIE+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q I    FQ + +F+V  QPWY V  P                H   E     H      N  +F +S FQY+++AI FSKG PFR P YKNY F+ ++I +  F L+I+  P   +  +LQ+   P     ++L+ +++ +FV   + NF +   +  V+ N
Sbjct:   18 HAVCLIENPTEENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLTKGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVVMSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLNGTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDV------------------KGIGDELYNPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NARFLSPEENVCNEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPESTPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAGLCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYADSLTQ-CSHPSAIDPEAIPVKLVHDSLED------LQMTRYHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGFQSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFISSFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPYQWRVTMLIIVLVNAFVSITVENFFLDMVLWKVVFN 1083          
BLAST of Cation-transporting ATPase vs. Ensembl Celegans
Match: catp-6 (Probable cation-transporting ATPase W08D2.5 [Source:UniProtKB/Swiss-Prot;Acc:Q27533])

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 484/1225 (39.51%), Postives = 691/1225 (56.41%), Query Frame = 3
Query:  105 ITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIE------QTCTEFYTSLP-------------LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGV---------------VASKPDGSFEDPVDDPSEMALCP----LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGN----ENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRM----NYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVD---ARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICV------------------IERPD--------------FHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYV--LPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISY-----FIEFVIDNMSLRRQMKR 3515
            +  GD++ T ++ Y+   F+  L + L +LT  I RLI HW  +W + +   PC+   A+ I   D +    + E++  L+                    K N  + T+   +     PE   R+F+++KL+Y+W   +   E++D I       +T  E    +P             LT  E+  R+  +G N+I VQ+ P+L LL+ E + PFYVFQI SVT+W+ D+Y  YA  IV +S  S+ + +Y  R  E  LR+ V S     V R+G T   I +++LVPGDI+ +P  GCLM CD+ L++G  IVNES+LTGESVP+TK                        V+L  E  D VF+++K+S++VLFCGT+V+Q+R +  + V A+V+RT Y T KG+LVRSI++PKP+D +F +D  KFI  LA  +  GFIYTIIVM+ R   + +I++RSLDIITI +PPALP AM++GI+ AQ RLKKK I+CISP+TINTCG INV CFDKTGTLTEDGLD   V               +       F   + + +     P    L++++ATCHSL  I+G + GDPLD+ +FQ   W ++EG++G+       FD   P I   +  + K  +  ++RQF FSSSLQRMSVI  F  R     N  LY KGSPE++ +LC   T+P D+  ++  +   G+R++A+A RPL ++++K  ++ R  VEC+L  LG +VMENR+KP T  +I  L  A IR +MVTGDN+LT LSVAR+CGII    +  LV+     LD Y      ++              SV   + V+ D    S+ +C                   +E P+              +HLA+SG T+A+I  + P+L+ +L     VFAR APDQK  L+E LQ I Y V+MCGDGANDC ALKAAHAGISLS+ EAS+A+PFTSK+ +I CVP +I EGR AL TSFG FK+MAGYS TQF++V+ LYWI   L+D QF+YID+ ++T  ++ +G + A  +L+   P  RLL+   M+S++ Q I   + Q I +F  + QPW+    PP   +    R+    A+F VS+FQYI+LA+V+SKG PFR  ++ N    A  I      L+IV  P + +   L     PSL   + +      N  +SY     F++F +     R + KR
Sbjct:    3 LESGDHTLT-LFAYRTGPFRTILFYALTVLTLGIFRLILHWKQKWDVKMRMVPCTFEAAEYIYIIDNHN---VSELQPVLR--------------------KSNATIPTENGEM--RKVPEL--RWFVYRKLEYVWIDDLNSDESVDEISDNDNCWKTSFEIANRIPCRSLLAVSESNFGLTLSEISRRLEFYGRNEIVVQLRPILYLLVMEVITPFYVFQIFSVTVWYNDEYAYYASLIVILSLGSIVMDVYQIRTQEIRLRSMVHSTESVEVIREG-TEMTIGSDQLVPGDILLIPPHGCLMQCDSVLMNGTVIVNESVLTGESVPITK------------------------VALTDETNDSVFNIEKNSKNVLFCGTQVLQTRFYRGKKVKAIVLRTAYSTLKGQLVRSIMYPKPVDFRFTKDLFKFILFLACISGCGFIYTIIVMIMRGNTLRRIIVRSLDIITITVPPALPAAMSVGIINAQLRLKKKEIFCISPSTINTCGAINVVCFDKTGTLTEDGLDFHVVRPVMSAVNQEIQKVKLEKSNRTEFMGEMTELTSRNGLPFDGDLVKAIATCHSLTRINGVLHGDPLDLILFQKTGWTMEEGIEGDIEEETQRFDNVQPSII--KPTDDKSAEYSVIRQFTFSSSLQRMSVIV-FDPREDRPDNMMLYSKGSPEMILSLCDPNTVPEDYLLQVNSYAQHGFRLIAVARRPLDLNFNKASKVKRDAVECDLEMLGLIVMENRVKPVTLGVINQLNRANIRTVMVTGDNLLTGLSVARECGIIRPSKRAFLVEHVPGELDEYGRTKIFVK-------------QSVSSSDEVIEDDASVSISMCSSTWKGSSEGDGFSPTNTEVETPNPVTADSLGHLIASSYHLAISGPTFAVIVHEYPELVDQLCSVCDVFARMAPDQKQSLVEQLQQIDYTVAMCGDGANDCAALKAAHAGISLSDAEASIAAPFTSKVPDIRCVPTVISEGRAALVTSFGIFKYMAGYSLTQFVTVMHLYWISNILTDGQFMYIDMFLITMFALLFGNTPAFYRLAHTPPPTRLLSIASMTSVVGQLIIIGVVQFIVFFSTSQQPWFTPYQPPVDDEVEDKRSMQGTALFCVSMFQYIILALVYSKGPPFRGNLWSNKPMCALTIFATLLCLFIVIWPTELVLKTLGNVELPSLTFRIFIVIVGAVNAAVSYGFETLFVDFFLLGYWERYKKKR 1158          
BLAST of Cation-transporting ATPase vs. Ensembl Celegans
Match: catp-7 (Cation-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q86FP2])

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 441/1146 (38.48%), Postives = 660/1146 (57.59%), Query Frame = 3
Query:  132 DIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYT---------SLPLTEIEVQN---RIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP-LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYV--LPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLI-VVISFTLYIVF--KPFQWLRNLLQL-ESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMK 3512
            DI  YK   ++ F  + L   T  I RL  HW P+  I      CS+  AD++L  D + +Y I  V    K+G            T H+++   D    +   L          R+F ++KL+Y W         +DG   T +  Y+         S P T ++  +   R   FG N + V+++P   L+ KE L+PFY+FQ  SVT+W++DDYV YA  I+ MS  S+ + L  TR  +  L++ VV      V R+      ++++E+VPGD++ +P  GC+MYCDA L++G CIVNESMLTGES+P+TK+              ++ D G +          ++F + KH ++++F GTKV+Q++ ++ + V A+V+RT Y T KG+L+R+I++PKP D KF ++ +KFIGVLA+ A  GF+YT  ++  R   + KI+IR+LD++TI++PPALP  M IGI +AQ RL++KSIYCISP TINTCG I+V CFDKTGTLTEDGLD + +     D    D +   +    C  ++ ++ATCH+L+ I+ E+ GDPLD+ MF+   + ++E  D   +E   S+  I  R  ++       I++QF FSS LQR SVI      M    Y KGSPE++ +LCR ET+P +F   + +++  GYR++A+A + L +  S++ + PR  +EC+L  +G + +ENRLKP T  +I+ L  A IR +MVTGDN+LTALSVAR+CGII                N +  +IE       +R  + +++ ++     + +P  V +  +   D   A+SG T++++  + P L+ +LV+   VFAR AP+QK  L+E LQ +G  V+MCGDGANDC ALKAAHAGISLSE EAS+A+PFTSK+A+I CV  LI EGR AL TS+  F  MAGYS TQFIS+L+LYWI  + S  QFL+ID+ ++T L+     ++A  +L+   P   +L+T  M SL  Q     + Q+  +  +  Q W++  +P H   +   ++    AIF VS+F YIVL  VF+ G P+RA I  N  FL ++I V ++    +VF   P Q+    LQ+ + F       I+ +      +IS   +  +D +S R + K
Sbjct:   53 DIIAYKTTFWRTFFFYALSFGTCGIFRLFLHWFPKRLIQFRGKRCSVENADLVLVVDNHNRYDICNVYYRNKSG------------TDHTVVANTDGNLAELDEL----------RWFKYRKLQYTW---------IDGEWSTPSRAYSHVTPENLASSAPTTGLKADDVALRRTYFGPNVMPVKLSPFYELVYKEVLSPFYIFQAISVTVWYIDDYVWYAALIIVMSLYSVIMTLRQTRSQQRRLQSMVVEHDEVQVIRENGRVLTLDSSEIVPGDVLVIPPQGCMMYCDAVLLNGTCIVNESMLTGESIPITKS--------------AISDDGHE----------KIFSIDKHGKNIIFNGTKVLQTKYYKGQNVKALVIRTAYSTTKGQLIRAIMYPKPADFKFFRELMKFIGVLAIVAFFGFMYTSFILFYRGSSIGKIIIRALDLVTIVVPPALPAVMGIGIFYAQRRLRQKSIYCISPTTINTCGAIDVVCFDKTGTLTEDGLDFYALRVVN-DAKIGDNIVQIAANDSCQNVVRAIATCHTLSKINNELHGDPLDVIMFEQTGYSLEED-DSESHESIESIQPILIRPPKDSSLPDCQIVKQFTFSSGLQRQSVIVTEEDSM--KAYCKGSPEMIMSLCRPETVPENFHDIVEEYSQHGYRLIAVAEKELVVG-SEVQKTPRQSIECDLTLIGLVALENRLKPVTTEVIQKLNEANIRSVMVTGDNLLTALSVARECGIIVP--------------NKSAYLIEHENGVVDRRGRTVLTIREKEDHHTERQPKIVDLTKMTNKDCQFAISGSTFSVVTHEYPDLLDQLVLVCNVFARMAPEQKQLLVEHLQDVGQTVAMCGDGANDCAALKAAHAGISLSEAEASIAAPFTSKVADIRCVITLISEGRAALVTSYSAFLCMAGYSLTQFISILLLYWIATSYSQMQFLFIDIAIVTNLAFLSSKTRAHKELASTPPPTSILSTASMVSLFGQLAIGGMAQVAVFCLITMQSWFIPFMPTHHDNDEDRKSLQGTAIFYVSLFHYIVLYFVFAAGPPYRASIASNKAFLISMIGVTVTCIAIVVFYVTPIQYFLGCLQMPQEF-----RFIILAVATVTAVISIIYDRCVDWISERLREK 1119          
BLAST of Cation-transporting ATPase vs. Ensembl Celegans
Match: catp-7 (Cation-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q86FP2])

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 441/1146 (38.48%), Postives = 660/1146 (57.59%), Query Frame = 3
Query:  132 DIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYT---------SLPLTEIEVQN---RIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP-LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYV--LPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLI-VVISFTLYIVF--KPFQWLRNLLQL-ESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMK 3512
            DI  YK   ++ F  + L   T  I RL  HW P+  I      CS+  AD++L  D + +Y I  V    K+G            T H+++   D    +   L          R+F ++KL+Y W         +DG   T +  Y+         S P T ++  +   R   FG N + V+++P   L+ KE L+PFY+FQ  SVT+W++DDYV YA  I+ MS  S+ + L  TR  +  L++ VV      V R+      ++++E+VPGD++ +P  GC+MYCDA L++G CIVNESMLTGES+P+TK+              ++ D G +          ++F + KH ++++F GTKV+Q++ ++ + V A+V+RT Y T KG+L+R+I++PKP D KF ++ +KFIGVLA+ A  GF+YT  ++  R   + KI+IR+LD++TI++PPALP  M IGI +AQ RL++KSIYCISP TINTCG I+V CFDKTGTLTEDGLD + +     D    D +   +    C  ++ ++ATCH+L+ I+ E+ GDPLD+ MF+   + ++E  D   +E   S+  I  R  ++       I++QF FSS LQR SVI      M    Y KGSPE++ +LCR ET+P +F   + +++  GYR++A+A + L +  S++ + PR  +EC+L  +G + +ENRLKP T  +I+ L  A IR +MVTGDN+LTALSVAR+CGII                N +  +IE       +R  + +++ ++     + +P  V +  +   D   A+SG T++++  + P L+ +LV+   VFAR AP+QK  L+E LQ +G  V+MCGDGANDC ALKAAHAGISLSE EAS+A+PFTSK+A+I CV  LI EGR AL TS+  F  MAGYS TQFIS+L+LYWI  + S  QFL+ID+ ++T L+     ++A  +L+   P   +L+T  M SL  Q     + Q+  +  +  Q W++  +P H   +   ++    AIF VS+F YIVL  VF+ G P+RA I  N  FL ++I V ++    +VF   P Q+    LQ+ + F       I+ +      +IS   +  +D +S R + K
Sbjct:   53 DIIAYKTTFWRTFFFYALSFGTCGIFRLFLHWFPKRLIQFRGKRCSVENADLVLVVDNHNRYDICNVYYRNKSG------------TDHTVVANTDGNLAELDEL----------RWFKYRKLQYTW---------IDGEWSTPSRAYSHVTPENLASSAPTTGLKADDVALRRTYFGPNVMPVKLSPFYELVYKEVLSPFYIFQAISVTVWYIDDYVWYAALIIVMSLYSVIMTLRQTRSQQRRLQSMVVEHDEVQVIRENGRVLTLDSSEIVPGDVLVIPPQGCMMYCDAVLLNGTCIVNESMLTGESIPITKS--------------AISDDGHE----------KIFSIDKHGKNIIFNGTKVLQTKYYKGQNVKALVIRTAYSTTKGQLIRAIMYPKPADFKFFRELMKFIGVLAIVAFFGFMYTSFILFYRGSSIGKIIIRALDLVTIVVPPALPAVMGIGIFYAQRRLRQKSIYCISPTTINTCGAIDVVCFDKTGTLTEDGLDFYALRVVN-DAKIGDNIVQIAANDSCQNVVRAIATCHTLSKINNELHGDPLDVIMFEQTGYSLEED-DSESHESIESIQPILIRPPKDSSLPDCQIVKQFTFSSGLQRQSVIVTEEDSM--KAYCKGSPEMIMSLCRPETVPENFHDIVEEYSQHGYRLIAVAEKELVVG-SEVQKTPRQSIECDLTLIGLVALENRLKPVTTEVIQKLNEANIRSVMVTGDNLLTALSVARECGIIVP--------------NKSAYLIEHENGVVDRRGRTVLTIREKEDHHTERQPKIVDLTKMTNKDCQFAISGSTFSVVTHEYPDLLDQLVLVCNVFARMAPEQKQLLVEHLQDVGQTVAMCGDGANDCAALKAAHAGISLSEAEASIAAPFTSKVADIRCVITLISEGRAALVTSYSAFLCMAGYSLTQFISILLLYWIATSYSQMQFLFIDIAIVTNLAFLSSKTRAHKELASTPPPTSILSTASMVSLFGQLAIGGMAQVAVFCLITMQSWFIPFMPTHHDNDEDRKSLQGTAIFYVSLFHYIVLYFVFAAGPPYRASIASNKAFLISMIGVTVTCIAIVVFYVTPIQYFLGCLQMPQEF-----RFIILAVATVTAVISIIYDRCVDWISERLREK 1119          
BLAST of Cation-transporting ATPase vs. Ensembl Celegans
Match: catp-6 (Probable cation-transporting ATPase W08D2.5 [Source:UniProtKB/Swiss-Prot;Acc:Q27533])

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 456/1101 (41.42%), Postives = 641/1101 (58.22%), Query Frame = 3
Query:  477 RYFIHKKLKYIWNWKILHFEALDGIE------QTCTEFYTSLP-------------LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGV---------------VASKPDGSFEDPVDDPSEMALCP----LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGN----ENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRM----NYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVD---ARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICV------------------IERPD--------------FHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYV--LPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISY-----FIEFVIDNMSLRRQMKR 3515
            R+F+++KL+Y+W   +   E++D I       +T  E    +P             LT  E+  R+  +G N+I VQ+ P+L LL+ E + PFYVFQI SVT+W+ D+Y  YA  IV +S  S+ + +Y  R  E  LR+ V S     V R+G T   I +++LVPGDI+ +P  GCLM CD+ L++G  IVNES+LTGESVP+TK                        V+L  E  D VF+++K+S++VLFCGT+V+Q+R +  + V A+V+RT Y T KG+LVRSI++PKP+D +F +D  KFI  LA  +  GFIYTIIVM+ R   + +I++RSLDIITI +PPALP AM++GI+ AQ RLKKK I+CISP+TINTCG INV CFDKTGTLTEDGLD   V               +       F   + + +     P    L++++ATCHSL  I+G + GDPLD+ +FQ   W ++EG++G+       FD   P I   +  + K  +  ++RQF FSSSLQRMSVI  F  R     N  LY KGSPE++ +LC   T+P D+  ++  +   G+R++A+A RPL ++++K  ++ R  VEC+L  LG +VMENR+KP T  +I  L  A IR +MVTGDN+LT LSVAR+CGII    +  LV+     LD Y      ++              SV   + V+ D    S+ +C                   +E P+              +HLA+SG T+A+I  + P+L+ +L     VFAR APDQK  L+E LQ I Y V+MCGDGANDC ALKAAHAGISLS+ EAS+A+PFTSK+ +I CVP +I EGR AL TSFG FK+MAGYS TQF++V+ LYWI   L+D QF+YID+ ++T  ++ +G + A  +L+   P  RLL+   M+S++ Q I   + Q I +F  + QPW+    PP   +    R+    A+F VS+FQYI+LA+V+SKG PFR  ++ N    A  I      L+IV  P + +   L     PSL   + +      N  +SY     F++F +     R + KR
Sbjct:   50 RWFVYRKLEYVWIDDLNSDESVDEISDNDNCWKTSFEIANRIPCRSLLAVSESNFGLTLSEISRRLEFYGRNEIVVQLRPILYLLVMEVITPFYVFQIFSVTVWYNDEYAYYASLIVILSLGSIVMDVYQIRTQEIRLRSMVHSTESVEVIREG-TEMTIGSDQLVPGDILLIPPHGCLMQCDSVLMNGTVIVNESVLTGESVPITK------------------------VALTDETNDSVFNIEKNSKNVLFCGTQVLQTRFYRGKKVKAIVLRTAYSTLKGQLVRSIMYPKPVDFRFTKDLFKFILFLACISGCGFIYTIIVMIMRGNTLRRIIVRSLDIITITVPPALPAAMSVGIINAQLRLKKKEIFCISPSTINTCGAINVVCFDKTGTLTEDGLDFHVVRPVMSAVNQEIQKVKLEKSNRTEFMGEMTELTSRNGLPFDGDLVKAIATCHSLTRINGVLHGDPLDLILFQKTGWTMEEGIEGDIEEETQRFDNVQPSII--KPTDDKSAEYSVIRQFTFSSSLQRMSVIV-FDPREDRPDNMMLYSKGSPEMILSLCDPNTVPEDYLLQVNSYAQHGFRLIAVARRPLDLNFNKASKVKRDAVECDLEMLGLIVMENRVKPVTLGVINQLNRANIRTVMVTGDNLLTGLSVARECGIIRPSKRAFLVEHVPGELDEYGRTKIFVK-------------QSVSSSDEVIEDDASVSISMCSSTWKGSSEGDGFSPTNTEVETPNPVTADSLGHLIASSYHLAISGPTFAVIVHEYPELVDQLCSVCDVFARMAPDQKQSLVEQLQQIDYTVAMCGDGANDCAALKAAHAGISLSDAEASIAAPFTSKVPDIRCVPTVISEGRAALVTSFGIFKYMAGYSLTQFVTVMHLYWISNILTDGQFMYIDMFLITMFALLFGNTPAFYRLAHTPPPTRLLSIASMTSVVGQLIIIGVVQFIVFFSTSQQPWFTPYQPPVDDEVEDKRSMQGTALFCVSMFQYIILALVYSKGPPFRGNLWSNKPMCALTIFATLLCLFIVIWPTELVLKTLGNVELPSLTFRIFIVIVGAVNAAVSYGFETLFVDFFLLGYWERYKKKR 1109          
BLAST of Cation-transporting ATPase vs. Ensembl Celegans
Match: catp-7 (Cation-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q86FP2])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 441/1146 (38.48%), Postives = 660/1146 (57.59%), Query Frame = 3
Query:  132 DIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYT---------SLPLTEIEVQN---RIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP-LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYV--LPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLI-VVISFTLYIVF--KPFQWLRNLLQL-ESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMK 3512
            DI  YK   ++ F  + L   T  I RL  HW P+  I      CS+  AD++L  D + +Y I  V    K+G            T H+++   D    +   L          R+F ++KL+Y W         +DG   T +  Y+         S P T ++  +   R   FG N + V+++P   L+ KE L+PFY+FQ  SVT+W++DDYV YA  I+ MS  S+ + L  TR  +  L++ VV      V R+      ++++E+VPGD++ +P  GC+MYCDA L++G CIVNESMLTGES+P+TK+              ++ D G +          ++F + KH ++++F GTKV+Q++ ++ + V A+V+RT Y T KG+L+R+I++PKP D KF ++ +KFIGVLA+ A  GF+YT  ++  R   + KI+IR+LD++TI++PPALP  M IGI +AQ RL++KSIYCISP TINTCG I+V CFDKTGTLTEDGLD + +     D    D +   +    C  ++ ++ATCH+L+ I+ E+ GDPLD+ MF+   + ++E  D   +E   S+  I  R  ++       I++QF FSS LQR SVI      M    Y KGSPE++ +LCR ET+P +F   + +++  GYR++A+A + L +  S++ + PR  +EC+L  +G + +ENRLKP T  +I+ L  A IR +MVTGDN+LTALSVAR+CGII                N +  +IE       +R  + +++ ++     + +P  V +  +   D   A+SG T++++  + P L+ +LV+   VFAR AP+QK  L+E LQ +G  V+MCGDGANDC ALKAAHAGISLSE EAS+A+PFTSK+A+I CV  LI EGR AL TS+  F  MAGYS TQFIS+L+LYWI  + S  QFL+ID+ ++T L+     ++A  +L+   P   +L+T  M SL  Q     + Q+  +  +  Q W++  +P H   +   ++    AIF VS+F YIVL  VF+ G P+RA I  N  FL ++I V ++    +VF   P Q+    LQ+ + F       I+ +      +IS   +  +D +S R + K
Sbjct:   37 DIIAYKTTFWRTFFFYALSFGTCGIFRLFLHWFPKRLIQFRGKRCSVENADLVLVVDNHNRYDICNVYYRNKSG------------TDHTVVANTDGNLAELDEL----------RWFKYRKLQYTW---------IDGEWSTPSRAYSHVTPENLASSAPTTGLKADDVALRRTYFGPNVMPVKLSPFYELVYKEVLSPFYIFQAISVTVWYIDDYVWYAALIIVMSLYSVIMTLRQTRSQQRRLQSMVVEHDEVQVIRENGRVLTLDSSEIVPGDVLVIPPQGCMMYCDAVLLNGTCIVNESMLTGESIPITKS--------------AISDDGHE----------KIFSIDKHGKNIIFNGTKVLQTKYYKGQNVKALVIRTAYSTTKGQLIRAIMYPKPADFKFFRELMKFIGVLAIVAFFGFMYTSFILFYRGSSIGKIIIRALDLVTIVVPPALPAVMGIGIFYAQRRLRQKSIYCISPTTINTCGAIDVVCFDKTGTLTEDGLDFYALRVVN-DAKIGDNIVQIAANDSCQNVVRAIATCHTLSKINNELHGDPLDVIMFEQTGYSLEED-DSESHESIESIQPILIRPPKDSSLPDCQIVKQFTFSSGLQRQSVIVTEEDSM--KAYCKGSPEMIMSLCRPETVPENFHDIVEEYSQHGYRLIAVAEKELVVG-SEVQKTPRQSIECDLTLIGLVALENRLKPVTTEVIQKLNEANIRSVMVTGDNLLTALSVARECGIIVP--------------NKSAYLIEHENGVVDRRGRTVLTIREKEDHHTERQPKIVDLTKMTNKDCQFAISGSTFSVVTHEYPDLLDQLVLVCNVFARMAPEQKQLLVEHLQDVGQTVAMCGDGANDCAALKAAHAGISLSEAEASIAAPFTSKVADIRCVITLISEGRAALVTSYSAFLCMAGYSLTQFISILLLYWIATSYSQMQFLFIDIAIVTNLAFLSSKTRAHKELASTPPPTSILSTASMVSLFGQLAIGGMAQVAVFCLITMQSWFIPFMPTHHDNDEDRKSLQGTAIFYVSLFHYIVLYFVFAAGPPYRASIASNKAFLISMIGVTVTCIAIVVFYVTPIQYFLGCLQMPQEF-----RFIILAVATVTAVISIIYDRCVDWISERLREK 1103          
BLAST of Cation-transporting ATPase vs. Ensembl Fly
Match: anne (gene:FBgn0052000 transcript:FBtr0113417)

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 496/1285 (38.60%), Postives = 730/1285 (56.81%), Query Frame = 3
Query:  135 IYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQ-QYWIHEVK----LTLKNGESV-KASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQT--CTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENE-FDMSVPMIAFRRNREG----------------------------------KDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARL--DSYNV-------------NDTIIEFHYAEDLQRPVSEISVLKR----------------------------NRVVNDSKPS-------------SVK-----------ICVIERPDFH-------LAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVE-TPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVIDNMSLRR-QMKRIK-IILFPQSVDQVEYXXXXXXXXXXSASWPPIIK 3617
            + GY+R+  +    W    LT  +LRL+ HW    Y+Y + + CSL EA+ +L  + YQ ++ ++ VK    LT  N +++ +  Q + +RT        + L+         ++     R F  K+L Y WN     F+ ++G++    C+ ++    L   E  +R  +FG+N+I V +     LL  E LNPFYVFQ+ SV LWF  DY  YA  I+ MS   +++ +  T+KN++ L+ TV + G+  V        ++    +VPGDIIE+P SGC ++CDA LISGNCI++ESMLTGESVPVTKTPLP+                           D +FD  +H+RH LFCGTKVIQ+R   ++ VLA V+ TG +TAKGEL+RSIL+P P+D KF QD+ KFI  LA+ A VGFIYT++  + R  +  KI + SLD+ITI++PPALP AMT+G  +AQ RLK   I+CISP +IN  G IN  CFDKTGTLTEDGLD+WGVV       F+ P+     +     +  M TCHS+ I++G + GDPLD+KMF+S  W++++  +  + E + +  P I  R+ R G                                  K+   GI+R+FPF+S+LQRMSV+T+  S   +N+Y KGSPE+L  LC+ ++LP ++S +L +F   GYR++A+A++ L  K++Y+K+ R+ R EVE  + FLGF+++ENRLKP+T  +I  L AA IR IM+TGDN+LTA+SVARDCGI+S    VI V A    DS N+             +D   + HY  DL    S   + K                             N +VN+S  S             SVK           + +   PD          AM GKTW I++D  P+ +  L+ +G+++AR +PDQK  L+  LQ++ Y V+MCGDGANDCGALK AHAGISLSETEAS+ASPFTS+   IS V ++IKEGR AL TSFG FK+MA YS  QFISV++LY I +NL+D Q+LY+DL +++  +  +G +++   + VE  P   L+++T ++SL+L       FQ+  + +++ QPW+    P  +  +      N  +F +S FQYI+LA VFSKGAP+R P++ N+      IV +   +Y+V  P  W+ +  QL   P++    ++ ++  A+F+   F+E F+++ +  ++ Q+KR K  +   Q   ++E++           +WPPI +
Sbjct:  164 VCGYRRSLMRTGFCWACIFLTGGLLRLVLHWWRHLYLYATCSQCSLEEAEQVLVTEDYQGKHKMYHVKQIQVLTSSNLKTLLEKEQQSIERTHIECDHVENVLQLSVHFTSAQFKKCSSIRIFRCKQLVYAWNNNTNRFQRINGLDLNIPCSYYHQQRGLPVHEQISRRIVFGDNEITVPLRDFKTLLFLEVLNPFYVFQLFSVILWFTYDYYYYACVILLMSVFGITVSVLQTKKNQDVLQKTVYNTGNAWVVDHKGLSKELPTRAIVPGDIIEIPSSGCTLHCDAILISGNCILDESMLTGESVPVTKTPLPSKR-------------------------DMIFDKTEHARHTLFCGTKVIQTRYIGSKKVLAFVINTGNITAKGELIRSILYPPPVDYKFEQDSYKFIQFLAIIACVGFIYTLVTKILRGTDPVKIAVESLDLITIVVPPALPAAMTVGRFYAQKRLKTSEIFCISPRSINVAGSINCCCFDKTGTLTEDGLDMWGVVPKSSTNQFQIPLKSVDRLPFDHFLFGMVTCHSITILNGRMMGDPLDLKMFESTGWELEDSNNIPDTEKYGILYPTI-LRQPRGGLSGMAETESGSKNEIKRQSSVDDLLATVGISPSQKNFDHGIVREFPFTSALQRMSVVTRCLSDQVFNVYCKGSPEMLKKLCKPQSLPDNYSQQLSEFAKKGYRIIAIAFKALSHKMNYTKVQRLSREEVENNMEFLGFVILENRLKPDTTKVINALNAAKIRTIMITGDNILTAISVARDCGIVSPSQSVITVHADPIGDSANIQTNTGTECNFDNSSDKHYKLHYTLDLGSKTSRAYLFKSCFNSNLFDPETPEFTAQVGKTIFHMESTNSLVNESTSSYAESGLPTSDSLASVKTIDTWTHNDAELGIKHTPDESWRRQECIFAMDGKTWQIVKDYFPEEMEILLTRGSIYARMSPDQKQALVIELQNLDYCVAMCGDGANDCGALKVAHAGISLSETEASIASPFTSRNPTISAVLKVIKEGRAALVTSFGIFKYMAAYSLVQFISVMILYSIDSNLTDKQYLYVDLGLISIFAFFFGKTESFDGMLVEQVPLSSLISSTPLASLLLHLTVVTAFQVTCWVHLHQQPWFKAFEPADEDHL--GCFENYTMFCISSFQYIILAFVFSKGAPYRKPLWSNWPLCLAFIVNLCIIVYLVLYPSDWVASFFQLIVPPTMRFRYVMLAYGAASFICHIFVESFLVEYLVFKKYQVKREKNWVTSKQKYMRLEHDISNI------KNWPPITE 1414          
BLAST of Cation-transporting ATPase vs. Ensembl Fly
Match: anne (gene:FBgn0052000 transcript:FBtr0089451)

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 493/1285 (38.37%), Postives = 730/1285 (56.81%), Query Frame = 3
Query:  135 IYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQ-QYWIHEVK----LTLKNGESV-KASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQT--CTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENE-FDMSVPMIAFRRNREG----------------------------------KDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARL--DSYNV-------------NDTIIEFHYAEDLQRPVSEISVLKR----------------------------NRVVNDSK--------PSSVKICVIE-----------------------RPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVE-TPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVIDNMSLRR-QMKRIK-IILFPQSVDQVEYXXXXXXXXXXSASWPPIIK 3617
            + GY+R+  +    W    LT  +LRL+ HW    Y+Y + + CSL EA+ +L  + YQ ++ ++ VK    LT  N +++ +  Q + +RT        + L+         ++     R F  K+L Y WN     F+ ++G++    C+ ++    L   E  +R  +FG+N+I V +     LL  E LNPFYVFQ+ SV LWF  DY  YA  I+ MS   +++ +  T+KN++ L+ TV + G+  V        ++    +VPGDIIE+P SGC ++CDA LISGNCI++ESMLTGESVPVTKTPLP+                           D +FD  +H+RH LFCGTKVIQ+R   ++ VLA V+ TG +TAKGEL+RSIL+P P+D KF QD+ KFI  LA+ A VGFIYT++  + R  +  KI + SLD+ITI++PPALP AMT+G  +AQ RLK   I+CISP +IN  G IN  CFDKTGTLTEDGLD+WGVV       F+ P+     +     +  M TCHS+ I++G + GDPLD+KMF+S  W++++  +  + E + +  P I  R+ R G                                  K+   GI+R+FPF+S+LQRMSV+T+  S   +N+Y KGSPE+L  LC+ ++LP ++S +L +F   GYR++A+A++ L  K++Y+K+ R+ R EVE  + FLGF+++ENRLKP+T  +I  L AA IR IM+TGDN+LTA+SVARDCGI+S    VI V A    DS N+             +D   + HY  DL    S   + K                             N +VN+S         P+S  +  ++                       R +   AM GKTW I++D  P+ +  L+ +G+++AR +PDQK  L+  LQ++ Y V+MCGDGANDCGALK AHAGISLSETEAS+ASPFTS+   IS V ++IKEGR AL TSFG FK+MA YS  QFISV++LY I +NL+D Q+LY+DL +++  +  +G +++   + VE  P   L+++T ++SL+L       FQ+  + +++ QPW+    P  +  +      N  +F +S FQYI+LA VFSKGAP+R P++ N+      IV +   +Y+V  P  W+ +  QL   P++    ++ ++  A+F+   F+E F+++ +  ++ Q+KR K  +   Q   ++E++           +WPPI +
Sbjct:  101 VCGYRRSLMRTGFCWACIFLTGGLLRLVLHWWRHLYLYATCSQCSLEEAEQVLVTEDYQGKHKMYHVKQIQVLTSSNLKTLLEKEQQSIERTHIECDHVENVLQLSVHFTSAQFKKCSSIRIFRCKQLVYAWNNNTNRFQRINGLDLNIPCSYYHQQRGLPVHEQISRRIVFGDNEITVPLRDFKTLLFLEVLNPFYVFQLFSVILWFTYDYYYYACVILLMSVFGITVSVLQTKKNQDVLQKTVYNTGNAWVVDHKGLSKELPTRAIVPGDIIEIPSSGCTLHCDAILISGNCILDESMLTGESVPVTKTPLPSKR-------------------------DMIFDKTEHARHTLFCGTKVIQTRYIGSKKVLAFVINTGNITAKGELIRSILYPPPVDYKFEQDSYKFIQFLAIIACVGFIYTLVTKILRGTDPVKIAVESLDLITIVVPPALPAAMTVGRFYAQKRLKTSEIFCISPRSINVAGSINCCCFDKTGTLTEDGLDMWGVVPKSSTNQFQIPLKSVDRLPFDHFLFGMVTCHSITILNGRMMGDPLDLKMFESTGWELEDSNNIPDTEKYGILYPTI-LRQPRGGLSGMAETESGSKNEIKRQSSVDDLLATVGISPSQKNFDHGIVREFPFTSALQRMSVVTRCLSDQVFNVYCKGSPEMLKKLCKPQSLPDNYSQQLSEFAKKGYRIIAIAFKALSHKMNYTKVQRLSREEVENNMEFLGFVILENRLKPDTTKVINALNAAKIRTIMITGDNILTAISVARDCGIVSPSQSVITVHADPIGDSANIQTNTGTECNFDNSSDKHYKLHYTLDLGSKTSRAYLFKSCFNSNLFDPETPEFTAQVGKTIFHMESTNSLVNESTSSYAESGLPTSDSLASVKTIDTWTHNDAELGIKHTPDESWRRQECIFAMDGKTWQIVKDYFPEEMEILLTRGSIYARMSPDQKQALVIELQNLDYCVAMCGDGANDCGALKVAHAGISLSETEASIASPFTSRNPTISAVLKVIKEGRAALVTSFGIFKYMAAYSLVQFISVMILYSIDSNLTDKQYLYVDLGLISIFAFFFGKTESFDGMLVEQVPLSSLISSTPLASLLLHLTVVTAFQVTCWVHLHQQPWFKAFEPADEDHL--GCFENYTMFCISSFQYIILAFVFSKGAPYRKPLWSNWPLCLAFIVNLCIIVYLVLYPSDWVASFFQLIVPPTMRFRYVMLAYGAASFICHIFVESFLVEYLVFKKYQVKREKNWVTSKQKYMRLEHDISNI------KNWPPITE 1351          
BLAST of Cation-transporting ATPase vs. Ensembl Fly
Match: anne (gene:FBgn0052000 transcript:FBtr0333161)

HSP 1 Score: 854.358 bits (2206), Expect = 0.000e+0
Identity = 493/1285 (38.37%), Postives = 730/1285 (56.81%), Query Frame = 3
Query:  135 IYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQ-QYWIHEVK----LTLKNGESV-KASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQT--CTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENE-FDMSVPMIAFRRNREG----------------------------------KDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDAR--LDSYNV-------------NDTIIEFHYAEDLQRPVSEISVLKR----------------------------NRVVNDSK--------PSSVKICVIE-----------------------RPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVE-TPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVIDNMSLRR-QMKRIK-IILFPQSVDQVEYXXXXXXXXXXSASWPPIIK 3617
            + GY+R+  +    W    LT  +LRL+ HW    Y+Y + + CSL EA+ +L  + YQ ++ ++ VK    LT  N +++ +  Q + +RT        + L+         ++     R F  K+L Y WN     F+ ++G++    C+ ++    L   E  +R  +FG+N+I V +     LL  E LNPFYVFQ+ SV LWF  DY  YA  I+ MS   +++ +  T+KN++ L+ TV + G+  V        ++    +VPGDIIE+P SGC ++CDA LISGNCI++ESMLTGESVPVTKTPLP+                           D +FD  +H+RH LFCGTKVIQ+R   ++ VLA V+ TG +TAKGEL+RSIL+P P+D KF QD+ KFI  LA+ A VGFIYT++  + R  +  KI + SLD+ITI++PPALP AMT+G  +AQ RLK   I+CISP +IN  G IN  CFDKTGTLTEDGLD+WGVV       F+ P+     +     +  M TCHS+ I++G + GDPLD+KMF+S  W++++  +  + E + +  P I  R+ R G                                  K+   GI+R+FPF+S+LQRMSV+T+  S   +N+Y KGSPE+L  LC+ ++LP ++S +L +F   GYR++A+A++ L  K++Y+K+ R+ R EVE  + FLGF+++ENRLKP+T  +I  L AA IR IM+TGDN+LTA+SVARDCGI+S    VI V A    DS N+             +D   + HY  DL    S   + K                             N +VN+S         P+S  +  ++                       R +   AM GKTW I++D  P+ +  L+ +G+++AR +PDQK  L+  LQ++ Y V+MCGDGANDCGALK AHAGISLSETEAS+ASPFTS+   IS V ++IKEGR AL TSFG FK+MA YS  QFISV++LY I +NL+D Q+LY+DL +++  +  +G +++   + VE  P   L+++T ++SL+L       FQ+  + +++ QPW+    P  +  +      N  +F +S FQYI+LA VFSKGAP+R P++ N+      IV +   +Y+V  P  W+ +  QL   P++    ++ ++  A+F+   F+E F+++ +  ++ Q+KR K  +   Q   ++E++           +WPPI +
Sbjct:    3 VCGYRRSLMRTGFCWACIFLTGGLLRLVLHWWRHLYLYATCSQCSLEEAEQVLVTEDYQGKHKMYHVKQIQVLTSSNLKTLLEKEQQSIERTHIECDHVENVLQLSVHFTSAQFKKCSSIRIFRCKQLVYAWNNNTNRFQRINGLDLNIPCSYYHQQRGLPVHEQISRRIVFGDNEITVPLRDFKTLLFLEVLNPFYVFQLFSVILWFTYDYYYYACVILLMSVFGITVSVLQTKKNQDVLQKTVYNTGNAWVVDHKGLSKELPTRAIVPGDIIEIPSSGCTLHCDAILISGNCILDESMLTGESVPVTKTPLPSKR-------------------------DMIFDKTEHARHTLFCGTKVIQTRYIGSKKVLAFVINTGNITAKGELIRSILYPPPVDYKFEQDSYKFIQFLAIIACVGFIYTLVTKILRGTDPVKIAVESLDLITIVVPPALPAAMTVGRFYAQKRLKTSEIFCISPRSINVAGSINCCCFDKTGTLTEDGLDMWGVVPKSSTNQFQIPLKSVDRLPFDHFLFGMVTCHSITILNGRMMGDPLDLKMFESTGWELEDSNNIPDTEKYGILYPTI-LRQPRGGLSGMAETESGSKNEIKRQSSVDDLLATVGISPSQKNFDHGIVREFPFTSALQRMSVVTRCLSDQVFNVYCKGSPEMLKKLCKPQSLPDNYSQQLSEFAKKGYRIIAIAFKALSHKMNYTKVQRLSREEVENNMEFLGFVILENRLKPDTTKVINALNAAKIRTIMITGDNILTAISVARDCGIVSPSQSVITVHADPIGDSANIQTNTGTECNFDNSSDKHYKLHYTLDLGSKTSRAYLFKSCFNSNLFDPETPEFTAQVGKTIFHMESTNSLVNESTSSYAESGLPTSDSLASVKTIDTWTHNDAELGIKHTPDESWRRQECIFAMDGKTWQIVKDYFPEEMEILLTRGSIYARMSPDQKQALVIELQNLDYCVAMCGDGANDCGALKVAHAGISLSETEASIASPFTSRNPTISAVLKVIKEGRAALVTSFGIFKYMAAYSLVQFISVMILYSIDSNLTDKQYLYVDLGLISIFAFFFGKTESFDGMLVEQVPLSSLISSTPLASLLLHLTVVTAFQVTCWVHLHQQPWFKAFEPADEDHL--GCFENYTMFCISSFQYIILAFVFSKGAPYRKPLWSNWPLCLAFIVNLCIIVYLVLYPSDWVASFFQLIVPPTMRFRYVMLAYGAASFICHIFVESFLVEYLVFKKYQVKREKNWVTSKQKYMRLEHDISNI------KNWPPITE 1253          
BLAST of Cation-transporting ATPase vs. Ensembl Fly
Match: anne (gene:FBgn0052000 transcript:FBtr0089449)

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 493/1285 (38.37%), Postives = 730/1285 (56.81%), Query Frame = 3
Query:  135 IYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQ-QYWIHEVK----LTLKNGESV-KASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQT--CTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENE-FDMSVPMIAFRRNREG----------------------------------KDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDAR--LDSYNV-------------NDTIIEFHYAEDLQRPVSEISVLKR----------------------------NRVVNDSK--------PSSVKICVIE-----------------------RPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVE-TPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVIDNMSLRR-QMKRIK-IILFPQSVDQVEYXXXXXXXXXXSASWPPIIK 3617
            + GY+R+  +    W    LT  +LRL+ HW    Y+Y + + CSL EA+ +L  + YQ ++ ++ VK    LT  N +++ +  Q + +RT        + L+         ++     R F  K+L Y WN     F+ ++G++    C+ ++    L   E  +R  +FG+N+I V +     LL  E LNPFYVFQ+ SV LWF  DY  YA  I+ MS   +++ +  T+KN++ L+ TV + G+  V        ++    +VPGDIIE+P SGC ++CDA LISGNCI++ESMLTGESVPVTKTPLP+                           D +FD  +H+RH LFCGTKVIQ+R   ++ VLA V+ TG +TAKGEL+RSIL+P P+D KF QD+ KFI  LA+ A VGFIYT++  + R  +  KI + SLD+ITI++PPALP AMT+G  +AQ RLK   I+CISP +IN  G IN  CFDKTGTLTEDGLD+WGVV       F+ P+     +     +  M TCHS+ I++G + GDPLD+KMF+S  W++++  +  + E + +  P I  R+ R G                                  K+   GI+R+FPF+S+LQRMSV+T+  S   +N+Y KGSPE+L  LC+ ++LP ++S +L +F   GYR++A+A++ L  K++Y+K+ R+ R EVE  + FLGF+++ENRLKP+T  +I  L AA IR IM+TGDN+LTA+SVARDCGI+S    VI V A    DS N+             +D   + HY  DL    S   + K                             N +VN+S         P+S  +  ++                       R +   AM GKTW I++D  P+ +  L+ +G+++AR +PDQK  L+  LQ++ Y V+MCGDGANDCGALK AHAGISLSETEAS+ASPFTS+   IS V ++IKEGR AL TSFG FK+MA YS  QFISV++LY I +NL+D Q+LY+DL +++  +  +G +++   + VE  P   L+++T ++SL+L       FQ+  + +++ QPW+    P  +  +      N  +F +S FQYI+LA VFSKGAP+R P++ N+      IV +   +Y+V  P  W+ +  QL   P++    ++ ++  A+F+   F+E F+++ +  ++ Q+KR K  +   Q   ++E++           +WPPI +
Sbjct:   27 VCGYRRSLMRTGFCWACIFLTGGLLRLVLHWWRHLYLYATCSQCSLEEAEQVLVTEDYQGKHKMYHVKQIQVLTSSNLKTLLEKEQQSIERTHIECDHVENVLQLSVHFTSAQFKKCSSIRIFRCKQLVYAWNNNTNRFQRINGLDLNIPCSYYHQQRGLPVHEQISRRIVFGDNEITVPLRDFKTLLFLEVLNPFYVFQLFSVILWFTYDYYYYACVILLMSVFGITVSVLQTKKNQDVLQKTVYNTGNAWVVDHKGLSKELPTRAIVPGDIIEIPSSGCTLHCDAILISGNCILDESMLTGESVPVTKTPLPSKR-------------------------DMIFDKTEHARHTLFCGTKVIQTRYIGSKKVLAFVINTGNITAKGELIRSILYPPPVDYKFEQDSYKFIQFLAIIACVGFIYTLVTKILRGTDPVKIAVESLDLITIVVPPALPAAMTVGRFYAQKRLKTSEIFCISPRSINVAGSINCCCFDKTGTLTEDGLDMWGVVPKSSTNQFQIPLKSVDRLPFDHFLFGMVTCHSITILNGRMMGDPLDLKMFESTGWELEDSNNIPDTEKYGILYPTI-LRQPRGGLSGMAETESGSKNEIKRQSSVDDLLATVGISPSQKNFDHGIVREFPFTSALQRMSVVTRCLSDQVFNVYCKGSPEMLKKLCKPQSLPDNYSQQLSEFAKKGYRIIAIAFKALSHKMNYTKVQRLSREEVENNMEFLGFVILENRLKPDTTKVINALNAAKIRTIMITGDNILTAISVARDCGIVSPSQSVITVHADPIGDSANIQTNTGTECNFDNSSDKHYKLHYTLDLGSKTSRAYLFKSCFNSNLFDPETPEFTAQVGKTIFHMESTNSLVNESTSSYAESGLPTSDSLASVKTIDTWTHNDAELGIKHTPDESWRRQECIFAMDGKTWQIVKDYFPEEMEILLTRGSIYARMSPDQKQALVIELQNLDYCVAMCGDGANDCGALKVAHAGISLSETEASIASPFTSRNPTISAVLKVIKEGRAALVTSFGIFKYMAAYSLVQFISVMILYSIDSNLTDKQYLYVDLGLISIFAFFFGKTESFDGMLVEQVPLSSLISSTPLASLLLHLTVVTAFQVTCWVHLHQQPWFKAFEPADEDHL--GCFENYTMFCISSFQYIILAFVFSKGAPYRKPLWSNWPLCLAFIVNLCIIVYLVLYPSDWVASFFQLIVPPTMRFRYVMLAYGAASFICHIFVESFLVEYLVFKKYQVKREKNWVTSKQKYMRLEHDISNI------KNWPPITE 1277          
BLAST of Cation-transporting ATPase vs. Ensembl Fly
Match: anne (gene:FBgn0052000 transcript:FBtr0089448)

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 493/1285 (38.37%), Postives = 730/1285 (56.81%), Query Frame = 3
Query:  135 IYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQ-QYWIHEVK----LTLKNGESV-KASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQT--CTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENE-FDMSVPMIAFRRNREG----------------------------------KDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDAR--LDSYNV-------------NDTIIEFHYAEDLQRPVSEISVLKR----------------------------NRVVNDSK--------PSSVKICVIE-----------------------RPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVE-TPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVIDNMSLRR-QMKRIK-IILFPQSVDQVEYXXXXXXXXXXSASWPPIIK 3617
            + GY+R+  +    W    LT  +LRL+ HW    Y+Y + + CSL EA+ +L  + YQ ++ ++ VK    LT  N +++ +  Q + +RT        + L+         ++     R F  K+L Y WN     F+ ++G++    C+ ++    L   E  +R  +FG+N+I V +     LL  E LNPFYVFQ+ SV LWF  DY  YA  I+ MS   +++ +  T+KN++ L+ TV + G+  V        ++    +VPGDIIE+P SGC ++CDA LISGNCI++ESMLTGESVPVTKTPLP+                           D +FD  +H+RH LFCGTKVIQ+R   ++ VLA V+ TG +TAKGEL+RSIL+P P+D KF QD+ KFI  LA+ A VGFIYT++  + R  +  KI + SLD+ITI++PPALP AMT+G  +AQ RLK   I+CISP +IN  G IN  CFDKTGTLTEDGLD+WGVV       F+ P+     +     +  M TCHS+ I++G + GDPLD+KMF+S  W++++  +  + E + +  P I  R+ R G                                  K+   GI+R+FPF+S+LQRMSV+T+  S   +N+Y KGSPE+L  LC+ ++LP ++S +L +F   GYR++A+A++ L  K++Y+K+ R+ R EVE  + FLGF+++ENRLKP+T  +I  L AA IR IM+TGDN+LTA+SVARDCGI+S    VI V A    DS N+             +D   + HY  DL    S   + K                             N +VN+S         P+S  +  ++                       R +   AM GKTW I++D  P+ +  L+ +G+++AR +PDQK  L+  LQ++ Y V+MCGDGANDCGALK AHAGISLSETEAS+ASPFTS+   IS V ++IKEGR AL TSFG FK+MA YS  QFISV++LY I +NL+D Q+LY+DL +++  +  +G +++   + VE  P   L+++T ++SL+L       FQ+  + +++ QPW+    P  +  +      N  +F +S FQYI+LA VFSKGAP+R P++ N+      IV +   +Y+V  P  W+ +  QL   P++    ++ ++  A+F+   F+E F+++ +  ++ Q+KR K  +   Q   ++E++           +WPPI +
Sbjct:   27 VCGYRRSLMRTGFCWACIFLTGGLLRLVLHWWRHLYLYATCSQCSLEEAEQVLVTEDYQGKHKMYHVKQIQVLTSSNLKTLLEKEQQSIERTHIECDHVENVLQLSVHFTSAQFKKCSSIRIFRCKQLVYAWNNNTNRFQRINGLDLNIPCSYYHQQRGLPVHEQISRRIVFGDNEITVPLRDFKTLLFLEVLNPFYVFQLFSVILWFTYDYYYYACVILLMSVFGITVSVLQTKKNQDVLQKTVYNTGNAWVVDHKGLSKELPTRAIVPGDIIEIPSSGCTLHCDAILISGNCILDESMLTGESVPVTKTPLPSKR-------------------------DMIFDKTEHARHTLFCGTKVIQTRYIGSKKVLAFVINTGNITAKGELIRSILYPPPVDYKFEQDSYKFIQFLAIIACVGFIYTLVTKILRGTDPVKIAVESLDLITIVVPPALPAAMTVGRFYAQKRLKTSEIFCISPRSINVAGSINCCCFDKTGTLTEDGLDMWGVVPKSSTNQFQIPLKSVDRLPFDHFLFGMVTCHSITILNGRMMGDPLDLKMFESTGWELEDSNNIPDTEKYGILYPTI-LRQPRGGLSGMAETESGSKNEIKRQSSVDDLLATVGISPSQKNFDHGIVREFPFTSALQRMSVVTRCLSDQVFNVYCKGSPEMLKKLCKPQSLPDNYSQQLSEFAKKGYRIIAIAFKALSHKMNYTKVQRLSREEVENNMEFLGFVILENRLKPDTTKVINALNAAKIRTIMITGDNILTAISVARDCGIVSPSQSVITVHADPIGDSANIQTNTGTECNFDNSSDKHYKLHYTLDLGSKTSRAYLFKSCFNSNLFDPETPEFTAQVGKTIFHMESTNSLVNESTSSYAESGLPTSDSLASVKTIDTWTHNDAELGIKHTPDESWRRQECIFAMDGKTWQIVKDYFPEEMEILLTRGSIYARMSPDQKQALVIELQNLDYCVAMCGDGANDCGALKVAHAGISLSETEASIASPFTSRNPTISAVLKVIKEGRAALVTSFGIFKYMAAYSLVQFISVMILYSIDSNLTDKQYLYVDLGLISIFAFFFGKTESFDGMLVEQVPLSSLISSTPLASLLLHLTVVTAFQVTCWVHLHQQPWFKAFEPADEDHL--GCFENYTMFCISSFQYIILAFVFSKGAPYRKPLWSNWPLCLAFIVNLCIIVYLVLYPSDWVASFFQLIVPPTMRFRYVMLAYGAASFICHIFVESFLVEYLVFKKYQVKREKNWVTSKQKYMRLEHDISNI------KNWPPITE 1277          
BLAST of Cation-transporting ATPase vs. Ensembl Zebrafish
Match: atp13a2 (ATPase cation transporting 13A2 [Source:ZFIN;Acc:ZDB-GENE-061215-126])

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 445/1193 (37.30%), Postives = 691/1193 (57.92%), Query Frame = 3
Query:  123 SKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCND--KLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFY-TSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRD-GKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPV-LAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVD--GNENEFDMSVPMIAFRRN-----REGKDVQ--IGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA--HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSL------------RRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPI 3611
            S  D+ GY+   +K++L     + +  +L ++F W PR  I      C +  AD++L KD+Y Q ++ +V       E V+   +++        +  D  +L ++K  LL         RY++ + ++YIW  K   F     + +  TC + +     L+  +   R  +FG N I+V +   L LL +E LNPFY+FQ+ S+ LW  D YV YA CI  +S +S+ + LY+TRK   +LR     I +  V RD G+  C +++ ELVPGD + +P  G L+ CDA L++G C+VNESMLTGES+PV KTPL N                           +  ++ +   RH LFCGT++IQ++        +AVV  TG+LTAKG+L+ SIL+P+P+D +F +DA+KF+  L L AL+G IY+++++        +++IRSLDI+TII+PPALP A+T   ++AQ+RLK++ ++CISP  IN CG I++ CFDKTGTLTE+GLD+WGV+     G F + V DP  +    ++ ++A+CHS+ ++ G+  GDPL++KM +S  W++ E  +  G+++EF     +   R        EG  V   + I+R+FPFSSSLQRMSV+T   + ++   ++KG+PE++++ C KE++P  FS  L ++   G+RVL LAY+ L    + +  + R EVE  + FLG LVM+N++KPE+  +I+ L  A +RP+MVTGDN+LTA++VAR CG++   +KVI V A   +     ++ +FH  E     ++    +  +  V     S+V         +HLA++G ++A + D  P+ +PK++++G ++AR  P+QKTQL+++LQ + Y V MCGDGANDCGAL+AA  G+SLSE EASVASPFTSK  NISCVP LIKEGRC+L TSF  FK+MA YS  QF SVL+LY    NL D QFL+ DL+++T L+I  G       L  + P+  LL+  +++SL++  +   L Q+        Q WYV P +S +          + ++F+VS FQYI++++V +KG P++ P+Y N +F+  L+ + +   ++V      +  +L L     +   L+L +    NF I + +EF ID  +L            ++Q KR+ + L                    + SWPP+
Sbjct:   36 SHMDVQGYRWVCWKVWLCRIGAVFSVGLLLVLFKWRPRIGILARCKSCPISMADVLLLKDRYGQQFVVDVIT-----EEVEEGSLDFAVGDADENEWRDTVQLHSEKKTLL---------RYYVFEGMRYIWISKKGAFCKASVLSEGWTCADLHGQQQGLSRADQSTRKQIFGANIIDVPVKSYLQLLFEEVLNPFYIFQVFSIILWMSDGYVYYAACIFIISLISIGVSLYETRKQSTTLRRMACLIVNVTVRRDTGEEEC-VSSEELVPGDCVVIPAEGLLLPCDAALVAGECMVNESMLTGESIPVMKTPLSNS--------------------------EATYNPESQRRHTLFCGTQIIQAKGGGPGKGAIAVVTCTGFLTAKGDLISSILYPQPLDFRFYRDAMKFLLFLGLLALIGTIYSLVILSKSNTPWKELIIRSLDIVTIIVPPALPAAITTATIYAQNRLKRQGVFCISPPRINICGKISLFCFDKTGTLTEEGLDVWGVMEVT-GGVFGELVPDPLFLQPGLMLSALASCHSVALLGGQALGDPLELKMIESTGWELTEPENDMGHDSEFGGHRVLAVMRPPASELLTEGNSVSQPVAIVRRFPFSSSLQRMSVVTVGPAELSPVAFIKGAPEMVASFCHKESVPSHFSHTLREYASQGFRVLGLAYKHLA-KETDLSTVERVEVEKGMNFLGLLVMKNQVKPESAEVIQTLTLAQLRPVMVTGDNILTAVNVARVCGMVPSHEKVIFVHASPPTAGSQASL-QFHEGEGATATINTQQTI--DIPVQGQYQSAV--------GYHLAINGMSFAALCDHFPEYLPKVLMRGTIYARMTPEQKTQLVKALQKLNYRVGMCGDGANDCGALRAADVGVSLSEAEASVASPFTSKSDNISCVPLLIKEGRCSLVTSFSLFKYMALYSLIQFASVLILYTEKTNLGDLQFLFFDLVLVTALAILMGRGGPSNDLHPQRPAASLLSLPVLASLLMHTVLLILAQVSGLLITMSQDWYV-PLNSTRTGAANLPNMEDTSVFAVSGFQYIIMSVVITKGFPYKKPLYHNVLFVCALVFLFALMSWLVLFRHTIIHRVLSLYDITDMSYKLLLVAIAALNFFICFLLEFFIDQGALNCLRNLRGKRESKKQYKRLNVQL------------------TETPSWPPL 1155          
BLAST of Cation-transporting ATPase vs. Ensembl Zebrafish
Match: atp13a2 (ATPase cation transporting 13A2 [Source:ZFIN;Acc:ZDB-GENE-061215-126])

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 445/1193 (37.30%), Postives = 690/1193 (57.84%), Query Frame = 3
Query:  123 SKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCND--KLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFY-TSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRD-GKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPV-LAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVD--GNENEFDMSVPMIAFRRN-----REGKDVQ--IGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA--HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSL------------RRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPI 3611
            S  D+ GY+   +K++L     + +  +L ++F W PR  I      C +  AD++L KD+Y Q ++ +V       E V+   +++        +  D  +L ++K  LL         RY++ + ++YIW  K   F     + +  TC + +     L+  +   R  +FG N I+V +   L LL +E LNPFY+FQ+ S+ LW  D YV YA CI  +S +S+ + LY+TRK   +LR     I +  V RD G+  C +++ ELVPGD + +P  G L+ CDA L++G C+VNESMLTGES+PV KTPL N                           +  ++ +   RH LFCGT++IQ++        +AVV  TG+LTAKG+L+ SIL+P+P+D +F +DA+KF+  L L AL+G IY+++++        +++IRSLDI+TII+PPALP A+T   ++AQ+RLK++ ++CISP  IN CG I++ CFDKTGTLTE+GLD+WGV+     G F + V DP  +    ++ ++A+CHS+ ++ G+  GDPL++KM +S  W++ E  +  G+++EF     +   R        EG  V   + I+R+FPFSSSLQRMSV+T   +  +   ++KG+PE++++ C KE++P  FS  L ++   G+RVL LAY+ L    + +  + R EVE  + FLG LVM+N++KPE+  +I+ L  A +RP+MVTGDN+LTA++VAR CG++   +KVI V A   +     ++ +FH  E     ++    +  +  V     S+V         +HLA++G ++A + D  P+ +PK++++G ++AR  P+QKTQL+++LQ + Y V MCGDGANDCGAL+AA  G+SLSE EASVASPFTSK  NISCVP LIKEGRC+L TSF  FK+MA YS  QF SVL+LY    NL D QFL+ DL+++T L+I  G       L  + P+  LL+  +++SL++  +   L Q+        Q WYV P +S +          + ++F+VS FQYI++++V +KG P++ P+Y N +F+  L+ + +   ++V      +  +L L     +   L+L +    NF I + +EF ID  +L            ++Q KR+ + L                    + SWPP+
Sbjct:   36 SHMDVQGYRWVCWKVWLCRIGAVFSVGLLLVLFKWRPRIGILARCKSCPISMADVLLLKDRYGQQFVVDVIT-----EEVEEGSLDFAVGDADENEWRDTVQLHSEKKTLL---------RYYVFEGIRYIWISKKGAFCKASVLSEGWTCADLHGQQQGLSRADQSTRKQIFGANIIDVPVKSYLQLLFEEVLNPFYIFQVFSIILWMSDGYVYYAACIFIISLISIGVSLYETRKQSTTLRRMACLIVNVTVRRDTGEEEC-VSSEELVPGDCVVIPAEGLLLPCDAALVAGECMVNESMLTGESIPVMKTPLSNS--------------------------EATYNPESQRRHTLFCGTQIIQAKGGGPGKGAIAVVTCTGFLTAKGDLISSILYPQPLDFRFYRDAMKFLLFLGLLALIGTIYSLVILSKSNTPWKELIIRSLDIVTIIVPPALPAAITTATIYAQNRLKRQGVFCISPPRINICGKISLFCFDKTGTLTEEGLDVWGVMEVT-GGVFGELVPDPLFLPPGLMLSALASCHSVALLGGQALGDPLELKMIESTGWELTEPENDMGHDSEFGGHRVLAVMRPPASELLTEGNSVSQPVAIVRRFPFSSSLQRMSVVTVGPAEPSPVAFIKGAPEMVASFCHKESVPSHFSHTLREYASQGFRVLGLAYKHLA-KETDLSTVERVEVEKGMNFLGLLVMKNQVKPESAEVIQTLTLAQLRPVMVTGDNILTAVNVARVCGMVPLHEKVIFVHASPPTAGSQASL-QFHEGEGATATINTQQTI--DIPVQGQYQSAV--------GYHLAINGMSFAALCDHFPEYLPKVLMRGTIYARMTPEQKTQLVKALQKLNYRVGMCGDGANDCGALRAADVGVSLSEAEASVASPFTSKSDNISCVPLLIKEGRCSLVTSFSLFKYMALYSLIQFASVLILYTEKTNLGDLQFLFFDLVLVTVLAILMGRGGPSNDLHPQRPAASLLSLPVLASLLMHTVLLILAQVSGLLITMSQDWYV-PLNSTRTGAANLPNMEDTSVFAVSGFQYIIMSVVITKGFPYKKPLYHNVLFVCALVFLFALMSWLVLFRHTIIHRVLSLYDITDMSYKLLLVAIAALNFFICFLLEFFIDQGALNCLRNLRGKRESKKQYKRLNVQL------------------TETPSWPPL 1155          
BLAST of Cation-transporting ATPase vs. Ensembl Zebrafish
Match: atp13a1 (ATPase 13A1 [Source:ZFIN;Acc:ZDB-GENE-040426-2804])

HSP 1 Score: 311.612 bits (797), Expect = 2.433e-87
Identity = 235/740 (31.76%), Postives = 374/740 (50.54%), Query Frame = 3
Query:  600 EVQNRIA--LFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRS--GCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSR-HVLFCGTKVIQSR-----NFENEPV----LAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMV-NRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDD-PSEMALCPLIESMATCHSL-NIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKF----SSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL-KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISL 2753
            EVQ R A   +G N+ E+ +   L L  +    PF+VFQ+  V LW LD+Y  Y+   +FM     +  +    +N + +R          V R+ K +  I+++ELVPGDI+ + RS    L+ CD  L+ G CIV+E+MLTGESVP  K P+ +        PN                   + DL+  SR H++  GTKV+Q       +   +PV    +A V+RTG+ T++G+L+R+ILF        N +   FI  L +FA+   +Y  +    +     YK+ +    I+T ++PP LP+ +++ +  +   L K  ++C  P  I   G + + CFDKTGTLT D L + GV   + +G    PV + P +         +ATCHSL  + DG++ GDPL+  M  +  W + +    +E  F  S+           K   + I ++F F+S+L+RMSV+  +    S+ + Y   VKG+PE L  +  +   P  +     + +  G RVLAL Y+ +  +S+ ++  + R ++EC+LRF GF+V+   LK +++++I +++ A    +M+TGDN LTA  VAR+   I +   +IL  +   S       +    +  L  P S +S L                  I+R D  L ++G+  A ++   PQL+  L+    VFAR +P QK  +I SL+ +G+   MCGDG ND GALK AH G++L
Sbjct:  187 EVQLRAAEKRYGTNRAEMVVPDFLELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLFMLVAFEASLVQQQMRNMSEIRRMGNKPYMIQVYRNRK-WRPISSDELVPGDIVSVGRSPQDNLVPCDVLLLRGRCIVDEAMLTGESVPQMKEPIED------LDPN------------------RILDLQTDSRLHIISGGTKVVQHSPPLRASAGLKPVDNGCVAYVLRTGFYTSQGKLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAVYVWVEGTKDPSRNKYKLFLECTLILTSVVPPELPIELSLAVNTSLIALAKLYVFCTEPFRIPFAGKVEICCFDKTGTLTSDSLVVRGVAGLR-EGKQVMPVSEIPVDTH-----RVVATCHSLVTLDDGQLVGDPLEKAMLTAADWTLTK----DEKVFARSI-----------KTPGLKIHQRFHFTSALKRMSVLASYERMGSTELCYISTVKGAPETLRNMFSE--CPASYDEVHREMSREGARVLALGYKEMGHLSHQQVREVSREQLECDLRFAGFMVVSCPLKSDSKAVIREIQEASHHVVMITGDNPLTACHVARELHFIQKEHTLILQQS---SSQAEWQWVSIDGSVSLPLPPSSVSEL------------------IQRYD--LCVTGEGLARLKFD-PQLLSALLPHVRVFARVSPKQKEFVITSLKGLGFVTLMCGDGTNDVGALKHAHIGVAL 854          

HSP 2 Score: 63.1586 bits (152), Expect = 2.413e-9
Identity = 63/254 (24.80%), Postives = 115/254 (45.28%), Query Frame = 3
Query: 2763 EASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEV-----IHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIV---VISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLR 3500
            +AS+A+PFTSK+++I C+  +IK+GRC L T+   FK +A  +     S  +LY      SD+Q     L+ L    +    SK    LS E P   +     + +++LQ+  +  F  + Y Y   Q     PP S++ V        +  N+ ++ +S+   +    +  KG PF   + +N   L ++ +    I   L      F     L+ + +   L++  +L    +A  L+   ++F++   +LR
Sbjct:  935 DASIAAPFTSKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQATLQGLL-LAGCFLFISRSKPLKSLSKERPLPNIFNLYTVLTVLLQFAVH--FCSLVYLYKGAQTRS--PPRSEQFVDLYKEFEPSLINSTVYIMSMAMQMATFAINYKGHPFMESLTENRPLLWSIAISGLAIVGLLTGSSPEFNEQFALVDIPTEFKLIIAQVLVVDFVAALLVDRVLQFLLGKGTLR 1183          
BLAST of Cation-transporting ATPase vs. Ensembl Zebrafish
Match: atp13a3 (ATPase 13A3 [Source:ZFIN;Acc:ZDB-GENE-120521-1])

HSP 1 Score: 290.426 bits (742), Expect = 3.694e-86
Identity = 190/483 (39.34%), Postives = 274/483 (56.73%), Query Frame = 3
Query: 2295 MLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLP-------PH---------SQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFP-SLLVNLILFSFVIANFLISYFIEFVIDNMS---------LRRQMKRIKIILFPQ--SVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTD 3659
            MLTA+SVARDCG+I   D VI+ DA +   +     I +HYA+   +  ++ + L+   ++ +   S  +    E+  +H AMSGK++A+I +    L+ KLV+ G VFAR APDQKTQL+E+L+S+ Y+V MCGDGANDCGALK AHAGISLSE EASVASPFTS   +I+CVP LI+EGR AL TSF  FKFMA YS  Q +SV +LY I +NL D+QFL+ID+ ++  +  +   + A  +L    P   L++  ++ S++ Q +    FQIIA+  +    WY  P       PH           KE       N  +F +S FQY+++AIVFSKG PFR P YKN+ F+ + ++++ F  +I+F P   +   L+L   P S  V++++   ++AN ++S  IE  ID             RR++ + + +   Q  SVD                 WPP  K  S  E +P +  D
Sbjct:    1 MLTAISVARDCGMIQPLDLVIIADA-VPPKDGQAAKINWHYADKPSKHSNKPTKLEEVEIILEDGHSVDESRSQEQ--YHFAMSGKSFAVIIEHFQDLLQKLVLHGTVFARMAPDQKTQLVETLESVDYFVGMCGDGANDCGALKRAHAGISLSELEASVASPFTSTTPSITCVPNLIREGRAALITSFCVFKFMALYSIIQCLSVALLYSIGSNLGDFQFLFIDMAIILLIVFTMSLNSAWKELVARRPPSGLVSGPLLFSVLTQILICLAFQIIAFLLIQRLDWYSKPDFYNCSLPHHMNNYSNSTGTKEENIVNDVNTTLFFISSFQYLIVAIVFSKGKPFRQPSYKNWPFVLSALILVIFMFFIMFFPISGIYKFLELVCVPLSWRVSMVI--IILANTIVSVIIEGGIDMYGSKCLSWLCCRRRKVPKARYMHLAQELSVD---------------PDWPP--KPKSTTEAKPALHPD 461          
BLAST of Cation-transporting ATPase vs. Ensembl Zebrafish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-001212-8])

HSP 1 Score: 139.428 bits (350), Expect = 9.691e-33
Identity = 213/896 (23.77%), Postives = 349/896 (38.95%), Query Frame = 3
Query:  549 IEQTCTEFYTSL--PLTEIEVQNRIALFGENKIEVQ-ITPLLVLLLKEGLNPFYVFQICSVTLWFL---------DDYV---VYAG----CIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGN-CIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGE---LVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGL---DLWGVVASKPDGSFEDPVD---DPSEMALCPLIESMATCH---------SLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVI--TKFSSRMNYNLYVKGSPEVLSTLCR-----------KETLPRDFSSKLLQFTHSGYRVLALAYRPL-KISYSKMMRIPRHEVECE---LRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKI---ANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVL--MLYWIVAN----LSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETP 3044
            +E+ C +F T +   LT  + ++ +A  G N +     TP  V   ++    F +       L FL         DD     +Y G     +V ++      Q   + K   S +N V      LV R+G+   QINA E+V GD++E+ + G  +  D  +IS + C V+ S LTGES P T++P                              D   D    +R++ F  T  ++           VVV TG  T  G    L   +   K    K  +  +  I  +A+F  V F    +++    +E    VI  + II   +P  L   +T+ +     R+ +K+    +   + T G  +  C DKTGTLT++ +    +W         + ED      D S +    L    A C+         SL I+  ++ GD  +  + + I               ++S   +   R +  K  +I      PF+S+ +    I  T+ ++   Y L +KG+PE +   C             E +   F +  L+    G RVL   +  + +  Y K       +V  +   L F+G + M +  +      +   ++A I+ IMVTGD+ +TA ++A+  GIISE                N+T+ +   A  L  PVS+++            P   K CVI   D       +   ++R+              VFAR +P QK  ++E  Q  G  V++ GDG ND  ALK A  G+++  + + V+      I    N + +   ++EGR      F   K    Y+ T  I  +   L +I+ N    L     L IDL      +IS  Y  A + +    P
Sbjct:   48 VEEVCRKFQTDIVQGLTNAKARDFLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDDPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQ--QALVIREGEKM-QINAEEVVAGDLVEV-KGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSP------------------------------DCTHDNPLETRNIAFFSTNCVEGT------ARGVVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVSFFILAVILGYTWLEA---VIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSVTWVALARVAALCNRAVFKAGQDSLPILKRDVAGDASESALLKCI---------------ELSSGSVKAMREKNKKVAEI------PFNSTNKYQLSIHETEDNNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHVLMPEDQYPKGFAFDTDDVNFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEG---------------NETVEDI--AARLNIPVSQVN------------PRDAKACVIHGTDLKDYSQEQIDEVLRNHTE----------IVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLI----FDNLKKSIAYTLTSNIPEITPFLLFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQP 836          
BLAST of Cation-transporting ATPase vs. Ensembl Xenopus
Match: ATP13A3 (ATPase type 13A3 [Source:NCBI gene;Acc:100497750])

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 495/1192 (41.53%), Postives = 704/1192 (59.06%), Query Frame = 3
Query:   96 NQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVKLTL-------KNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQ------PEQVNRYFIHKKLKYIWN---WKILHFEALD-GIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKD-----------------VQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQ----KEVIH----------RAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVID 3485
             +KI +G+  + +I GY    +K+ L     + +   L L+ +WMP+W +  + T  +L++ D++L +  D+++Q++  +V++ L       +  ESV A ++      H        L    T    D+       P    RYF+H  L Y WN        F+ LD GI+ +      S  L +     R   +G N+I V++  L  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  I+ MS +S+   LY  +K    L + V   SI    V R  K   +I + +LVPGDI+ +P +G +M CDA LISG CIVNESMLTGESVPVTKT LP+PT           DS        +   +E++  + H RH LFCGT VIQ+R +  E V A++VRTG+ T+KG+L+R+IL+PKP D K  +DA  F+  L   A +GF+YTII  +  ++    I+I SLDIITI +PPALP AMT GIV+AQ RLK   I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + D  F  P +     +L     +  MATCHSL  IDG + GDPLD+KMF++I W ++E  +      +  +P +     +   D                  +IGI+RQFPFSS+LQRM+V+ +       + YVKG+PEV+++LC++ET+P DF+S L ++T  GYRV+ALA+R L  KIS+ K+  I R  +E  + FLG ++M+N+LK ET S++EDL+ A IR +MVTGDNMLTA+SVARDCG+I   +KVI+ +A L   +     I +HYA+ L R  S ++ +       +VV+DS   +         ++H AM+GK++ +I +  P L+PKLV+ G VFAR APDQKTQL+E LQ++ YYV MCGDGANDCGALK AH GISLSE EASVASPFTS+  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A   L  + P   L++  ++ S++ Q +    FQ  A+ +V  QPWY V  P+S        +H          + + N  +F VS FQY+++AIVFSKG PFR P YKN+ F+ +++ +    L+ +  P   + +  +L   P     + +   ++ N  +S  +E FV+D
Sbjct:    4 GEKINKGEEDEMEIDGYNLCRWKLALVAIGVLCSGGFLLLLLYWMPKWRVKATCTRVTLKDCDVVLLRTTDEFRQWFCAKVRILLSPVTHPFQIPESV-AGKVTNGHIGH--------LPESHTEHHEDHPMNNATVPLHEVRYFVHHSLTYYWNDVHQTFSLFKGLDEGIQCSAMHREHSQGLCKEIHDYRKLFYGINEITVKVPSLFKLLVKEVLNPFYIFQLFSVILWCTDEYYYYASAILLMSVISIISSLYTIKKQYIMLHDMVSAHSIVRVSVYRGKKEAEEILSTDLVPGDIMLIPPNGTIMPCDAVLISGTCIVNESMLTGESVPVTKTNLPDPT----------TDS--------RAPENEIYSTEIHKRHTLFCGTNVIQTRFYAGESVKAIIVRTGFSTSKGQLIRAILYPKPTDFKLYRDAYLFLLCLVAVAGIGFLYTIINSILNKVPAGIIIIESLDIITITVPPALPAAMTAGIVYAQKRLKNLGIFCISPQRINICGQLNLICFDKTGTLTEDGLDLWGIQRVE-DARFLLPEEKACSESLVKSQFVACMATCHSLTKIDGVLSGDPLDLKMFEAIGWILEEATEEETALHNKMMPTVVQPPKQPVTDQKPAASQEMELFEIPTTYEIGIVRQFPFSSALQRMAVVARILGEKKMDAYVKGAPEVIASLCKQETVPHDFASVLEEYTKQGYRVIALAHRKLESKISWHKVQNISRDAIESNMTFLGLIIMQNKLKEETPSVLEDLRNANIRTVMVTGDNMLTAISVARDCGMILPQEKVIVAEA-LPPKDGRVATISWHYADSLPR--SSLNTIDSEDIPVKVVSDSLEDNYV------ANYHFAMNGKSFGVILEHFPDLVPKLVLHGTVFARMAPDQKTQLVEELQNVDYYVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSRTPSISCVPNLIREGRAALITSFCVFKFMALYSLIQYFSVTLLYSILSNLGDFQFLFIDLAIILIVVFTMSLNPAWKVLVAQRPPSGLISGPLLFSVLSQILICLGFQTWAFLWVKEQPWYEVWIPNSNVCNLSADLHYDNHTDEHNIKNYENTTLFYVSSFQYLIVAIVFSKGKPFRQPSYKNWFFVVSVLGLYILILFFMLYPITPVDDFFELVCVP-FEWRIKMLIIIVINAAVSILVENFVLD 1157          
BLAST of Cation-transporting ATPase vs. Ensembl Xenopus
Match: a4gnt (alpha-1,4-N-acetylglucosaminyltransferase [Source:Xenbase;Acc:XB-GENE-5796041])

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 464/1194 (38.86%), Postives = 681/1194 (57.04%), Query Frame = 3
Query:  105 ITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTE----FYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDG--KTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPV--DDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRN-REGKDVQIGI--LRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKI-SYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDS--------YNVNDTIIEFHYA-EDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYV---------LPPHSQKEVIHR---------------------AHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFI-EFVIDNMSLRRQMKRI 3518
            +  G+ ++ DI+GYK +  +  L    YI +   L L+F+W P W+++ +  PCSL EA ++L +  D ++Q    +VK        ++ S  ++K T+ +  K  D    K   +     PE   RY   +K++YIW+     F     +E   +C+     F + + L E  ++  I   G N I+V I P+  LL+KE LNPFYVFQ+ SV LWF ++Y+ Y+  I+ MS + + + +Y  R+    L   V S  +  V   G  +    + +  L PGDI+ + R+  L+ CDA L  G CIVNESMLTGES+PVTKTPLPN     P+  +SV D                     + RHVLFCGT+VIQ +   N PV AVV+RTG+ TAKG+LVRSIL+PKP++ +  +DA+ F+  L   A +G IY + V         ++V+++LD+ITI +PPALP A+T GI++AQ RL+K  I+CISP  IN CG IN+ CFDKTGTLTEDGLDLWGVV +     F++ +     S +   PL  +MATCHSL ++DG + GDPLD KMF+S  W ++   D  E+    ++P    +       DV  GI  L+QFPFSSSLQRMSVIT+  +   Y +Y+KG+PE++++ C+ +T+P +F  +L  +T  G+RV+ LAY+ L I  + K++ + R EVE +L FLG LV+ENRLK ET  ++++L  A +R +M+TGDN+ TA++VA++ G+ISE   VIL++A+  S        + + D I   +Y   D+   + E+S           KP+       E   +H AM+G T+ +I      L+ K+++ G +FAR +P QK+ L+E  Q +GY V MCGDGANDCGALK AH GISLSE EASVASPFTS   NI CVP LIKEGR AL TSF  FK+MA YS  Q+I VL+LYW     ++YQFL+ DL + T +S++   + A  +LS   P  +L++  ++ S+++  I + + Q+  +  V  Q WY+           P +Q     R                     ++ N  I+ ++    +++A+V SKG PFR PIY NYIF+  + V  +  L+ +F   Q L   L L   P +    IL   +I    +SY   E +++N +L   MK++
Sbjct:   13 LNPGEENEMDIFGYKTHICRKVLCIIGYIFSLGFLWLLFYWKPEWHVWANCVPCSLEEASVVLLRTTDDFKQTSWKKVKW-------IQLSSKDFK-TYRAATKDPDSTINKAIIM-----PELKVRYVQVQKIRYIWDNIEKQFTKAGILEDHYSCSSIHAMFESGVALEEEGIRRLIC--GPNIIDVGIIPIWKLLVKEVLNPFYVFQLFSVCLWFAEEYIEYSVAIILMSLICIFLSVYTLRQQSVKLHKLVESHNNITVSVYGEDRGIFDLESRHLAPGDILVIKRN-TLLPCDALLFKGGCIVNESMLTGESIPVTKTPLPNTDNTEPWKVHSVHD---------------------YKRHVLFCGTQVIQVKASYNSPVKAVVLRTGFNTAKGDLVRSILYPKPVNYRLYRDAVIFLCTLIGTAFIGMIYAVCVFSLSGSAPGEVVLKALDVITIAVPPALPAALTAGIMYAQRRLEKAGIFCISPQRINLCGMINLFCFDKTGTLTEDGLDLWGVVPAN-GYRFQNVIILSPDSSLPWGPLFGAMATCHSLIVLDGNVQGDPLDQKMFESTCWVLE---DQQEDNMTENMPQRIVKPGPTTSSDVIEGIVILQQFPFSSSLQRMSVITQVLNGDEYAVYLKGAPEMVASFCKTDTVPINFPDELTFYTKQGFRVIGLAYKILDIKDHKKLLTLKREEVESDLIFLGLLVLENRLKLETRPVLKELNRAKVRSVMITGDNLQTAVTVAKNSGMISEGSNVILIEAKEPSGSDLATITWTLVDGIKSKNYDFMDICISMEEVS-----------KPAE------ENLHYHFAMNGSTYQVIIQHFNNLLQKILIHGTIFARMSPGQKSNLVEEFQKLGYSVGMCGDGANDCGALKMAHVGISLSEQEASVASPFTSNTPNIECVPRLIKEGRAALVTSFCVFKYMALYSMIQYIGVLLLYWEKTTYANYQFLFQDLAITTVISVTMSLNHAYPRLSSFKPPAQLISPPLLLSVLINIILSLILQVCGFVIVQKQQWYISDLSSIYSACVPTNQSLSTSRPVSNDTNLTTSANSAEISDFQSYENTTIWLLATLNCLIVALVVSKGKPFRQPIYTNYIFILVIAVQFAVCLFFLFADIQNLYKALDLVCTPLIWRGAILIMLLI-TLAVSYIAEEAIVENRALWNAMKKL 1147          
BLAST of Cation-transporting ATPase vs. Ensembl Xenopus
Match: ATP13A3 (ATPase type 13A3 [Source:NCBI gene;Acc:100497750])

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 464/1168 (39.73%), Postives = 676/1168 (57.88%), Query Frame = 3
Query:   96 NQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKD---------------VQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQ----KEVIH----------RAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLI-VVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFI 3470
             +KI +G+  + +I GY    +K+ L     + +   L L+ +WMP+W +  + T  +L++ D++L +  D+++Q++  +V++ L        S + +        +  + +  K T   I + PE    +     +                          ++PL E+    +   +G N+I V++  L  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  I+ MS +S+   LY  +K    L + V   SI    V R  K   +I + +LVPGDI+ +P +G +M CDA LISG CIVNESMLTGESVPVTKT LP+PT           DS        +   +E++  + H RH LFCGT VIQ+R +  E V A++VRTG+ T+KG+L+R+IL+PKP D K  +DA  F+  L   A +GF+YTII  +  ++    I+I SLDIITI +PPALP AMT GIV+AQ RLK   I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + D  F  P +     +L     +  MATCHSL  IDG + GDPLD+KMF++I W ++E  +      +  +P +     +   D                +IGI+RQFPFSS+LQRM+V+ +       + YVKG+PEV+++LC++ET+P DF+S L ++T  GYRV+ALA+R L  KIS+ K+  I R  +E  + FLG ++M+N+LK ET S++EDL+ A IR +MVTGDNMLTA+SVARDCG+I   +KVI+ +A L   +     I +HYA+ L R  S ++ +       +VV+DS   +         ++H AM+GK++ +I +  P L+PKLV+ G VFAR APDQKTQL+E LQ++ YYV MCGDGANDCGALK AH GISLSE EASVASPFTS+  +ISCVP LI   R  + +       MA + F  +    +   I++NL D+QFL+IDL ++  +  +   + A   L  + P   L++  ++ S++ Q +    FQ  A+ +V  QPWY V  P+S        +H          + + N  +F VS FQY+++AIVFSKG PFR P YKN +FL       I ++  +V  PF+W   +L +     +++N  + S ++ NF++   +
Sbjct:    6 GEKINKGEEDEMEIDGYNLCRWKLALVAIGVLCSGGFLLLLLYWMPKWRVKATCTRVTLKDCDVVLLRTTDEFRQWFCAKVRILL--------SPVTHP------FQIPESVAGKVTNGHIGHLPESHTEHHEDHPMNN-----------------------ATVPLHEV----KKLFYGINEITVKVPSLFKLLVKEVLNPFYIFQLFSVILWCTDEYYYYASAILLMSVISIISSLYTIKKQYIMLHDMVSAHSIVRVSVYRGKKEAEEILSTDLVPGDIMLIPPNGTIMPCDAVLISGTCIVNESMLTGESVPVTKTNLPDPT----------TDS--------RAPENEIYSTEIHKRHTLFCGTNVIQTRFYAGESVKAIIVRTGFSTSKGQLIRAILYPKPTDFKLYRDAYLFLLCLVAVAGIGFLYTIINSILNKVPAGIIIIESLDIITITVPPALPAAMTAGIVYAQKRLKNLGIFCISPQRINICGQLNLICFDKTGTLTEDGLDLWGIQRVE-DARFLLPEEKACSESLVKSQFVACMATCHSLTKIDGVLSGDPLDLKMFEAIGWILEEATEEETALHNKMMPTVVQPPKQPVTDQKPAASQEMVLLFTTYEIGIVRQFPFSSALQRMAVVARILGEKKMDAYVKGAPEVIASLCKQETVPHDFASVLEEYTKQGYRVIALAHRKLESKISWHKVQNISRDAIESNMTFLGLIIMQNKLKEETPSVLEDLRNANIRTVMVTGDNMLTAISVARDCGMILPQEKVIVAEA-LPPKDGRVATISWHYADSLPR--SSLNTIDSEDIPVKVVSDSLEDNY------VANYHFAMNGKSFGVILEHFPDLVPKLVLHGTVFARMAPDQKTQLVEELQNVDYYVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSRTPSISCVPNLI---RYCIFSLCKCISLMALHKFCIYSRAALFSCILSNLGDFQFLFIDLAIILIVVFTMSLNPAWKVLVAQRPPSGLISGPLLFSVLSQILICLGFQTWAFLWVKEQPWYEVWIPNSNVCNLSADLHYDNHTDEHNIKNYENTTLFYVSSFQYLIVAIVFSKGKPFRQPSYKNCMFLMLFTDNYIPYSHTLVCVPFEWRIKMLII-----IVINAAV-SILVENFVLDMLL 1095          
BLAST of Cation-transporting ATPase vs. Ensembl Xenopus
Match: ATP13A3 (ATPase type 13A3 [Source:NCBI gene;Acc:100497750])

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 430/962 (44.70%), Postives = 591/962 (61.43%), Query Frame = 3
Query:  624 FGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKD---------------VQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQ----KEVIH----------RAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLI-VVISFTLYIVFKPFQWLRNLL 3386
            +G N+I V++  L  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  I+ MS +S+   LY  +K    L + V   SI    V R  K   +I + +LVPGDI+ +P +G +M CDA LISG CIVNESMLTGESVPVTKT LP+PT           DS        +   +E++  + H RH LFCGT VIQ+R +  E V A++VRTG+ T+KG+L+R+IL+PKP D K  +DA  F+  L   A +GF+YTII  +  +  V  I+I SLDIITI +PPALP AMT GIV+AQ RLK   I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + D  F  P +     +L     +  MATCHSL  IDG + GDPLD+KMF++I W ++E  +      +  +P +     +   D                +IGI+RQFPFSS+LQRM+V+ +       + YVKG+PEV+++LC++ET+P DF+S L ++T  GYRV+ALA+R L  KIS+ K+  I R  +E  + FLG ++M+N+LK ET S++EDL+ A IR +MVTGDNMLTA+SVARDCG+I   +KVI+ +A L   +     I +HYA+ L R  S ++ +       +VV+DS   +         ++H AM+GK++ +I +  P L+PKLV+ G VFAR APDQKTQL+E LQ++ YYV MCGDGANDCGALK AH GISLSE EASVASPFTS+  +ISCVP LI   R  + +       MA + F  +    +   I++NL D+QFL+IDL ++  +  +   + A   L  + P   L++  ++ S++ Q +    FQ  A+ +V  QPWY V  P+S        +H          + + N  +F VS FQY+++AIVFSKG PFR P YKN +FL       I ++  +V  PF+W   +L
Sbjct:   92 YGINEITVKVPSLFKLLVKEVLNPFYIFQLFSVILWCTDEYYYYASAILLMSVISIISSLYTIKKQYIMLHDMVSAHSIVRVSVYRGKKEAEEILSTDLVPGDIMLIPPNGTIMPCDAVLISGTCIVNESMLTGESVPVTKTNLPDPT----------TDS--------RAPENEIYSTEIHKRHTLFCGTNVIQTRFYAGESVKAIIVRTGFSTSKGQLIRAILYPKPTDFKLYRDAYLFLLCLVAVAGIGFLYTIINSILNK--VCIIIIESLDIITITVPPALPAAMTAGIVYAQKRLKNLGIFCISPQRINICGQLNLICFDKTGTLTEDGLDLWGIQRVE-DARFLLPEEKACSESLVKSQFVACMATCHSLTKIDGVLSGDPLDLKMFEAIGWILEEATEEETALHNKMMPTVVQPPKQPVTDQKPAASQEMVLLFTTYEIGIVRQFPFSSALQRMAVVARILGEKKMDAYVKGAPEVIASLCKQETVPHDFASVLEEYTKQGYRVIALAHRKLESKISWHKVQNISRDAIESNMTFLGLIIMQNKLKEETPSVLEDLRNANIRTVMVTGDNMLTAISVARDCGMILPQEKVIVAEA-LPPKDGRVATISWHYADSLPR--SSLNTIDSEDIPVKVVSDSLEDNYV------ANYHFAMNGKSFGVILEHFPDLVPKLVLHGTVFARMAPDQKTQLVEELQNVDYYVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSRTPSISCVPNLI---RYCIFSLCKCISLMALHKFCIYSRAALFSCILSNLGDFQFLFIDLAIILIVVFTMSLNPAWKVLVAQRPPSGLISGPLLFSVLSQILICLGFQTWAFLWVKEQPWYEVWIPNSNVCNLSADLHYDNHTDEHNIKNYENTTLFYVSSFQYLIVAIVFSKGKPFRQPSYKNCMFLMLFTDNYIPYSHTLVCVPFEWRIKML 1020          
BLAST of Cation-transporting ATPase vs. Ensembl Xenopus
Match: tma16 (translation machinery associated 16 homolog [Source:Xenbase;Acc:XB-GENE-1015317])

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 453/1195 (37.91%), Postives = 676/1195 (56.57%), Query Frame = 3
Query:   84 RLMLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQ------YWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLID---YQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYTSLP--LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNE---NSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFED--PVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETL------PRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSS--VKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA---------------------HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFI-EFVIDNMSLRRQMKRI 3518
            R +LN    EG  ++ +I+GY+   ++  L    YI +  +L L+F+W P W ++    PC L  A++ L +  D+++        W H     L   +SV             +++ +DKL TK    +I+     PE   RY   +K+KY+W      F+    +E   +C++ ++     LT+ E   R  + G N IEV++ P+  LL KE LNPFY+FQI S++LW  + Y+ Y+  I+ ++ +S+ + +YD R+     N L  +  S   T++ +DG ++  + + +LVPGDII L      + CD  L+ G+CIVNE MLTGES+PVTKTPL       P+   S +D                     + RHVLFCGT+VIQ+ +   +PV AVVV+TG+ TAKG++VRSIL+PKP++ K  QDAL+F+  L + A VGFIY++IV   +   V+ I+I+S+  IT+ IPP LP A+   ++++Q RLKKK I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWGV+    +  F+      D +++  CPL+ +MA+CHSL I+DG+I GDPLD+KMF+   W I++     EN  + ++ +    R        I IL+QFPFSSSLQRMSVI +        +++KG+PE+++  C  E++      P  F ++L   +   Y   AL    +K  + KM      EVEC L FLG L++ENRLK ET   + +L  A+I+ +M+TGDN+ TA++VAR CGI+    +VIL +A   + ++  +I       +L        V+  N    D + +S   K C      ++ AMSGKT+ II      L+PKL++ GA+FAR +P QK  LIE  Q + YYV+MCGDGANDCGALK AHAGISLSE EASVASPFTS+ ANI CVP+LIKEGR AL +SF  FK++  YS  QFI +L+LYW +  +  YQ+L+ D+ +   +S++   +    KL+   P  +L++  ++ S+I   + +   QI  +  V  QPWY    +  K+    A                     + +  ++ ++    I++A VFSKG PFR PIY NY+F   L + ++  L+I+F   + L    QL   P++    IL   V+  FL+S+ + E  I+N  +   +K+I
Sbjct:   10 RALLN----EGMENEMEIFGYRTILWRKGLCIMGYIFSFGLLWLLFYWKPEWEVWAYCEPCLLENANVFLLRSTDEFKHCSKKNLLWTH-----LSKQDSV-------------LLQTSDKLSTKDEYSIINKAIMMPEHKVRYIRVQKIKYVWLLSEKKFQKAGALEDLYSCSQIHSRFGSGLTQEEQTLRRLICGPNAIEVEVVPVWKLLFKEVLNPFYLFQIASLSLWLAEGYIEYSVVIIIITLISVILTVYDLRQQSVKLNRLVESNNSASVTVLMKDGDSY-DVESRQLVPGDIIVLTGKRFFLPCDCILLEGSCIVNEGMLTGESIPVTKTPLDRSESAKPWKIQSGED---------------------YKRHVLFCGTEVIQATSTGADPVTAVVVQTGFNTAKGDMVRSILYPKPMNFKLYQDALRFLMCLVVIAAVGFIYSVIVFKVKGASVWDIIIKSIIAITVAIPPILPAAVATALMYSQKRLKKKKIFCISPQRINVCGRVNLVCFDKTGTLTEDGLDLWGVIPCT-ENRFQKLHMFADGNDLPWCPLLGAMASCHSLLILDGKIQGDPLDVKMFEGTNWIIED--SNTENNHNHNLLIKPGPRCSPVPVKGITILQQFPFSSSLQRMSVIAQAIESEENMVFMKGAPEMVTQFCLPESVTCIFKKPLFFDNELKTRSPYSYNFWALNKLRMKQEHIKM-----EEVECSLIFLGLLILENRLKTETIPALNELNNALIKTVMITGDNLQTAITVARSCGIVQRHGRVILAEASEPNGSIPASITWKEVETNLH-------VVHDNTETTDPEKNSDAQKSC-----PYYFAMSGKTYGIIVQYFYSLLPKLLLNGAIFARMSPGQKANLIEEFQKLDYYVAMCGDGANDCGALKMAHAGISLSEQEASVASPFTSQTANILCVPQLIKEGRAALVSSFAVFKYVTLYSMIQFICMLLLYWKLKMVGLYQYLFQDVGITILVSLTLSLTHPYQKLAPYRPPAQLISPPLLLSIIFNILLSLASQICGFLLVQQQPWYSTSNYRYKKCFIGAAMQKSQFFVFTGVEENPEFENYESTTLWPITTINLIIVAFVFSKGTPFRKPIYTNYLFFCLLPIQLAACLFILFADLKGLYRAFQLICTPTIWRISILI-IVLIYFLVSFAVEELFIENRRVWLYLKKI 1139          
BLAST of Cation-transporting ATPase vs. Ensembl Mouse
Match: Atp13a3 (ATPase type 13A3 [Source:MGI Symbol;Acc:MGI:2685387])

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 488/1211 (40.30%), Postives = 725/1211 (59.87%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGESVKAS-QINYKRTFHSI-IKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDP-SEMAL-CPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMI-------------AFRRNREGKDV----QIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA---------------------HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDN---------MSLRRQMKRIKIILFPQSV 3545
            + I +G   + +I+GY    +K+ + +   I T   L L+ +W+P W +  +    ++++ +++L +  D+++ ++  ++  L ++N  ++ A   +N     H++ +   ++ +  K       Q +Q+ RYF H  ++Y WN  I +F+ L G+++  +C   Y   S  LT+     R  ++G N+I V++  +  LL+KE LNPFY+FQ+ SV LW +D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR+ +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+         VK  GE           E +  + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L + A +GFIYTII  +    EV +I+I+SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P D+  SEM +    +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +             A  +  E  ++    +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PEV+++LC+ ET+P DF   L  +T  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGDNMLTA+SVARDCG+I   DKVI+ +A L   +     I +HY + L +  SE S +    +       S++   + R  +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQL+E+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q + +  FQ + +F+V    + V  P+S      R+                     + N  +F +S FQY+ +A+ FSKG PFR P YKNY F+ ++I++  F L+I+  P   +  +L++   P     + +   V+ N  +S  +E  +D          +S R++  + K +   Q +
Sbjct:    7 KTINKGQEDEMEIHGYNLCRWKLAMVFVGVICTGGFLLLLLYWLPEWRVKATCVRAAVKDCEVVLLRTTDEFRVWFCAKIHFLPVENQPNLNAKCLVNEVSNGHAVHLTEENRCEMNKYS---QSQSQQM-RYFTHHSIRYFWNDAIHNFDFLKGLDEGVSCASLYEKHSAGLTQGMHAYRKLIYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSVDEYYYYALAIVIMSVVSIISSLYSIRKQYVMLHDMVATHSTVRVSVCRENEEIEEIFSTDLVPGDVMIIPLNGTVMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPS-------VDVKGMGE-----------EQYSPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVVVAGIGFIYTIINSILNEKEVQEIIIKSLDIITITVPPALPAAMTAGIVYAQRRLKKVGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NTRFLLPEDNVCSEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPSKQLLPEPTTAGNQEMELFELPAIYEIGIVRQFPFSSALQRMSVVARTLGEKRMDAYMKGAPEVVASLCKPETVPVDFEKVLEDYTKQGFRVIALAHRKLESKLTWHKVQHISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDNMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYTDSLSQ-CSESSAIDSEAIPIKLAHDSLEDLEVTR--YHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLVEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALMTSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIVISVGFQSLGFFWVKQ--YKVCDPNSDVCNTTRSACWNSSHLYNGTELDSCKIQNYENTTVFFISSFQYLTVAVAFSKGKPFRQPCYKNYFFVISVIILYVFILFIMLHPVASVDQVLEIMCVPYQW-RIYMLIIVLINAFVSITVEESVDRWGKCCLSWALSCRKKTPKAKYMYLAQEL 1187          
BLAST of Cation-transporting ATPase vs. Ensembl Mouse
Match: Atp13a3 (ATPase type 13A3 [Source:MGI Symbol;Acc:MGI:2685387])

HSP 1 Score: 828.165 bits (2138), Expect = 0.000e+0
Identity = 483/1193 (40.49%), Postives = 716/1193 (60.02%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDP-SEMAL-CPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMI-------------AFRRNREGKDV----QIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA---------------------HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVIDNMSLRRQMKRIK 3521
            + I +G   + +I+GY    +K+ + +   I T   L L+ +W+P W +  +    ++++ +++L +  D+++ ++  ++  L ++N  ++ A  +  + +    +   ++ + +  +        Q  RYF H  ++Y WN  I +F+ L G+++  +C   Y   S  LT+     R  ++G N+I V++  +  LL+KE LNPFY+FQ+ SV LW +D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR+ +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+         VK  GE           E +  + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L + A +GFIYTII  +    EV +I+I+SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P D+  SEM +    +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +             A  +  E  ++    +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PEV+++LC+ ET+P DF   L  +T  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGDNMLTA+SVARDCG+I   DKVI+ +A L   +     I +HY + L +  SE S +    +       S++   + R  +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQL+E+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q + +  FQ + +F+V    + V  P+S      R+                     + N  +F +S FQY+ +A+ FSKG PFR P YKNY F+ ++I++  F L+I+  P   +  +L++   P     + +   V+ N  +S  +E F +D +  +    R K
Sbjct:    7 KTINKGQEDEMEIHGYNLCRWKLAMVFVGVICTGGFLLLLLYWLPEWRVKATCVRAAVKDCEVVLLRTTDEFRVWFCAKIHFLPVENQPNLNAKCLVNEVSNGHAVHLTEENRCEMNKY--SQSQSQQMRYFTHHSIRYFWNDAIHNFDFLKGLDEGVSCASLYEKHSAGLTQGMHAYRKLIYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSVDEYYYYALAIVIMSVVSIISSLYSIRKQYVMLHDMVATHSTVRVSVCRENEEIEEIFSTDLVPGDVMIIPLNGTVMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPS-------VDVKGMGE-----------EQYSPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVVVAGIGFIYTIINSILNEKEVQEIIIKSLDIITITVPPALPAAMTAGIVYAQRRLKKVGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NTRFLLPEDNVCSEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPSKQLLPEPTTAGNQEMELFELPAIYEIGIVRQFPFSSALQRMSVVARTLGEKRMDAYMKGAPEVVASLCKPETVPVDFEKVLEDYTKQGFRVIALAHRKLESKLTWHKVQHISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDNMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYTDSLSQ-CSESSAIDSEAIPIKLAHDSLEDLEVTR--YHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLVEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALMTSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIVISVGFQSLGFFWVKQ--YKVCDPNSDVCNTTRSACWNSSHLYNGTELDSCKIQNYENTTVFFISSFQYLTVAVAFSKGKPFRQPCYKNYFFVISVIILYVFILFIMLHPVASVDQVLEIMCVPYQW-RIYMLIIVLINAFVSITVESFFLDTVLWKVVFNRDK 1171          
BLAST of Cation-transporting ATPase vs. Ensembl Mouse
Match: Atp13a2 (ATPase type 13A2 [Source:MGI Symbol;Acc:MGI:1922022])

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 448/1119 (40.04%), Postives = 646/1119 (57.73%), Query Frame = 3
Query:  192 LTAFILRLIFHWMPRWYIYISHTPCSLREAD--IILAKDQ---YQQYWIHEVK---LTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIE--QTCTEFYTSLPLTEIEVQ-NRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDP-VDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSV----PMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKI--SYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA--HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDN 3488
            + A I  L+F W P W + +   PCSL  A+  +I  KD+    +Q +  +V+   +   + E    +Q    R+  ++    +      + L    + +QV RY++ +  +Y+W      F  +  ++  +TC + + S     ++ Q  R  ++G N I + +   L LL  E LNP+Y FQ  S+ LW  D Y  YA CI  +SA+S+ + LY TRK   +LR+ V       VCR G     ++++ELVPGD + LP+ G +M CDA L++G C+VNES LTGES PV KT LP   G  P+ P +                        H RH LFCGT ++Q+R +    VLAVV RTG+ TAKG LV SIL P+PI  KF + ++KF+  L++ AL+G +Y+II++   R+ V +IVIR+LD++T+++PPALP AMT+  ++AQSRL+ + I+CI P  IN  G + + CFDKTGTLTEDGLD+ GVV  K  G    P V +P  + L PL+ ++ATCH+L+ +     GDP+D+KM +S  W ++EG           +    P     R +E   V + +L +FPFSS+LQRM V+  +        YVKGSPE++++LC  ET+P DFS  L  +T +GYRV+ALA +PL I  S +   ++ R  VE EL  LG LVM N LKP+T  +I+ L+   IR +MVTGDN+ TA++VAR CG++   + + ++ A               + E  Q    E    + + V+N +K +     V E    HLA+SG T+A++R   P+L+PK++V+  VFAR AP+QKT+L+  LQ + Y V MCGDGANDCGALKAA  GISLS+ EASV SPFTS +A+I CVP +I+EGRC+L TSF  FK+MA YS TQFISVL+LY I  NL D QFL IDL++ TT+++    +     L    P   LL+  ++ SL+LQ    A  Q+  YF V  QPW+V P +           + N  +FS+S FQY++LA   SKGAPFR P+Y N  FL  L ++ S  + ++  P   L+  L L +       L+L   V  NF+ ++ +E V+D 
Sbjct:   56 MLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIEIKDKEGSSRQLFTVQVQTEAVVQGSLELPPQAQAEDGRSQAAVGVTPEGTWQDTSELHRQEEAKQVLRYYVLQGQRYVWMETQQAFCQVSLLDHGRTCDDVHCSSSGLSLQDQATRKTIYGPNVISIPVKSYLQLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISICLALYKTRKQSLTLRDMVKLSVRVQVCRPGGEEEWVDSSELVPGDCLVLPQEGGVMPCDAALVAGECVVNESSLTGESTPVLKTALPE--GPKPYCPET------------------------HRRHTLFCGTLILQARAYVGPRVLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMKFVAALSVLALLGTVYSIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPLK--GQVLLPLVPEPCHLPLGPLLRALATCHALSQLHDTPVGDPMDLKMVESTGWVLEEGPAAGSAPGSQVLVVMRPPPGGPRQQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCSPETVPSDFSQVLQSYTAAGYRVVALAGKPLPIAPSLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMVGAQEHLAVIHAT--------------HPEQGQPAALEFLPTESSAVMNGAKATGYPT-VPEPQSCHLALSGSTFAVLRKHFPKLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALTLVRARPPGALLSVPVLGSLLLQVALVAGIQLGGYFLVIAQPWFV-PLNRTVPAPDNLPNYENTVVFSLSGFQYLILAAAVSKGAPFRQPLYTNVPFLVALALLGSVLVGLILVP-GLLQGPLGLRNIVDSSFKLLLLGLVAFNFVGAFMLESVLDQ 1129          
BLAST of Cation-transporting ATPase vs. Ensembl Mouse
Match: Atp13a4 (ATPase type 13A4 [Source:MGI Symbol;Acc:MGI:1924456])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 460/1180 (38.98%), Postives = 681/1180 (57.71%), Query Frame = 3
Query:  105 ITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQY-WIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYT----SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGH-TLVCRDGKTFCQ-INANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMAL--CPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDV---QIGILRQFPFSSSLQRMSVITK--FSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRP----VSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHS----------------------QKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVIDNMSLRRQMKR 3515
            + EGD ++ +I+GY+    +  L     I +  +L L+F+W P W ++ +  PCSL+EAD++L K  D+++ Y W   + ++L    S      +     H +I     +  +  R     +P+   RY   +K++Y+WN     F+ +  +E   +         L LT  E + R  + G N I+V+ITP+  LL+KE LNPFY+FQ+ SV LWF +DY  YA  I+ MS +S+++ +YD R+    L + V S    T+   + K   Q + +  LVPGD++ L  S   M CDA LI G+C+V+E MLTGES+PVTKTPL      VP+   S  D                       RHVLFCGT+VIQ++   +  V AVV++TG+ TAKG+LVRSIL+PKP++ K  +DA++F+  L   A +G +YT+ V V       ++V ++LD+ITI +PPALP A+T GI++AQ RLKKK I+CISP  IN CG +N+ CFDKTGTLT  GLD WGVV    +G F+      S  AL   PL  +MA+CHSL ++DG I GDPLD+KMF++ KW++    D    + +M    I  +       V    + I+ QFPFSS+LQRM+VI +     R+ +   +KG+PE +++ C+ +T+P  F S+L  +T  G+RV+ALAY+ L++       + R +VE +L FLG L++ENRLK ET+ ++E+L +A IR +M+TGDN+ TA++VAR  G++SE  KVILV+A  ++   +   I +   E+ ++P      +  +  R  V  + +  S          +H A+SGK++ +I      L+PK+++ G +FAR +P QK+ L+E  Q + Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  NI CVP LIKEGR AL TSF  FK+MA YS  Q++ VL+LYW   +LS+YQFL+ DL + T + ++   + A  KL    P+ RL++  ++ S++L  + +    I+ +  V  QPWY++  HS                      +      +  N  I+ +     I +A+VFSKG PFR P Y NYIF+  LI+ +   L+I+F     +   L L   P L    IL   + +NF++S  +E  +I+N +L   +KR
Sbjct:   13 LNEGDENEMEIFGYRTQGCRKALCLIGSIFSLGMLPLVFYWRPAWRVWANCVPCSLQEADVVLLKTTDEFKIYSWKKVIWISLSALSSTSGLTPD-----HPLITDEGYIINRAIR-----KPDLKVRYIKVQKIRYVWNNLEGQFQKIGSLEDWLSSAKIHQKFGLGLTSEEQEIRRLICGPNAIDVEITPIWKLLIKEVLNPFYIFQLFSVCLWFSEDYKEYALAIILMSVISIALTVYDLRQQSVKLHHLVESHNSITVSVYERKAGAQDLESRLLVPGDLLILTGSRVQMPCDAILIDGSCVVDEGMLTGESIPVTKTPLSQTASSVPWKMQSEADP---------------------RRHVLFCGTEVIQAKAAGSGAVRAVVLQTGFNTAKGDLVRSILYPKPMNFKLYRDAIRFLLCLVGTATIGMVYTLCVYVLSGEPPEEVVRKALDVITIAVPPALPAALTTGIIYAQRRLKKKGIFCISPQRINVCGQLNLVCFDKTGTLTRGGLDPWGVVPCDQNG-FQAVHSFASGKALPQGPLCAAMASCHSLILLDGTIQGDPLDLKMFEATKWEMTASGDDFHIK-EMLAHTIVVKPTDMVAQVPAEGLAIVHQFPFSSALQRMTVIVQEMGGGRLAF---MKGAPERVASFCQPDTVPTSFISELQIYTTQGFRVIALAYKKLEMD-CPTTALMREKVESDLVFLGLLILENRLKEETKPVLEELISARIRTVMITGDNLQTAITVARKSGMVSEGQKVILVEAN-EATGSSSASISWKLVEE-KKPGPFGSQDTYINIREEVPENGRDGS----------YHFALSGKSFHVISQYFSSLLPKILINGTIFARMSPGQKSSLVEEFQKLDYFVGMCGDGANDCGALKMAHVGISLSEQEASVASPFTSKTPNIECVPHLIKEGRAALVTSFCMFKYMALYSMIQYVGVLLLYWKTNSLSNYQFLFQDLAITTLIGVTMNLNGANPKLVPFRPAGRLISPPLLLSVVLNILLSLAMHIVGFILVQKQPWYIMDYHSVCPVRNESASALAASPSVPEKTRSNSTFASFENTTIWFLGTINCIFVALVFSKGKPFRQPTYTNYIFVLVLILQMGVCLFILFADIPEMHRRLDLLCTPVLWRVYILI-MISSNFVVSLAVEKAIIENRALWIAVKR 1142          
BLAST of Cation-transporting ATPase vs. Ensembl Mouse
Match: Atp13a2 (ATPase type 13A2 [Source:MGI Symbol;Acc:MGI:1922022])

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 434/1075 (40.37%), Postives = 623/1075 (57.95%), Query Frame = 3
Query:  135 IYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREAD--IILAKDQ---YQQYWIHEVK---LTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIE--QTCTEFYTSLPLTEIEVQ-NRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDP-VDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSV----PMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKI--SYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA--HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKN 3299
            + GY  + ++         + A I  L+F W P W + +   PCSL  A+  +I  KD+    +Q +  +V+   +   + E    +Q    R+  ++    +      + L    + +QV RY++ +  +Y+W      F  +  ++  +TC + + S     ++ Q  R  ++G N I + +   L LL  E LNP+Y FQ  S+ LW  D Y  YA CI  +SA+S+ + LY TRK   +LR+ V       VCR G     ++++ELVPGD + LP+ G +M CDA L++G C+VNES LTGES PV KT LP   G  P+ P +                        H RH LFCGT ++Q+R +    VLAVV RTG+ TAKG LV SIL P+PI  KF + ++KF+  L++ AL+G +Y+II++   R+ V +IVIR+LD++T+++PPALP AMT+  ++AQSRL+ + I+CI P  IN  G + + CFDKTGTLTEDGLD+ GVV  K  G    P V +P  + L PL+ ++ATCH+L+ +     GDP+D+KM +S  W ++EG           +    P     R +E   V + +L +FPFSS+LQRM V+  +        YVKGSPE++++LC  ET+P DFS  L  +T +GYRV+ALA +PL I  S +   ++ R  VE EL  LG LVM N LKP+T  +I+ L+   IR +MVTGDN+ TA++VAR CG++   + + ++ A               + E  Q    E    + + V+N +K +     V E    HLA+SG T+A++R   P+L+PK++V+  VFAR AP+QKT+L+  LQ + Y V MCGDGANDCGALKAA  GISLS+ EASV SPFTS +A+I CVP +I+EGRC+L TSF  FK+MA YS TQFISVL+LY I  NL D QFL IDL++ TT+++    +     L    P   LL+  ++ SL+LQ    A  Q+  YF V  QPW+V P +           + N  +FS+S FQY++LA   SKGAPFR P+Y N
Sbjct:   37 LSGYCGSPWRAIGYHAAVWMLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIEIKDKEGSSRQLFTVQVQTEAVVQGSLELPPQAQAEDGRSQAAVGVTPEGTWQDTSELHRQEEAKQVLRYYVLQGQRYVWMETQQAFCQVSLLDHGRTCDDVHCSSSGLSLQDQATRKTIYGPNVISIPVKSYLQLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISICLALYKTRKQSLTLRDMVKLSVRVQVCRPGGEEEWVDSSELVPGDCLVLPQEGGVMPCDAALVAGECVVNESSLTGESTPVLKTALPE--GPKPYCPET------------------------HRRHTLFCGTLILQARAYVGPRVLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMKFVAALSVLALLGTVYSIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPLK--GQVLLPLVPEPCHLPLGPLLRALATCHALSQLHDTPVGDPMDLKMVESTGWVLEEGPAAGSAPGSQVLVVMRPPPGGPRQQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCSPETVPSDFSQVLQSYTAAGYRVVALAGKPLPIAPSLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMVGAQEHLAVIHAT--------------HPEQGQPAALEFLPTESSAVMNGAKATGYPT-VPEPQSCHLALSGSTFAVLRKHFPKLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALTLVRARPPGALLSVPVLGSLLLQVALVAGIQLGGYFLVIAQPWFV-PLNRTVPAPDNLPNYENTVVFSLSGFQYLILAAAVSKGAPFRQPLYTN 1067          
BLAST of Cation-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q9H7F0|AT133_HUMAN (Probable cation-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4)

HSP 1 Score: 847.81 bits (2189), Expect = 0.000e+0
Identity = 494/1187 (41.62%), Postives = 709/1187 (59.73%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGE-SVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPE-QVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAF-----------RRNREGK------DVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRN----RVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP----------------HSQKEVIHRAH-----ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVID 3485
            + I +G   + +IYGY  + +K+ +     I +   L L+ +WMP W +  +    ++++ +++L +  D+++ ++  +++ L+L+    S   S  N     H++    +  +  + R+    Q E Q  RYF H  +KY WN  I +F+ L G+++  +CT  Y   S  LT+     R  L+G N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR  +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+  V                  K + DE+++ + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L   A +GFIYTII  +   ++V  I+I SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P ++     L     +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +               N+E +        +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PE ++ LC+ ET+P DF + L  FT  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGD+MLTA+SVARDCG+I   DKVI+ +A L   +     I +HYA+ L +  S  S +       ++V+DS         ++   +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQLIE+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q I    FQ + +F+V  QPWY V  P                H   E     H      N  +F +S FQY+++AI FSKG PFR P YKNY F+ ++I +  F L+I+  P   +  +LQ+   P     + +   V+ N  +S  +E  +D
Sbjct:    7 KTINQGQEDEMEIYGYNLSRWKLAIVSLGVICSGGFLLLLLYWMPEWRVKATCVRAAIKDCEVVLLRTTDEFKMWFCAKIRVLSLETYPVSSPKSMSNKLSNGHAVCLIENPTEENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLTKGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVVMSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLNGTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDV------------------KGIGDELYNPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NARFLSPEENVCNEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPESTPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAGLCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYADSLTQ-CSHPSAIDPEAIPVKLVHDSLED------LQMTRYHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGFQSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFISSFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPYQW-RVTMLIIVLVNAFVSITVEESVD 1165          
BLAST of Cation-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q5XF89|AT133_MOUSE (Probable cation-transporting ATPase 13A3 OS=Mus musculus OX=10090 GN=Atp13a3 PE=1 SV=1)

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 488/1211 (40.30%), Postives = 725/1211 (59.87%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGESVKAS-QINYKRTFHSI-IKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDP-SEMAL-CPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMI-------------AFRRNREGKDV----QIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA---------------------HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDN---------MSLRRQMKRIKIILFPQSV 3545
            + I +G   + +I+GY    +K+ + +   I T   L L+ +W+P W +  +    ++++ +++L +  D+++ ++  ++  L ++N  ++ A   +N     H++ +   ++ +  K       Q +Q+ RYF H  ++Y WN  I +F+ L G+++  +C   Y   S  LT+     R  ++G N+I V++  +  LL+KE LNPFY+FQ+ SV LW +D+Y  YA  IV MS +S+   LY  RK    L + V   S     VCR+ +   +I + +LVPGD++ +P +G +M CDA LI+G CIVNESMLTGESVPVTKT LPNP+         VK  GE           E +  + H RH LFCGT VIQ+R +  E V A+VVRTG+ T+KG+LVRSIL+PKP D K  +DA  F+  L + A +GFIYTII  +    EV +I+I+SLDIITI +PPALP AMT GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG+   + +  F  P D+  SEM +    +  MATCHSL  I+G + GDPLD+KMF++I W ++E  +      +  +P +             A  +  E  ++    +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PEV+++LC+ ET+P DF   L  +T  G+RV+ALA+R L  K+++ K+  I R  +E  + F+G ++M+N+LK ET +++EDL  A IR +MVTGDNMLTA+SVARDCG+I   DKVI+ +A L   +     I +HY + L +  SE S +    +       S++   + R  +H AM+GK++++I +    L+PKL++ G VFAR APDQKTQL+E+LQ++ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTSK  +ISCVP LI+EGR AL TSF  FKFMA YS  Q+ SV +LY I++NL D+QFL+IDL ++  +  +   + A  +L  + P   L++  ++ S++ Q + +  FQ + +F+V    + V  P+S      R+                     + N  +F +S FQY+ +A+ FSKG PFR P YKNY F+ ++I++  F L+I+  P   +  +L++   P     + +   V+ N  +S  +E  +D          +S R++  + K +   Q +
Sbjct:    7 KTINKGQEDEMEIHGYNLCRWKLAMVFVGVICTGGFLLLLLYWLPEWRVKATCVRAAVKDCEVVLLRTTDEFRVWFCAKIHFLPVENQPNLNAKCLVNEVSNGHAVHLTEENRCEMNKYS---QSQSQQM-RYFTHHSIRYFWNDAIHNFDFLKGLDEGVSCASLYEKHSAGLTQGMHAYRKLIYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSVDEYYYYALAIVIMSVVSIISSLYSIRKQYVMLHDMVATHSTVRVSVCRENEEIEEIFSTDLVPGDVMIIPLNGTVMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPS-------VDVKGMGE-----------EQYSPETHKRHTLFCGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVVVAGIGFIYTIINSILNEKEVQEIIIKSLDIITITVPPALPAAMTAGIVYAQRRLKKVGIFCISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVE-NTRFLLPEDNVCSEMLVKSQFVACMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPSKQLLPEPTTAGNQEMELFELPAIYEIGIVRQFPFSSALQRMSVVARTLGEKRMDAYMKGAPEVVASLCKPETVPVDFEKVLEDYTKQGFRVIALAHRKLESKLTWHKVQHISRDAIENNMDFMGLIIMQNKLKQETPAVLEDLHKANIRTVMVTGDNMLTAVSVARDCGMILPQDKVIIAEA-LPPKDGKVAKINWHYTDSLSQ-CSESSAIDSEAIPIKLAHDSLEDLEVTR--YHFAMNGKSFSVILEHFQDLVPKLMLHGTVFARMAPDQKTQLVEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSKTPSISCVPNLIREGRAALMTSFCVFKFMALYSIIQYFSVTLLYSILSNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIVISVGFQSLGFFWVKQ--YKVCDPNSDVCNTTRSACWNSSHLYNGTELDSCKIQNYENTTVFFISSFQYLTVAVAFSKGKPFRQPCYKNYFFVISVIILYVFILFIMLHPVASVDQVLEIMCVPYQW-RIYMLIIVLINAFVSITVEESVDRWGKCCLSWALSCRKKTPKAKYMYLAQEL 1187          
BLAST of Cation-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q5ZKB7|AT134_CHICK (Probable cation-transporting ATPase 13A4 OS=Gallus gallus OX=9031 GN=ATP13A4 PE=2 SV=1)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 471/1209 (38.96%), Postives = 705/1209 (58.31%), Query Frame = 3
Query:  114 GDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIE--QTCTEFYTSLP--LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVC-RDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMAL--CPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQ---IGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-----------------------VLPPH-------SQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFI-EFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPI 3611
            G+ ++ +I+GYK    +  L    YIL+   L L+F+W P W ++ +  PCSL EAD++L +  D+++ Y       + KN   +  S I   R  +      D + +K        +P    +    +K++Y+WN     F+ +  +E   TC+  +T     LT  E   R  + G N I+V + P+  LL+KE LNPFYVFQ+ SV LWF +DY+ YA  I+ MS LS+S+ +YD R+    L+  V S    +V  R+ + F ++ ++ LVPGD++ L     L+ CDA LISG CIVNESMLTGES+PVTKT LP      P+  +  +D                     + +HVLFCGT+VIQ++  +   V AVV++TG+ TAKG+LVRSIL+PKP++ +  +DAL+F+  L  FA +G IYT+ V      E  ++V ++LD+ITI +PPALP A+T GI++ Q RLKKK I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWG++ S+ +  F+D    P++ +L   P   +M  CHSL +++G+I GDPLD+KMF++  W I +   G++ E   S      R   +        I IL QFPFSS+LQRMSVI +  +      + KG+PE+++TLCR ET+P +F SKLL +T  G+RV+ LAY+ L+ S  +   + R EVE +L FLG L+MENRLK ET+ ++E+L AA IR +MVTGDN+ TA++VA++ G+IS  ++VILV+A        + I     A    +P+ E        + + S+         E   FH AMSGK++ ++      L+PKL++   VFAR +P QK+ L+E  Q + Y+V MCGDGANDCGALK AHAGISLSE EASVASPFTS+  +I+CVPELI+EGR AL TSF  FK+MA YS  Q++ VL+LYW + +  +YQFL+ DL + T + ++  +++A  KL    P  +L++  ++ S+IL  + +   QI+ +  V  QPWY                        L  H       ++ +  ++++ N  ++ +S    +++A+VFSKG PFR PIY NY+F+  L+  +   L++VF     L + + L   P+    + +   +     +S+ + E +I+N +L   +K+       Q   +  Y+R++  +  +SA WPP+
Sbjct:   16 GEENEMEIFGYKTQCCRKALCIAGYILSCGALLLLFYWKPEWDVWANCVPCSLEEADVVLLRTTDEFRIY-------SRKNVTWISVSGIIKSRLDYPSFAEEDSIFSKAL-----MKPSLQVKSIQVQKIRYVWNIYAKQFQKVGALEDHHTCSAIHTKFGSGLTCSEQSLRRVICGPNTIDVPVIPIWKLLIKEVLNPFYVFQLFSVCLWFAEDYMEYAAAIIIMSPLSISLTVYDLRQQSVKLQRLVESHNSIMVTGRNKEGFQELESHHLVPGDMVVLKEGKALLPCDAILISGQCIVNESMLTGESIPVTKTQLPQADNLKPWKMHCAED---------------------YKKHVLFCGTEVIQTKGDDRGVVKAVVLQTGFNTAKGDLVRSILYPKPMNFRLYRDALRFLMCLIAFAAIGMIYTVCVFALNGEEAGEVVKKALDVITIAVPPALPAALTTGIIYTQRRLKKKGIFCISPQRINMCGQLNLICFDKTGTLTEDGLDLWGLLPSEGN-CFQDVRRFPADHSLPWGPAFRAMVVCHSLIVLEGKIQGDPLDVKMFEATNWVIDDS-SGHQIEGQRSTHATVIRPGPKANTASVDGITILHQFPFSSALQRMSVIAQ-ETGGEKQAFTKGAPEMVATLCRAETVPSNFESKLLFYTAQGFRVIGLAYKSLQ-SGKQSTDLTREEVESDLTFLGLLIMENRLKRETKPVLEELSAAHIRSVMVTGDNIQTAVTVAKNAGMISPTNRVILVEA--------NKIPGSFSASVTWKPLKENKTEDDGNLDSGSQTGRRIRLAAEPGQFHFAMSGKSYQVVAQYFSHLLPKLLLNATVFARMSPSQKSSLVEEFQKLDYFVGMCGDGANDCGALKVAHAGISLSEQEASVASPFTSRTPSIACVPELIREGRAALVTSFCMFKYMALYSTIQYLGVLLLYWQLNSFGNYQFLFQDLAITTVIGMTMSFTEAYPKLVPYRPPSQLVSPPLLLSVILNILFSLGMQILGFLMVQKQPWYSKTDIHSACLSVNNHVENSSSASSLGLHGVGGGDPTEVDNGYKSYENTTVWLLSTINCLIIALVFSKGKPFRQPIYTNYVFIMVLVGQLGVCLFLVFADIDDLYSKMDLVCTPTTW-RISMVMMLAVTLAVSFLVEEAIIENRALWLWLKKTF-----QYHSKSHYKRLQRVLEQDSA-WPPL 1172          
BLAST of Cation-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q27533|YH2M_CAEEL (Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2)

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 484/1225 (39.51%), Postives = 691/1225 (56.41%), Query Frame = 3
Query:  105 ITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIE------QTCTEFYTSLP-------------LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGV---------------VASKPDGSFEDPVDDPSEMALCP----LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGN----ENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRM----NYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVD---ARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICV------------------IERPD--------------FHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYV--LPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISY-----FIEFVIDNMSLRRQMKR 3515
            +  GD++ T ++ Y+   F+  L + L +LT  I RLI HW  +W + +   PC+   A+ I   D +    + E++  L+                    K N  + T+   +     PE   R+F+++KL+Y+W   +   E++D I       +T  E    +P             LT  E+  R+  +G N+I VQ+ P+L LL+ E + PFYVFQI SVT+W+ D+Y  YA  IV +S  S+ + +Y  R  E  LR+ V S     V R+G T   I +++LVPGDI+ +P  GCLM CD+ L++G  IVNES+LTGESVP+TK                        V+L  E  D VF+++K+S++VLFCGT+V+Q+R +  + V A+V+RT Y T KG+LVRSI++PKP+D +F +D  KFI  LA  +  GFIYTIIVM+ R   + +I++RSLDIITI +PPALP AM++GI+ AQ RLKKK I+CISP+TINTCG INV CFDKTGTLTEDGLD   V               +       F   + + +     P    L++++ATCHSL  I+G + GDPLD+ +FQ   W ++EG++G+       FD   P I   +  + K  +  ++RQF FSSSLQRMSVI  F  R     N  LY KGSPE++ +LC   T+P D+  ++  +   G+R++A+A RPL ++++K  ++ R  VEC+L  LG +VMENR+KP T  +I  L  A IR +MVTGDN+LT LSVAR+CGII    +  LV+     LD Y      ++              SV   + V+ D    S+ +C                   +E P+              +HLA+SG T+A+I  + P+L+ +L     VFAR APDQK  L+E LQ I Y V+MCGDGANDC ALKAAHAGISLS+ EAS+A+PFTSK+ +I CVP +I EGR AL TSFG FK+MAGYS TQF++V+ LYWI   L+D QF+YID+ ++T  ++ +G + A  +L+   P  RLL+   M+S++ Q I   + Q I +F  + QPW+    PP   +    R+    A+F VS+FQYI+LA+V+SKG PFR  ++ N    A  I      L+IV  P + +   L     PSL   + +      N  +SY     F++F +     R + KR
Sbjct:    3 LESGDHTLT-LFAYRTGPFRTILFYALTVLTLGIFRLILHWKQKWDVKMRMVPCTFEAAEYIYIIDNHN---VSELQPVLR--------------------KSNATIPTENGEM--RKVPEL--RWFVYRKLEYVWIDDLNSDESVDEISDNDNCWKTSFEIANRIPCRSLLAVSESNFGLTLSEISRRLEFYGRNEIVVQLRPILYLLVMEVITPFYVFQIFSVTVWYNDEYAYYASLIVILSLGSIVMDVYQIRTQEIRLRSMVHSTESVEVIREG-TEMTIGSDQLVPGDILLIPPHGCLMQCDSVLMNGTVIVNESVLTGESVPITK------------------------VALTDETNDSVFNIEKNSKNVLFCGTQVLQTRFYRGKKVKAIVLRTAYSTLKGQLVRSIMYPKPVDFRFTKDLFKFILFLACISGCGFIYTIIVMIMRGNTLRRIIVRSLDIITITVPPALPAAMSVGIINAQLRLKKKEIFCISPSTINTCGAINVVCFDKTGTLTEDGLDFHVVRPVMSAVNQEIQKVKLEKSNRTEFMGEMTELTSRNGLPFDGDLVKAIATCHSLTRINGVLHGDPLDLILFQKTGWTMEEGIEGDIEEETQRFDNVQPSII--KPTDDKSAEYSVIRQFTFSSSLQRMSVIV-FDPREDRPDNMMLYSKGSPEMILSLCDPNTVPEDYLLQVNSYAQHGFRLIAVARRPLDLNFNKASKVKRDAVECDLEMLGLIVMENRVKPVTLGVINQLNRANIRTVMVTGDNLLTGLSVARECGIIRPSKRAFLVEHVPGELDEYGRTKIFVK-------------QSVSSSDEVIEDDASVSISMCSSTWKGSSEGDGFSPTNTEVETPNPVTADSLGHLIASSYHLAISGPTFAVIVHEYPELVDQLCSVCDVFARMAPDQKQSLVEQLQQIDYTVAMCGDGANDCAALKAAHAGISLSDAEASIAAPFTSKVPDIRCVPTVISEGRAALVTSFGIFKYMAGYSLTQFVTVMHLYWISNILTDGQFMYIDMFLITMFALLFGNTPAFYRLAHTPPPTRLLSIASMTSVVGQLIIIGVVQFIVFFSTSQQPWFTPYQPPVDDEVEDKRSMQGTALFCVSMFQYIILALVYSKGPPFRGNLWSNKPMCALTIFATLLCLFIVIWPTELVLKTLGNVELPSLTFRIFIVIVGAVNAAVSYGFETLFVDFFLLGYWERYKKKR 1158          
BLAST of Cation-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q9CTG6|AT132_MOUSE (Cation-transporting ATPase 13A2 OS=Mus musculus OX=10090 GN=Atp13a2 PE=2 SV=3)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 448/1119 (40.04%), Postives = 646/1119 (57.73%), Query Frame = 3
Query:  192 LTAFILRLIFHWMPRWYIYISHTPCSLREAD--IILAKDQ---YQQYWIHEVK---LTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIE--QTCTEFYTSLPLTEIEVQ-NRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDP-VDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSV----PMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKI--SYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA--HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDN 3488
            + A I  L+F W P W + +   PCSL  A+  +I  KD+    +Q +  +V+   +   + E    +Q    R+  ++    +      + L    + +QV RY++ +  +Y+W      F  +  ++  +TC + + S     ++ Q  R  ++G N I + +   L LL  E LNP+Y FQ  S+ LW  D Y  YA CI  +SA+S+ + LY TRK   +LR+ V       VCR G     ++++ELVPGD + LP+ G +M CDA L++G C+VNES LTGES PV KT LP   G  P+ P +                        H RH LFCGT ++Q+R +    VLAVV RTG+ TAKG LV SIL P+PI  KF + ++KF+  L++ AL+G +Y+II++   R+ V +IVIR+LD++T+++PPALP AMT+  ++AQSRL+ + I+CI P  IN  G + + CFDKTGTLTEDGLD+ GVV  K  G    P V +P  + L PL+ ++ATCH+L+ +     GDP+D+KM +S  W ++EG           +    P     R +E   V + +L +FPFSS+LQRM V+  +        YVKGSPE++++LC  ET+P DFS  L  +T +GYRV+ALA +PL I  S +   ++ R  VE EL  LG LVM N LKP+T  +I+ L+   IR +MVTGDN+ TA++VAR CG++   + + ++ A               + E  Q    E    + + V+N +K +     V E    HLA+SG T+A++R   P+L+PK++V+  VFAR AP+QKT+L+  LQ + Y V MCGDGANDCGALKAA  GISLS+ EASV SPFTS +A+I CVP +I+EGRC+L TSF  FK+MA YS TQFISVL+LY I  NL D QFL IDL++ TT+++    +     L    P   LL+  ++ SL+LQ    A  Q+  YF V  QPW+V P +           + N  +FS+S FQY++LA   SKGAPFR P+Y N  FL  L ++ S  + ++  P   L+  L L +       L+L   V  NF+ ++ +E V+D 
Sbjct:   56 MLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIEIKDKEGSSRQLFTVQVQTEAVVQGSLELPPQAQAEDGRSQAAVGVTPEGTWQDTSELHRQEEAKQVLRYYVLQGQRYVWMETQQAFCQVSLLDHGRTCDDVHCSSSGLSLQDQATRKTIYGPNVISIPVKSYLQLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISICLALYKTRKQSLTLRDMVKLSVRVQVCRPGGEEEWVDSSELVPGDCLVLPQEGGVMPCDAALVAGECVVNESSLTGESTPVLKTALPE--GPKPYCPET------------------------HRRHTLFCGTLILQARAYVGPRVLAVVTRTGFCTAKGGLVSSILHPRPISFKFYKHSMKFVAALSVLALLGTVYSIIILYRNRVPVREIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDVMGVVPLK--GQVLLPLVPEPCHLPLGPLLRALATCHALSQLHDTPVGDPMDLKMVESTGWVLEEGPAAGSAPGSQVLVVMRPPPGGPRQQEEPPVPVSVLCRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCSPETVPSDFSQVLQSYTAAGYRVVALAGKPLPIAPSLAAAQQLTRDTVERELSLLGLLVMRNLLKPQTAPVIQTLRKTGIRTVMVTGDNLQTAVTVARACGMVGAQEHLAVIHAT--------------HPEQGQPAALEFLPTESSAVMNGAKATGYPT-VPEPQSCHLALSGSTFAVLRKHFPKLLPKVLVQATVFARMAPEQKTELVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALTLVRARPPGALLSVPVLGSLLLQVALVAGIQLGGYFLVIAQPWFV-PLNRTVPAPDNLPNYENTVVFSLSGFQYLILAAAVSKGAPFRQPLYTNVPFLVALALLGSVLVGLILVP-GLLQGPLGLRNIVDSSFKLLLLGLVAFNFVGAFMLESVLDQ 1129          
BLAST of Cation-transporting ATPase vs. TrEMBL
Match: A0A267G531 (Cation-transporting ATPase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029214g1 PE=3 SV=1)

HSP 1 Score: 1145.95 bits (2963), Expect = 0.000e+0
Identity = 588/1215 (48.40%), Postives = 820/1215 (67.49%), Query Frame = 3
Query:  105 ITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKT-------------KKTRLLIDYQP-------EQVNRYFIHKKLKYIWNWKILHFEALDGIEQT-CTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKD---------VQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHA---NAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQL----ESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEM 3638
            I  G + ++ IYGY+RN  +  LT+  ++LTAF+LRL+FHW P WY+  +H  CSLR A+ ++ KDQYQQ+++H++ +  + G  VK   +N +  F+S +     ++T              KT +  + QP       + + RYF HKK+KY+W  ++  F  +D    T C+ F+ +  L E + + +   FG N++++ +TP+  L + + L+PFY+FQ+ SVT+WF D Y +YA CIV +S +SLS+ +++T +NE +LR T+VS  H  V R    + +++++ LVPGD+IE+P++GC+M CDA LI+GNCIVNESMLTGESVPV KTPLP+P+     S    +   +Q V  K E+I   F++++H++HVLFCGTKVIQ+R  E   V AVVVRTG++TAKGE++RSILFPKPI+ KFNQD + ++ VL LFAL GF+YT+++M +R   V K++IR+LD+ITI++PPALP AMT+GIVFAQ+RL+K  I+CISPN IN  G +N  CFDKTGTLTEDGLDLWGV+ ++ D +F  PV  P  +A  P +E+MATCH+L  I+GE+ GDPLD+KMF S  W ++E    +  +FD  V  I   R   G+           +IGI+RQF FSSSLQRMSVI +     ++  YVKGSPE++ +LCR ET+P  F   L+ +T  GYRV+ LAY+PL+ISY K  +I R  VE EL FLG LVMENRLKP+T  +I +L  A IRP+MVTGDN+LTALSVARDC II + D VILV     +       ++FHYA DL++ V E+       ++N   P       I   ++HLAM+G++W I+R   P LIPKLVVKG VFARF+PDQK QL+E+LQ +GY V MCGDGANDCGALKAAHAGISLSE EASVASPFTSK  NISCVP LI+EGRCAL TSFG FKFMAGYS  QF+S L+LY+I  NL D QFLY+DL ++TTLSI++GY++A  +++ E PS+RL++   ++S+  Q + NA+FQ +A+ YV+ Q W+  P H  ++V+  +++   N  +F VS++QYI +A+VFSK  P+R  I+ NY  L N++V ++  +Y+   PF WL+N L L       PS+    ++   V+ NFL+SY  E +I+    R  ++RI+  +   S  + EYERI++E+     SWPPI + +S Q+M
Sbjct:   25 INAGCDDESRIYGYRRNQLRTALTYAGFVLTAFLLRLVFHWKPEWYVKCTHDRCSLRRAEKLVIKDQYQQFFVHDICIVTRTGARVKL--VNRRSLFNSCVPDTHCVETGTGVRLLDPFMSAAKTAVATERQPLLSRLEEDALIRYFYHKKIKYVWVSELEGFAKIDVFSNTPCSHFHRTTGLLEEDAELQRVKFGGNRVQIPLTPIWQLFVLKALHPFYIFQVFSVTVWFNDGYWMYATCIVIISTVSLSLSVFETARNERNLRLTLVSSDHVKVARGIDNYTELDSDLLVPGDVIEIPKNGCVMQCDAVLIAGNCIVNESMLTGESVPVLKTPLPDPS-----SSRKKQQLQQQKVRSKPELI---FNVREHNKHVLFCGTKVIQTRFVEGSRVRAVVVRTGFMTAKGEMIRSILFPKPIEFKFNQDVIHYLMVLGLFALAGFVYTVVLMHSRGYPVSKMIIRALDLITIVVPPALPAAMTVGIVFAQTRLRKAKIFCISPNQINVSGTLNAVCFDKTGTLTEDGLDLWGVLPTEGD-TFAQPVHQPDSLASSPFLEAMATCHTLTRIEGELSGDPLDLKMFLSTGWQLEEPERDDHKKFDQLVSTIV--RQPAGQTQPEESQRTPCEIGIVRQFTFSSSLQRMSVIARRLGADHFTAYVKGSPEMVQSLCRPETIPASFHDCLMLYTRQGYRVIGLAYKPLRISYLKAQKIGRESVERELIFLGLLVMENRLKPQTTRVIHELLNANIRPVMVTGDNILTALSVARDCDIIGDQDSVILVQG-TPAEPPFKAQVDFHYAGDLRKKVREVVPEHAFSMLNARDPE----IDIREGNYHLAMTGRSWEIVRANFPHLIPKLVVKGTVFARFSPDQKAQLVEALQQVGYTVGMCGDGANDCGALKAAHAGISLSEAEASVASPFTSKEQNISCVPTLIREGRCALITSFGIFKFMAGYSTAQFMSCLILYYIGCNLIDVQFLYVDLFIITTLSITFGYTRAFPRMAKEVPSMRLMSAVTITSISCQILLNAIFQSMAFLYVHTQSWF-YPFH--RDVMSESYSSYENTMVFLVSMYQYITMAVVFSKSTPYRRTIFSNYFILVNILVTLAVNIYVTLDPFPWLKNALHLWDTPRDNPSVRFKFLVLGAVLMNFLLSYIAEELIEGPWFRMLVRRIRRAVAANS--EKEYERIKDELQQEKGSWPPITRTSSYQDM 1216          
BLAST of Cation-transporting ATPase vs. TrEMBL
Match: A0A4S2LI19 (Cation-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_007439 PE=3 SV=1)

HSP 1 Score: 1136.32 bits (2938), Expect = 0.000e+0
Identity = 605/1297 (46.65%), Postives = 826/1297 (63.69%), Query Frame = 3
Query:   99 QKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGES---VKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEAL---DGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRD--GKT-FCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIA-----FRR---------NREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDAR------LDSYNVNDT-----------------------------------IIEFHYAEDLQRPVSEISVL---------------------------------------------KRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDA 3662
             +I E D +  +I GY  +  K  + +  Y LT  +LRL+FHWMP+W +  +H  C L +A  +L KD    Y++  V  ++   E    VK   +   +       C+  +         D  P  +  YF +KKLKYIW+  +  F  L   DG      + + + PL E  V NR AL+  N+I ++ITP++ LLL + LNPFY FQ  S  LWF DDY +YA CI+ MS LSL IQ+Y+ R+NE +L+ TV       VCR+  G T F Q+++ ELVPGD+IE+PR GC+M+CDA +++GNCIVNES LTGESVPVTKTPLP                       + + +D   +L   +RHVLF GT VIQ+RN+ NE VLA+V RTG+ TAKGELVRSILFPKP+  KF QDALKF+  LA  +++G   +I +M    ++   + +R+LD++TI++PPALPVAMT+GIVFAQ RL+ + IYCI+P  IN CG ++V+CFDKTGTLTEDGLDLWGVV +   G+F +P   P E+   PLIE+M+TCHSL +I+G + GDPLD+KMFQS +W+  E +  +  +F+M+VP I      F           N E    +IGI+RQFPF+SSLQRMSV+ +  +  ++NLYVKG+PE++  LCR++T+P DF S LLQ+T  GYRVLALA+RPLKISY++++RIPR   E +L FLGFLVMENRLKPE+  +I+ L++A IRP+MVTGDNMLTA+SVARDC +I E D++I+V A+      L S N++D                                    ++EFHYAEDL +PV+E++                                               + + V++ +    V I +I+RPDFHLA+SGKTW +I++  P LIPKLVVKG VFARF+PDQKTQLIE+LQS+GY+V+MCGDGANDCGALKAAHAGISLSE EASVASPFTSK  NI CVP L++EGRCAL TSFGTFKFM GYS  QF + ++LY I +N++D QFL+IDL ++TTLS+++GY++A   LSVE P++ L++   + SL  Q   N LFQ+ AY +V+ QPWY+       +   + + +  +F +S +QY +LAIVFSKGAP+R  I  N +F+ NL+V ++ T+Y+   PF  L N  Q+   PS +  LI+ S  +ANF+  Y +E  +D +S RR++  I+  LFP+ V++ +YERIREEI+  + SWPPII+ ASVQ +  E+F + 
Sbjct:   19 SRIYEPDGTPCEIKGYTSSLIKKIIVYISYFLTCGLLRLVFHWMPQWMLKCTHRLCPLPDAQKVLIKDSSGVYFVLRVLASVIEDEGEMMVKPHTVPINKV---APDCSSSM---------DKDP-NITVYFFYKKLKYIWDRDLCQFNLLSEWDGCPYA--KLFPARPLPEHIVLNRRALYEPNEIVLRITPIIKLLLTKCLNPFYCFQAFSCALWFADDYWMYASCILVMSVLSLIIQVYELRRNEIALKKTVCGSALVSVCREVNGLTDFIQVDSTELVPGDLIEIPRKGCVMHCDAFVLTGNCIVNESTLTGESVPVTKTPLP-----------------------ENQQLDGGCNLNTMARHVLFGGTSVIQTRNYANERVLALVARTGFRTAKGELVRSILFPKPMKFKFTQDALKFVLALACISVIGLGLSIYLMYRSEVDTKSMFLRALDLVTIVVPPALPVAMTVGIVFAQRRLRSQDIYCINPGAINVCGVVSVTCFDKTGTLTEDGLDLWGVVPND-QGNFGEPHFKPHELERGPLIETMSTCHSLTLIEGVLSGDPLDLKMFQSTQWEFSEQISEDHCKFEMAVPAIVRPPAKFSSTHLPLESTVNPEMLPYEIGIIRQFPFTSSLQRMSVVARVLNSTHFNLYVKGAPEMIEALCRRDTIPSDFHSVLLQYTREGYRVLALAWRPLKISYTRVLRIPRERAEHDLLFLGFLVMENRLKPESAPVIQTLRSANIRPVMVTGDNMLTAVSVARDCEMIDELDRIIIVSAKPPPKVGLSSTNLDDVAAGDVTVGRTVPVSFPVDANFSAPSSFVAMAHDSPLVEFHYAEDLHKPVTEVTATDGGLRNGHLRPSHPEKTRHLWFRRKWKSHTRSPVTVTVNVDDGAAENDHVIDANHSHRVNIRMIDRPDFHLAISGKTWGVIKEHYPWLIPKLVVKGTVFARFSPDQKTQLIEALQSVGYFVAMCGDGANDCGALKAAHAGISLSEAEASVASPFTSKQQNIGCVPTLVREGRCALVTSFGTFKFMCGYSLVQFFTTILLYAIGSNITDPQFLFIDLFLITTLSVTFGYTRAYAHLSVEPPNMHLVSAVTLMSLGFQLFVNYLFQLGAYLWVSAQPWYINLYEVSDDFELKNYESTVLFIISAYQYSILAIVFSKGAPYRRSIVSNTLFIVNLVVCLAATIYLTTYPFDELLNFFQMVRIPSAIFLLIIHSAALANFMACYLLETFVDGVSFRRRLLHIRRALFPRRVERKDYERIREEIDRMAGSWPPIIRSASVQALPRELFNEG 1276          
BLAST of Cation-transporting ATPase vs. TrEMBL
Match: A0A4S2LFV3 (Cation-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_007439 PE=3 SV=1)

HSP 1 Score: 1135.55 bits (2936), Expect = 0.000e+0
Identity = 604/1296 (46.60%), Postives = 825/1296 (63.66%), Query Frame = 3
Query:  102 KITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGES---VKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEAL---DGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRD--GKT-FCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIA--------------FRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDAR------LDSYNVNDT-----------------------------------IIEFHYAEDLQRPVSEISVL---------------------------------------------KRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDA 3662
            +I E D +  +I GY  +  K  + +  Y LT  +LRL+FHWMP+W +  +H  C L +A  +L KD    Y++  V  ++   E    VK   +   +       C+  +         D  P  +  YF +KKLKYIW+  +  F  L   DG      + + + PL E  V NR AL+  N+I ++ITP++ LLL + LNPFY FQ  S  LWF DDY +YA CI+ MS LSL IQ+Y+ R+NE +L+ TV       VCR+  G T F Q+++ ELVPGD+IE+PR GC+M+CDA +++GNCIVNES LTGESVPVTKTPLP                       + + +D   +L   +RHVLF GT VIQ+RN+ NE VLA+V RTG+ TAKGELVRSILFPKP+  KF QDALKF+  LA  +++G   +I +M    ++   + +R+LD++TI++PPALPVAMT+GIVFAQ RL+ + IYCI+P  IN CG ++V+CFDKTGTLTEDGLDLWGVV +   G+F +P   P E+   PLIE+M+TCHSL +I+G + GDPLD+KMFQS +W+  E +  +  +F+M+VP I                  N E    +IGI+RQFPF+SSLQRMSV+ +  +  ++NLYVKG+PE++  LCR++T+P DF S LLQ+T  GYRVLALA+RPLKISY++++RIPR   E +L FLGFLVMENRLKPE+  +I+ L++A IRP+MVTGDNMLTA+SVARDC +I E D++I+V A+      L S N++D                                    ++EFHYAEDL +PV+E++                                               + + V++ +    V I +I+RPDFHLA+SGKTW +I++  P LIPKLVVKG VFARF+PDQKTQLIE+LQS+GY+V+MCGDGANDCGALKAAHAGISLSE EASVASPFTSK  NI CVP L++EGRCAL TSFGTFKFM GYS  QF + ++LY I +N++D QFL+IDL ++TTLS+++GY++A   LSVE P++ L++   + SL  Q   N LFQ+ AY +V+ QPWY+       +   + + +  +F +S +QY +LAIVFSKGAP+R  I  N +F+ NL+V ++ T+Y+   PF  L N  Q+   PS +  LI+ S  +ANF+  Y +E  +D +S RR++  I+  LFP+ V++ +YERIREEI+  + SWPPII+ ASVQ +  E+F + 
Sbjct:   20 RIYEPDGTPCEIKGYTSSLIKKIIVYISYFLTCGLLRLVFHWMPQWMLKCTHRLCPLPDAQKVLIKDSSGVYFVLRVLASVIEDEGEMMVKPHTVPINKV---APDCSSSM---------DKDP-NITVYFFYKKLKYIWDRDLCQFNLLSEWDGCPYA--KLFPARPLPEHIVLNRRALYEPNEIVLRITPIIKLLLTKCLNPFYCFQAFSCALWFADDYWMYASCILVMSVLSLIIQVYELRRNEIALKKTVCGSALVSVCREVNGLTDFIQVDSTELVPGDLIEIPRKGCVMHCDAFVLTGNCIVNESTLTGESVPVTKTPLP-----------------------ENQQLDGGCNLNTMARHVLFGGTSVIQTRNYANERVLALVARTGFRTAKGELVRSILFPKPMKFKFTQDALKFVLALACISVIGLGLSIYLMYRSEVDTKSMFLRALDLVTIVVPPALPVAMTVGIVFAQRRLRSQDIYCINPGAINVCGVVSVTCFDKTGTLTEDGLDLWGVVPND-QGNFGEPHFKPHELERGPLIETMSTCHSLTLIEGVLSGDPLDLKMFQSTQWEFSEQISEDHCKFEMAVPAIVRPPAKFSSTHLPLESTVNPEMLPYEIGIIRQFPFTSSLQRMSVVARVLNSTHFNLYVKGAPEMIEALCRRDTIPSDFHSVLLQYTREGYRVLALAWRPLKISYTRVLRIPRERAEHDLLFLGFLVMENRLKPESAPVIQTLRSANIRPVMVTGDNMLTAVSVARDCEMIDELDRIIIVSAKPPPKVGLSSTNLDDVAAGDVTVGRTVPVSFPVDANFSAPSSFVAMAHDSPLVEFHYAEDLHKPVTEVTATDGGLRNGHLRPSHPEKTRHLWFRRKWKSHTRSPVTVTVNVDDGAAENDHVIDANHSHRVNIRMIDRPDFHLAISGKTWGVIKEHYPWLIPKLVVKGTVFARFSPDQKTQLIEALQSVGYFVAMCGDGANDCGALKAAHAGISLSEAEASVASPFTSKQQNIGCVPTLVREGRCALVTSFGTFKFMCGYSLVQFFTTILLYAIGSNITDPQFLFIDLFLITTLSVTFGYTRAYAHLSVEPPNMHLVSAVTLMSLGFQLFVNYLFQLGAYLWVSAQPWYINLYEVSDDFELKNYESTVLFIISAYQYSILAIVFSKGAPYRRSIVSNTLFIVNLVVCLAATIYLTTYPFDELLNFFQMVRIPSAIFLLIIHSAALANFMACYLLETFVDGVSFRRRLLHIRRALFPRRVERKDYERIREEIDRMAGSWPPIIRSASVQALPRELFNEG 1276          
BLAST of Cation-transporting ATPase vs. TrEMBL
Match: A0A267G6L1 (Cation-transporting ATPase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034017g3 PE=3 SV=1)

HSP 1 Score: 1116.29 bits (2886), Expect = 0.000e+0
Identity = 596/1242 (47.99%), Postives = 818/1242 (65.86%), Query Frame = 3
Query:   93 LNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKC------NDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDG-IEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEM-ALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKD-----------VQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA-HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESF----PSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEE 3746
            L + + +G + ++ I GY+RN  KI L +  Y+ +AF+LRL+FHW+P  ++  +H  CSL  AD ++ KDQY Q ++H+V++  K+G  V+      +R+   + +C       D+     T LL  +  + + RYF HKKLKY+WN     F  ++  ++  C+ F+ +  LTE +       FGEN++ + +TP+  L   + L+PFY+FQ+ SV LWF D+Y +YA CIV +S LSLS+ +++T +NE +LR T+VS     V R    +  IN++ LVPGD+IE+P+ GC+M CDA L+SGNCIVNESMLTGESVPV KTPL            S  +SG                 + H+++VLFCGT VIQ+R  E+  V AVV+RTG+ TAKGE+VRSILFPKPI+ KFN+D + ++ VL+LFAL GFIYTI++M++R   V KI++R+LD+ITII+PPALP AMT+GIVFAQ+RL+K +I+CI+PNTIN  GG+N  CFDKTGTLTEDGLDLWGVV  + +  F+ P  +P  + +  PL+E+MA CH+L  I GE+ GDPLD+KMFQ  +W ++E    +  +FD  V  +      E  D            Q+GI+RQFPFSSSLQRMSV+ +     ++  YVKGSPE++  L R ++LP  FS +LL +T  GYRVLALAY+PL++SY K+ ++ R  VE +L FLG LVMENRLKP+T  +I  L  A IRP+MVTGDN+LTALSVARDC +I + D VILV A   +       ++FHYA DLQR V E+       + N   P       I+  ++HLAM+G++W I+R+  P LIPKLVVKG VFARF+PDQK QL+ESLQ +GY V MCGDGANDCGALKAAHAGISLSE EASVASPFTSK  NISCVP LI+EGRCA+ TSFGTFKFMAGYS TQF+S L+LY+I ANL+D QFLYIDL ++TTLSI++GY+KA  +LS E PS+RL++T  ++S+ LQ + N  FQ +A+ YV  Q W+  P H        A + N A++ VS FQYI LA+ FSK  P+R  I  N +FL NL++VI  ++Y+  KPF WL N L+L       PSL    ++   V+ NFL+S   E ++D  + R  ++ ++  L  +   + EYERIR+E+  +  +WPPI + AS++++  +     ++ H  Q  Q   +  DD+ D+    E+
Sbjct:   17 LAEILNQGQDDESRILGYRRNPAKIVLVYIGYVTSAFLLRLLFHWLPELHVRCTHDRCSLDLADKVVVKDQYGQLFVHDVQMMTKSGARVRL----LRRSRAGLNQCLPDEHATDETTGSATPLLDPFSEDSLTRYFFHKKLKYVWNSDQQLFVKIEVFVDTPCSFFHHTAGLTESDAARHRVRFGENRVNIPLTPIPKLFAVKALHPFYLFQLFSVILWFNDEYEMYASCIVVISLLSLSLSVFETARNERNLRKTLVSSNEICVARGLDNYVSINSDLLVPGDVIEIPKGGCVMQCDAVLVSGNCIVNESMLTGESVPVLKTPL------------SAAESGP-------------ISTRDHNKNVLFCGTHVIQTRFVESGRVRAVVLRTGFATAKGEMVRSILFPKPIEFKFNKDIVHYLIVLSLFALAGFIYTIVLMLHRDYPVGKIMLRALDLITIIVPPALPAAMTVGIVFAQTRLRKANIFCIAPNTINISGGLNAVCFDKTGTLTEDGLDLWGVVPVE-ERRFQSPNPEPHSLPSPSPLLEAMAVCHTLTRIRGELSGDPLDLKMFQGTRWVLEEPEQDDYRKFDQLVSTVVRPPGSEPVDNIDSIDPDRLPYQLGIIRQFPFSSSLQRMSVVARRLGADHFTAYVKGSPEMVQALSRPDSLPDRFSEQLLHYTRQGYRVLALAYKPLRVSYLKVQKLARESVERDLIFLGLLVMENRLKPQTTLVIHQLLNASIRPVMVTGDNILTALSVARDCDMIGDRDAVILVQA-TPAQPPFQAQLDFHYAGDLQRKVHEVVPEHAYSLPNTRDPE----IDIKEGNYHLAMTGRSWEIVRNHFPHLIPKLVVKGTVFARFSPDQKAQLVESLQQVGYTVGMCGDGANDCGALKAAHAGISLSEAEASVASPFTSKEQNISCVPTLIREGRCAIVTSFGTFKFMAGYSITQFVSCLILYYIGANLTDGQFLYIDLFIITTLSITFGYTKAYPQLSKEAPSLRLMSTVTIASICLQSLLNIAFQTLAFLYVQTQDWF-FPFHMDITADEYASYENTAVYLVSSFQYITLAVAFSKSQPYRLTIPSNRLFLVNLLLVIGASIYVTIKPFPWLLNFLELVKMPMDSPSLQFTSLVLGIVLMNFLLSNIAEELVDGTAFRLFIRGLRRRLRGRQARK-EYERIRDELVQDEGAWPPISRSASLEDVAQQDLIKFADEHQQQPRQHQGA--DDEDDVQHRDED 1219          
BLAST of Cation-transporting ATPase vs. TrEMBL
Match: A0A267EAN3 (Cation-transporting ATPase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034017g1 PE=3 SV=1)

HSP 1 Score: 1115.14 bits (2883), Expect = 0.000e+0
Identity = 596/1242 (47.99%), Postives = 818/1242 (65.86%), Query Frame = 3
Query:   93 LNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKC------NDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDG-IEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEM-ALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKD-----------VQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRA-HANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESF----PSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEE 3746
            L + + +G + ++ I GY+R+  KI L +  Y+ +AF+LRL+FHW+P  ++  +H  CSL  AD ++ KDQY Q ++H+V++  K+G  V+      +R+   + +C       D+     T LL  +  + + RYF HKKLKY+WN     F  ++  ++  C+ F+ +  LTE +       FGEN++ + +TP+  L   + L+PFY+FQ+ SV LWF D+Y +YA CIV +S LSLS+ +++T +NE +LR T+VS     V R    +  IN++ LVPGD+IE+P+ GC+M CDA L+SGNCIVNESMLTGESVPV KTPL            S  +SG                 + H+++VLFCGT VIQ+R  E+  V AVV+RTG+ TAKGE+VRSILFPKPI+ KFN+D + ++ VL+LFAL GFIYTI++M++R   V KI++R+LD+ITII+PPALP AMT+GIVFAQ+RL+K +I+CI+PNTIN  GG+N  CFDKTGTLTEDGLDLWGVV  + +  F+ P  +P  + +  PL+E MA CH+L  I GE+ GDPLD+KMFQ  +W ++E    +  +FD  V  +      E  D            Q+GI+RQFPFSSSLQRMSV+ +     ++  YVKGSPE++  L R ++LP  FS +LL +T  GYRVLALAY+PL++SY K+ ++ R  VE +L FLG LVMENRLKP+T  +I  L  A IRP+MVTGDN+LTALSVARDC +I + D VILV A   +       ++FHYA DLQR V E+       + N   P       I+  ++HLAM+G++W I+R+  P LIPKLVVKG VFARF+PDQK QL+ESLQ +GY V MCGDGANDCGALKAAHAGISLSE EASVASPFTSK  NISCVP LI+EGRCA+ TSFGTFKFMAGYS TQF+S L+LY+I ANL+D QFLYIDL ++TTLSI++GY+KA  +LS E PS+RL++T  ++S+ LQ + N  FQ +A+ YV  Q W+  P H        A + N A++ VS FQYI LA+ FSK  P+R  I  N +FL NL++VI  ++Y+  KPF WL N L+L       PSL    ++   V+ NFL+S   E ++D  + R  ++ ++  L  +   + EYERIR+E+  +  +WPPI + AS++++  +     ++ H  Q  Q L +  DD+ D+    E+
Sbjct:   22 LAEILNQGQDDESRILGYRRSPAKIVLVYIGYVTSAFLLRLLFHWLPELHVRCTHDRCSLDLADKVVVKDQYGQLFVHDVQMMTKSGARVRL----LRRSRAGLNQCLPDEHATDETTGSATPLLDPFSEDSLTRYFFHKKLKYVWNSDQQLFVKIEVFVDTPCSFFHHTAGLTESDAARHRVRFGENRVNIPLTPIPKLFAVKALHPFYLFQLFSVILWFNDEYEMYASCIVVISLLSLSLSVFETARNERNLRKTLVSSNEICVARGLDNYVSINSDLLVPGDVIEIPKGGCVMQCDAVLVSGNCIVNESMLTGESVPVLKTPL------------SAAESGP-------------ISTRDHNKNVLFCGTHVIQTRFVESGRVRAVVLRTGFATAKGEMVRSILFPKPIEFKFNKDIVHYLIVLSLFALAGFIYTIVLMLHRDYPVGKIMLRALDLITIIVPPALPAAMTVGIVFAQTRLRKANIFCIAPNTINISGGLNAVCFDKTGTLTEDGLDLWGVVPVE-ERRFQSPNPEPHSLPSPSPLLEVMAVCHTLTRIRGELSGDPLDLKMFQGTRWVLEEPEQDDYRKFDQLVSTVVRPPGSEPVDNIDSIDPDRLPYQLGIIRQFPFSSSLQRMSVVARRLGADHFTAYVKGSPEMVQALSRPDSLPDRFSEQLLHYTRQGYRVLALAYKPLRVSYLKVQKLARESVERDLIFLGLLVMENRLKPQTTLVIHQLLNASIRPVMVTGDNILTALSVARDCDMIGDRDAVILVQA-TPAQPPFQAQLDFHYAGDLQRKVHEVVPEHAYSLPNTRDPE----IDIKEGNYHLAMTGRSWEIVRNHFPHLIPKLVVKGTVFARFSPDQKAQLVESLQQVGYTVGMCGDGANDCGALKAAHAGISLSEAEASVASPFTSKEQNISCVPTLIREGRCAIVTSFGTFKFMAGYSITQFVSCLILYYIGANLTDGQFLYIDLFIITTLSITFGYTKAYPQLSKEAPSLRLMSTVTIASICLQSLLNIAFQTLAFLYVQTQDWF-FPFHMDITADEYASYENTAVYLVSSFQYITLAVAFSKSQPYRLTIPSNRLFLVNLLLVIGASIYVTIKPFPWLLNFLELVKMPMDSPSLQFTALVLGIVLMNFLLSNIAEELVDGTAFRLFIRGLRRRLRGRQARK-EYERIRDELVQDEGAWPPISRSASLEDVAQQDLIKFADEHQQQPRQHLRA--DDEDDVQHRDED 1224          
BLAST of Cation-transporting ATPase vs. Ensembl Cavefish
Match: atp13a2 (ATPase cation transporting 13A2 [Source:NCBI gene;Acc:103029693])

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 443/1142 (38.79%), Postives = 674/1142 (59.02%), Query Frame = 3
Query:  123 SKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEV-KLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT-SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCR-DGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNF--ENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVD--GNENEFD-------MSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSE---ISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAH-ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDN 3488
            S  D+ GY+R  ++++L     + +  +L ++F+W PR  +    T C L  AD +L +D Y Q ++ EV  + ++ G    A     +  +   ++ + + KT             V RY++ + ++Y+W  +   F  +  + +  TC + +     L+  +  +R  +FG+N I+V +     LL +E LNPFY+FQ+ S+ LW  D Y  YA CI  +S +S+++ LY+ RK   +LR     I +  V R  G+  C +++ ELVPGD + +P  G L+ CDA L++G C+VNESMLTGES+PV KTPL                           V  E +  +   RH LFCGT++IQ+R      +  LAVV RTG+ TAKG+LV SIL+P+P++ +F +DA+KF+  L   AL+G IY+I+++        +++IRSLDI+TI++PPALP A+T G ++AQ RLKK  ++CISP  IN CG I++ CFDKTGTLTE+GLD+WGV      G F+D V DP  +   P++ ++A+CHS+ ++  +  GDPL++KM +S  W ++E  +  G   EF        M  P   F+         + I+R+FPFSS+LQRMSV        +   ++KGSPE++++ C KE++P  F++ + +FT  G+RVLALAY+ L  + + +  I R ++E +++FLG LVM+N+LKPE+  +I  L+ A IRP+MVTGDN+LTAL+VAR C ++S  +KVI V A   + N   ++ +FH  E     VS    +  L +    N  K             +HLA++GK++A + D  P+ +PK++++G VFAR APDQKTQL+ +LQ + Y V MCGDGANDCGAL+AA  G+SLSE EASVASPFTSK  NISCVP LI+EGRC+L TSF  FK+MA YS  QF SVL+LY +  NL D QFL+ DL ++T L+I  G       L+ + P   LLT  +  +L+L  +   L Q+   F    Q WY+    +Q    +  +  +  +F VS FQYI ++I+ +KG P++ P++ N +F+  L+V+ +   ++V  P   +  +LQL     +  +++L +    NF+I YF+E +I+ 
Sbjct:   35 SHMDVQGYRRVCWRVWLCRFGAVCSLGMLLVLFNWRPRLAVLARCTSCPLPMADTLLLRDIYGQQFVIEVCTVEVEEGSFEHAGGEVDENEWRDNVQLHKEQKT-------------VLRYYVFEGMRYVWMPRKGAFCKVSVLSEGWTCADLHRLQQGLSRADQSSRQQIFGDNIIDVPVKSYGQLLFEEVLNPFYMFQVFSIILWMSDRYYYYAVCIFVISFISIAVSLYEIRKQSTTLRQMAQLIVNVTVRRATGEEEC-VSSVELVPGDCVVIPAEGLLLPCDAALLAGECMVNESMLTGESIPVMKTPL--------------------------SVSGETYSPESQRRHTLFCGTQIIQARGGCPGGKGALAVVTRTGFFTAKGDLVSSILYPQPLNFRFYRDAMKFLLFLGCLALIGTIYSIVMLYRSNTTWEQLIIRSLDIVTIVVPPALPAAITTGTIYAQHRLKKHGVFCISPPRINICGKISLFCFDKTGTLTEEGLDVWGVKVKNKSG-FDDLVPDPRLLPPGPMLSALASCHSVALLGDQAIGDPLELKMIESTGWSLQEPANESGVSPEFGSYRTLAVMRPPAAEFQPEGISISQPVAIVRRFPFSSALQRMSVAVVGPGGGSPCSFLKGSPEMVASYCVKESVPSQFTNTVQEFTSEGFRVLALAYKELG-AETDLSSIERVDLERDMQFLGLLVMKNQLKPESAGVITTLRRAQIRPVMVTGDNILTALNVARACRMVSSHEKVIFVHASPPTANSMASL-QFHRGESGAASVSTQETMDFLDQGLYQNSLK-------------YHLAINGKSFAALCDHFPEYLPKVLMRGTVFARMAPDQKTQLVRALQKLNYRVGMCGDGANDCGALRAADVGVSLSEAEASVASPFTSKSDNISCVPLLIREGRCSLVTSFSLFKYMALYSLIQFSSVLILYTVKTNLGDLQFLFFDLALVTLLAIVMGRGGPSDDLTPQRPPASLLTLPLTCTLLLHTLFLILTQVCVLFITMSQEWYIPLNSTQAGAANLPNMEDTGVFDVSGFQYIFMSIIVTKGYPYKKPLFYNVVFVFVLVVLFTVMSWLVMFPRGPVHRVLQLYQINDMSYSMLLVALAALNFIICYFLEDLIER 1120          
BLAST of Cation-transporting ATPase vs. Ensembl Cavefish
Match: atp13a2 (ATPase cation transporting 13A2 [Source:NCBI gene;Acc:103029693])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 437/1133 (38.57%), Postives = 665/1133 (58.69%), Query Frame = 3
Query:  123 SKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEV-KLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ--TCTEFYT-SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCR-DGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNF--ENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVS---EISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAH-ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDN 3488
            S  D+ GY+R  ++++L     + +  +L ++F+W PR  +    T C L  AD +L +D Y Q ++ EV  + ++ G    A     +  +   ++ + + KT             V RY++ + ++Y+W  +   F  +  + +  TC + +     L+  +  +R  +FG+N I+V +     LL +E LNPFY+FQ+ S+ LW  D Y  YA CI  +S +S+++ LY+ RK   +LR     I +  V R  G+  C +++ ELVPGD + +P  G L+ CDA L++G C+VNESMLTGES+PV KTPL                           V  E +  +   RH LFCGT++IQ+R      +  LAVV RTG+ TAKG+LV SIL+P+P++ +F +DA+KF+  L   AL+G IY+I+++        +++IRSLDI+TI++PPALP A+T G ++AQ RLKK  ++CISP  IN CG I++ CFDKTGTLTE+GLD+WGV      G F+D V DP  +   P++ ++A+CHS+ ++  +  GDPL++KM +S  W I +                            + I+R+FPFSS+LQRMSV        +   ++KGSPE++++ C KE++P  F++ + +FT  G+RVLALAY+ L  + + +  I R ++E +++FLG LVM+N+LKPE+  +I  L+ A IRP+MVTGDN+LTAL+VAR C ++S  +KVI V A   + N   + ++FH  E     VS    +  L +    N  K             +HLA++GK++A + D  P+ +PK++++G VFAR APDQKTQL+ +LQ + Y V MCGDGANDCGAL+AA  G+SLSE EASVASPFTSK  NISCVP LI+EGRC+L TSF  FK+MA YS  QF SVL+LY +  NL D QFL+ DL ++T L+I  G       L+ + P   LLT  +  +L+L  +   L Q+   F    Q WY+    +Q    +  +  +  +F VS FQYI ++I+ +KG P++ P++ N +F+  L+V+ +   ++V  P   +  +LQL     +  +++L +    NF+I YF+E +I+ 
Sbjct:   25 SHMDVQGYRRVCWRVWLCRFGAVCSLGMLLVLFNWRPRLAVLARCTSCPLPMADTLLLRDIYGQQFVIEVCTVEVEEGSFEHAGGEVDENEWRDNVQLHKEQKT-------------VLRYYVFEGMRYVWMPRKGAFCKVSVLSEGWTCADLHRLQQGLSRADQSSRQQIFGDNIIDVPVKSYGQLLFEEVLNPFYMFQVFSIILWMSDRYYYYAVCIFVISFISIAVSLYEIRKQSTTLRQMAQLIVNVTVRRATGEEEC-VSSVELVPGDCVVIPAEGLLLPCDAALLAGECMVNESMLTGESIPVMKTPL--------------------------SVSGETYSPESQRRHTLFCGTQIIQARGGCPGGKGALAVVTRTGFFTAKGDLVSSILYPQPLNFRFYRDAMKFLLFLGCLALIGTIYSIVMLYRSNTTWEQLIIRSLDIVTIVVPPALPAAITTGTIYAQHRLKKHGVFCISPPRINICGKISLFCFDKTGTLTEEGLDVWGVKVKNKSG-FDDLVPDPRLLPPGPMLSALASCHSVALLGDQAIGDPLELKMIESTGWSISQ---------------------------PVAIVRRFPFSSALQRMSVAVVGPGGGSPCSFLKGSPEMVASYCVKESVPSQFTNTVQEFTSEGFRVLALAYKELG-AETDLSSIERVDLERDMQFLGLLVMKNQLKPESAGVITTLRRAQIRPVMVTGDNILTALNVARACRMVSSHEKVIFVHASPPTANSMAS-LQFHRGESGAASVSTQETMDFLDQGLYQNSLK-------------YHLAINGKSFAALCDHFPEYLPKVLMRGTVFARMAPDQKTQLVRALQKLNYRVGMCGDGANDCGALRAADVGVSLSEAEASVASPFTSKSDNISCVPLLIREGRCSLVTSFSLFKYMALYSLIQFSSVLILYTVKTNLGDLQFLFFDLALVTLLAIVMGRGGPSDDLTPQRPPASLLTLPLTCTLLLHTLFLILTQVCVLFITMSQEWYIPLNSTQAGAANLPNMEDTGVFDVSGFQYIFMSIIVTKGYPYKKPLFYNVVFVFVLVVLFTVMSWLVMFPRGPVHRVLQLYQINDMSYSMLLVALAALNFIICYFLEDLIER 1074          
BLAST of Cation-transporting ATPase vs. Ensembl Cavefish
Match: ATP13A3 (ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 352/711 (49.51%), Postives = 478/711 (67.23%), Query Frame = 3
Query:  903 ANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFD-------------MSVPMIAFRRNREGKDV----QIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANL--SDYQFLYI 2966
            + +LVPGD++ +P +G +M CDA LISG CIVNESMLTGESVPVTKT LPNP       P   K + E          D+V+ +++H RH LFCGT VIQ+R +  E V AVVVRTG+ TAKG+LVRSIL+PKP D K  +DA  F+  L   A +GF+Y+I++ +  ++    I+I SLDIITI +PPALP A+T GIV+AQ RLKK  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWGV   + +GSF    ++  +  L     +  MATCHSL  I+G++ GDPLD+KMF++  W ++E  +   +  +             +  P ++  ++ E  ++    +IGI+RQFPFSS+LQRMSV+ +       + YVKG+PEV++ LC++ET+P DFS  L  +T  G+RV+ALA+R L  K+++ K+  + R  +E  + FLG ++M+N+LK ET  ++EDL+ A IR +MVTGDNMLTA+SVARDCG+I   D+VI+ DA L   +     I + YA++  +   + +VL+    +       +++  +E+  +H AMSGK++A+I +    L+ KLV+ G VFAR APDQKTQL+E+LQS+ Y+V MCGDGANDCGALK AH GISLSE EASVASPFTS+  NISCVP LI+EGR AL TSF  FKFMA YS  Q+ISV +LY++   L  SD +F YI
Sbjct:   54 STDLVPGDVMVIPSNGTIMPCDAVLISGTCIVNESMLTGESVPVTKTNLPNP-------PPGEKGAEE----------DQVYSIEEHKRHTLFCGTNVIQTRFYSGELVKAVVVRTGFSTAKGQLVRSILYPKPTDFKLYRDAYMFLLCLVGVAGIGFVYSIVLSIMNKVPAKTIIIESLDIITITVPPALPAALTAGIVYAQRRLKKLGIFCISPQRINICGQLNLICFDKTGTLTEDGLDLWGVQRVE-NGSFHHTEENAYKENLVKTHFVACMATCHSLTKIEGQLSGDPLDLKMFEATGWILEEATEEETSLHNRIMPTVVRPPKQLLPEPAMSPEQDMELYELSVSYEIGIVRQFPFSSALQRMSVVARLLGEKRMDAYVKGAPEVVAGLCKRETVPPDFSEVLEDYTKQGFRVIALAHRRLESKLTWHKVQNVNRDHIESNMEFLGLIIMQNKLKAETPGVLEDLRRANIRTVMVTGDNMLTAISVARDCGMIPPQDRVIIADA-LPPKDGQAAKINWRYADNPSKLSGKPAVLEIPYKL-------MEVSAVEQ--YHFAMSGKSFAVITEHFQDLLQKLVLHGTVFARMAPDQKTQLVETLQSVDYFVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSRTPNISCVPNLIREGRAALITSFCVFKFMALYSIIQYISVTLLYYVSVFLQFSD-RFQYI 735          
BLAST of Cation-transporting ATPase vs. Ensembl Cavefish
Match: ATP13A3 (ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113])

HSP 1 Score: 282.722 bits (722), Expect = 1.041e-83
Identity = 180/403 (44.67%), Postives = 248/403 (61.54%), Query Frame = 3
Query: 2295 MLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYID-----LIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVID 3485
            MLTA+SVARDCG+I   D+VI+ DA L   +     I + YA++  +   + +VL+  ++  D KP   K   +E+  +H AMSGK++A+I +    L+ KLV+ G VFAR APDQKTQL+E+LQS+ Y+V MCGDGANDCG    AH GISLSE EASVASPFTS+  NISCVP LI EGR AL TSF  FKFMA YS  Q+ISV +LY+I++NL D+QFL+ID     LIV T+L      + A  +L    P   L++  ++ S++ Q +    FQ +A+  V H+PWY    P S +  I   + N  +F VS FQY+++AIVFSKG PFR P YKN  F+ +++ +  F   I+  P   +   L+      +   L +   V+AN  +S  +E  +D
Sbjct:    1 MLTAISVARDCGMIPPQDRVIIADA-LPPKDGQAAKINWRYADNPSKLSGKPAVLEV-QISLDDKPEEQK--AVEQ--YHFAMSGKSFAVITEHFQDLLQKLVLHGTVFARMAPDQKTQLVETLQSV-YFVGMCGDGANDCGR---AHGGISLSELEASVASPFTSRTPNISCVPNLI-EGRAALITSFCVFKFMALYSIIQYISVTLLYYILSNLGDFQFLFIDIAIILLIVFTSL------NSAWKELVSRRPPSGLISGPLLFSVMTQILICLGFQTLAFLMVRHEPWYETWTPESDEHNIMN-YENTTLFYVSSFQYLIVAIVFSKGKPFRQPSYKN-PFMLSVLSLYVFLFAIMLFPVPEIDEFLEQIVCVPMKWRLTMVFIVLANAAVSVLVEGGLD 384          
BLAST of Cation-transporting ATPase vs. Ensembl Cavefish
Match: atp13a1 (ATPase 13A1 [Source:NCBI gene;Acc:103035743])

HSP 1 Score: 299.671 bits (766), Expect = 1.378e-83
Identity = 235/779 (30.17%), Postives = 383/779 (49.17%), Query Frame = 3
Query:  483 FIHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIA--LFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRS--GCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSR-HVLFCGTKVIQSR-----NFENEPV----LAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMV-NRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDD-PSEMALCPLIESMATCHSL-NIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKF----SSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL-KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISL 2753
            F  +K++Y+++ +  HF  +         ++ +    + E + R A   +G N+ E+ +   L L  +    PF+VFQ+  V LW LD+Y  Y+   +FM     +  +    +N + +R          V R+ K +  I+++ELVPGDI+ + RS    L+ CD  L+ G CIV+E+MLTGESVP  K P+ +        P                  + + DL+  SR HV+  GTKV+Q       +   +PV    +A V+RTG+ T++G+L+R+ILF        N +   FI  L +FA+   +Y  +    +     YK+ +    I+T ++PP LP+ +++ +  +   L K  ++C  P  I   G + + CFDKTGTLT D L + GV   +  G    PV + P E         +ATCHSL  + DG++ GDPL+  M  +  W + +    +E  F  ++           K   + I ++F F+S+L+RMSV+  +    S+   Y   VKG+PE L  +  +   P  +     + +  G RVLAL Y+ +  +S+ ++  + R  +EC+L F GF+V+   LK +++++I +++ A    +M+TGDN LTA  VAR+   I +   +IL            T  E+ + E +              V     P S+   ++ R D  +   G T  +  D  P+L+  L+    VFAR +P QK  +I SL+ +G+   MCGDG ND GALK AH G++L
Sbjct:  121 FEFQKIRYVFDRERKHFLPVAFPVDHPMSYFQTWRGYQEEAELRAAEKRYGTNRAEMVVPDFLELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLFMLVAFEASLVQQQMRNMSEIRRMGNKPYMIQVYRNRK-WRPISSDELVPGDIVSIGRSPQENLVPCDVLLLRGRCIVDEAMLTGESVPQMKEPVED------LDP------------------ERILDLQADSRLHVISGGTKVVQHSPPLRASAGLKPVDNGCVAYVLRTGFYTSQGKLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAVYVWVEGTKDLSRNKYKLFLECTLILTSVVPPELPIELSLAVNTSLIALAKLYVFCTEPFRIPFAGKVEICCFDKTGTLTSDSLVVRGVAGLRYKGKEVMPVSEIPVETH-----RVVATCHSLVTLDDGQLVGDPLEKAMLTAADWTLTK----DEKVFPRAI-----------KTPGLKIHQRFHFASALKRMSVLASYEKLGSTEFCYISTVKGAPETLRNMFSQ--CPDSYDEVHREMSREGARVLALGYKEMGHLSHQQVREMSREALECDLTFAGFMVVSCPLKNDSKAVIREIQEASHHVVMITGDNPLTACHVARELHFIQKEHTLIL--------QPGPTQDEWQW-ESID-----------GSVTVPLPPPSIS-GLVSRYDLCVTGEGLT-RLTHD--PRLLSALLPHVQVFARVSPKQKEFVITSLKGLGFITLMCGDGTNDVGALKHAHIGVAL 828          

HSP 2 Score: 60.8474 bits (146), Expect = 1.085e-8
Identity = 65/257 (25.29%), Postives = 116/257 (45.14%), Query Frame = 3
Query: 2763 EASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEV-----IHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNY-----IFLANLIVVISFTLYIVFKP-FQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLR 3500
            +AS+A+PFTSK+++I C+  +IK+GRC L T+   FK +A  +     S  +LY      SD+Q     L+ L    +    SK    LS E P   +     + +++LQ+  +  F  + Y Y   Q     PP  ++ V        +  N+ ++ +S+   +    +  KG PF   + +N      I L+ L +V    L     P F     L+ + +   L++  +L    +A  L+   ++F++   +LR
Sbjct:  909 DASIAAPFTSKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALVLAYSQSVLYLEGVKFSDFQATLQGLL-LAGCFLFISRSKPLKTLSKERPLPNIFNLYTILTVLLQFAVH--FCSLVYLYKGAQTRS--PPREEQFVDLYKEFEPSLINSTVYIMSMAMQMATFAINYKGHPFMESLTENRPLLWSIALSGLAIV---GLLTGSSPEFNEQFALVDIPTEFKLVIAQVLVLDFVAALLVDRVLQFLLGKGTLR 1157          
BLAST of Cation-transporting ATPase vs. Ensembl Sea Lamprey
Match: ATP13A4 (ATPase 13A4 [Source:HGNC Symbol;Acc:HGNC:25422])

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 400/1036 (38.61%), Postives = 591/1036 (57.05%), Query Frame = 3
Query:  135 IYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVK-LTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLID-YQPEQ-------VNRYFIHKKLKYIWNWKILHFEALDGIEQT--CTEFYTSLP--LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTV---VSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMS----VPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDN-------MLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY 3155
            ++G++   ++  L     +L+   L L+ +W PRW + +   PCSL EAD++L +  D++Q +   +V  L L+    +        R   +++       + K+++    +QPE        V R  +   + +I+N  I  F+   G+E T  CTE +      L + +   R  ++G N I++ + P+  LL KE LNPFYVFQ+ SV LWF + Y+ Y+  I+ M+ +S+ + +Y  RK   +L   V    ++  T++ RDG T     + E+VPGD I  P +G +M CDA L+SG+C+VNESMLTGESVPVTK+ LP   G  P+     +D                       R VLFCGT++IQ+R    + VLAV V TG+ T+KG+LVRSIL+PKP D K  +DA +F+  L   ALVG IYT+++      E  ++V ++LDIITI +PPALP AMT GI++AQ RL++ +I+CISP  IN CG IN+  FDKTGTLTEDGLDLWG++        E+     +  A  PL+ +  +C   N+    +   P  + + + +  +  E V   + +F  +    V   A +R  E     + +L+QF FSSSLQRMSV+ + +S      ++KG+PE ++ LC  +T+P DF  +L ++   GYRV+  A R L  +   M R  R +VEC+L FLG +++EN+LKPET++ +E+L+ A IR +M+TG         +L   S++    I    D+ + + +   S  ++ T+       D+   V+E            +KP+S          FH AM+G T+A++    P+L+ K+V+ G VFAR +P QK  LIE LQ + YYV MCGDGANDCGALK AHAGISLSE EASVASPFTSKI NI CV  LIKEGR AL TSF  FK+MA YS  Q+ISVL+LYW +A  S+Y+FLY DL++ T ++++   ++A   L+   P  +L++   + S++L        Q++AY  V  QPWY
Sbjct:    1 VFGFRHVRWRQALVVLGAVLSCGFLLLLLYWHPRWRVRLQCVPCSLAEADVLLLRTTDEFQTWSRQKVDWLKLRENSHLGGGGDEALRVDFALVA------SGKSQIFSSLHQPEMKKPSIAIVMRCTMTLNIIFIFNVDIRSFQC-SGLENTLTCTEIHDQFGKGLDQSQRDLRKLVYGLNLIDIPVPPMWKLLFKEVLNPFYVFQVFSVCLWFAESYMEYSYAIIAMTLISVGLSIYTVRKQAVALNKMVKEHSNLPVTILGRDG-TSRDTTSTEVVPGDTITFPSNGGIMPCDAVLVSGSCVVNESMLTGESVPVTKSTLPRREGDAPWVSAGAED---------------------FRRFVLFCGTRLIQTRPGAADKVLAVAVNTGFSTSKGKLVRSILYPKPTDFKLFRDAFRFLMSLIAVALVGMIYTVVIFSLSGTEAGEVVKKALDIITIAVPPALPAAMTAGIMYAQRRLRRVNIFCISPQRINVCGQINLVGFDKTGTLTEDGLDLWGLLRVS-----ENRSQHLNSFAHSPLLPTGPSCFIGNLCQVALL-LPFPVFLSKQVMEETDEEVSVGKLKFRAAPCSTVLHPAPQRCTE-PATSLAVLKQFTFSSSLQRMSVMARLASG-EACAFMKGAPEKVAGLCLPDTVPCDFEKELHKYAAQGYRVIGFASRQLGENELGMERSRRDKVECDLTFLGLMILENKLKPETQAALEELRKARIRTVMITGRRWIQRRIILLNNTSLSSSAVICQLVDEGLPMPSSCSSLRLH-TVDVLSGVGDMHLTVNE-----------STKPAST---------FHFAMTGTTYAVLLQHYPELLQKIVMNGTVFARMSPGQKASLIEELQKLNYYVGMCGDGANDCGALKMAHAGISLSEQEASVASPFTSKIPNIECVLHLIKEGRAALVTSFCVFKYMALYSMIQYISVLILYWKLAGFSNYEFLYQDLVITTVIAVTMSLNRAHPSLAAYRPPQQLVSPPFLLSVVLHVALTLACQVLAYLLVQRQPWY 978          
BLAST of Cation-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp13a3 (ATPase 13A3 [Source:ZFIN;Acc:ZDB-GENE-120521-1])

HSP 1 Score: 173.711 bits (439), Expect = 1.713e-49
Identity = 102/215 (47.44%), Postives = 133/215 (61.86%), Query Frame = 3
Query: 2706 ANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY--------VLP----PHSQKEVIH-----RAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKN 3299
            A D GALK AHAGISLSE EASVASPFTSK  NISCVP LI+EGR AL TSF  FKFMA YS  Q++SVL+LY I++NL D+QFL+IDL ++  L+ +   + A  +L+   P   LL+  ++ S+  Q +     Q+ A+     QPWY        + P    P +  + +H     R   N  +F VS FQYI++  VF+KG P+R PIYKN
Sbjct:    1 AQDHGALKRAHAGISLSELEASVASPFTSKTPNISCVPTLIREGRAALITSFCVFKFMALYSIIQYLSVLLLYSILSNLGDFQFLFIDLAIILVLAFTIPLNGAWPQLTAMGPPSSLLSVRLLLSVAAQALTCLGVQVCAFLLTQRQPWYQPWAPNITLCPGEETPLNSTDWVHDENNIRNAENTTLFFVSSFQYIIVCFVFAKGKPYRQPIYKN 215          
BLAST of Cation-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002888.1 (pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1 gene:ENSPMAG00000002641.1 transcript:ENSPMAT00000002888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.050e-14
Identity = 96/403 (23.82%), Postives = 157/403 (38.96%), Query Frame = 3
Query: 1920 QFPFSSSLQRMSVITKFSSRMN--YNLYVKGSPEVLSTLCRKETLPRD-----------FSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVEC------ELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKI---ANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVL--MLYWIVAN----LSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETP 3044
            + PF S+++    I +     +  Y L +KG+PE +   C    +              F +  L+    G RVL L    L++   +  R    + E       +L  +G + M +  +      +   ++A I+ IM TGD+ +TA ++A+  GIISE ++ +                     ED+          + N  VN   P   K CV+   D       +   I+++              VFAR +P QK  ++E  Q  G  V++ GDG ND  ALK A  GI++    + V+      I    N + +   ++EGR      F   K    Y+ T  I  +   L++I+ N    L     L IDL      +IS  Y  A + +    P
Sbjct:   36 EIPFDSTIKYQLSIHESDEPNDPRYLLVMKGAPERILDRCSSIIIEGQEESLDEELEEAFQNAYLELGGLGERVLGLCQ--LRLPVDQFPRGYAFDTENINFPMEDLCLVGLMSMIDPPRATVPDAVGKCRSAGIKVIMATGDHPITAKAIAKSVGIISEGNETV---------------------EDI--------AARLNIPVNQVDPRDAKACVVHGSDLKNMTETQLDDILKNYTE----------IVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSLALKKADIGIAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLI----FDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQP 393          
BLAST of Cation-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002145.1 (pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene:ENSPMAG00000001949.1 transcript:ENSPMAT00000002145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.225e-12
Identity = 73/266 (27.44%), Postives = 110/266 (41.35%), Query Frame = 3
Query: 2274 IMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKI---ANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVL--MLYWIVAN----LSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETP 3044
            IMVTGD+ +TA ++A+  GIISE                N+T+ +   A  L  PVS+++            P   K CV+   D       +   I+++              VFAR +P QK  ++E  Q  G  V++ GDG ND  ALK A  GI++    + V+      I    N + +   ++EGR      F   K    Y+ T  I  +   L++I+ N    L     L IDL      +IS  Y  A + +    P
Sbjct:    3 IMVTGDHPITAKAIAKGVGIISEG---------------NETVEDI--AARLNIPVSQVN------------PRDAKACVVHGSDLKDMTEIQLDDILKNHTE----------IVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLI----FDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQP 225          
BLAST of Cation-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007912.1 (pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 gene:ENSPMAG00000007146.1 transcript:ENSPMAT00000007912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.108e-11
Identity = 82/337 (24.33%), Postives = 146/337 (43.32%), Query Frame = 3
Query: 1422 KIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEG----VDGNENEFDMSVPMIAFRRNREGKDVQI---GILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRK------ETLP---RDFSSKLLQFTH----SGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDAR 2372
            K  I  + ++ + +P  LP+A+TI + ++  ++ K +      +   T G     C DKTGTLT + + +  V A   D  +      PS  AL P I  + T            G  ++      I    KEG      GN+ E  +   +   RR+ +    ++    + + + F+S  + MS +   ++   + LY KG+ E+L   C +      ET     RD    + +        G R + LAYR   I  S+      + +  EL  +  + +E+ ++PE  + I+  + A I   MVTGDN+ TA ++A  CGI+   +  + ++ +
Sbjct:   97 KFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTV--VQAYVGDVHY---CSVPSPDALAPAIMDVLT-----------TGIAVNCAYTTKILPPEKEGGLPRQVGNKTECALLGLLAEMRRDYQAVRDELPEERLYKVYTFNSVRKSMSTVL-HNADGGFRLYSKGASEILLKKCSRILGATGETRGFRLRDRDEMVRKVIEPMACDGLRTICLAYRDFPIG-SEPKWDDENAIVNELTCVTVVGIEDPVRPEVPNAIKMCQRAGITVRMVTGDNINTARAIASKCGILHPNEDFLCIEGK 415          
BLAST of Cation-transporting ATPase vs. Ensembl Yeast
Match: YPK9 (Vacuolar protein with a possible role in sequestering heavy metals; has similarity to the type V P-type ATPase Spf1p; homolog of human ATP13A2 (PARK9), mutations in which are associated with Parkinson disease and Kufor-Rakeb syndrome [Source:SGD;Acc:S000005817])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 389/1020 (38.14%), Postives = 582/1020 (57.06%), Query Frame = 3
Query:  588 LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGH----TLVCRDGKTFCQINANELVPGDIIELPRSG-CLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKD-SGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENE-PVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDG----SFEDPVDD---------------PSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDG--------NENEFDMS------VPMIAF--RRNREGKDVQ------IGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL-KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYA---EDLQRP--VSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAII-RDKCP---QLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIV-FKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFI 3470
            LT+   ++R   FG+N+I +++     +L  E L+PFYVFQ+ S+ LW +D+Y  YA CI  +S LS+    +D+   +  +   +  + H      V RD K +  I+++ELVPGDI E+      ++ CD+ L+S +CIVNESMLTGESVPV+K P    T +         D    QI S               S+  L+ GT +I++R    +   LA+VVRTG+ T KG LVRS++FPKP   KF +D+ K+IG ++L A+ GF  + +  +   ++   +++R+LDIITI++PPALP  +TIG  FA SRLK+K I+CISP  +N  G I+V CFDKTGTLTEDGLD+ GV  S+P+G     F + + D               P +        S+ TCHSL  +DG + GDPLD KMFQ   W  +E              +E D+       +P +      NRE           +G++R F F S L+RMSVI K ++   Y  + KG+PEV+S +C K TLP DF   L  +TH+GYRV+A A + L K ++    ++ R EVE  L FLGF++ +N+LK ET   ++ L+ A IR IM TGDN+LTA+SV R+ G+I          +R+   ++NDT +         D+  P  + +   LK  ++ N+S   S++ C     ++ LA+SG  + ++ RD+     + + ++++  +++AR +PD+K +L+  LQ + Y V  CGDGANDCGALKAA  GISLSE EASVA+PFTSKI NISCV ++I+EGR AL TSF  F++M+ YS  QFI++ +LY   +NL D+QFLYIDL+++  ++I   +SK+  K+  + PS  L++  ++  L++      LFQ I +  V    WY+ P     + +  +  N  +F VS FQYI+ AIV S G P+R P+ KN+ F+ ++ V I  +L ++      +L  +LQL    +     I+  +VI N+    +I
Sbjct:  462 LTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSI----FDSLNEQKKVSRNLAEMSHFHCDVRVLRD-KFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMY-----QLCDDFQSTQISSFV-------------SKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQ--------CSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSV-ESLREC-----NYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSD-NTVLFFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIV-WVILNYYAQLYI 1442          
BLAST of Cation-transporting ATPase vs. Ensembl Yeast
Match: SPF1 (P-type ATPase, ion transporter of the ER membrane; required to maintain normal lipid composition of intracellular compartments and proper targeting of mitochondrial outer membrane tail-anchored proteins; involved in ER function and Ca2+ homeostasis; required for regulating Hmg2p degradation; confers sensitivity to a killer toxin (SMKT) produced by Pichia farinosa KK1 [Source:SGD;Acc:S000000757])

HSP 1 Score: 273.092 bits (697), Expect = 1.560e-75
Identity = 216/726 (29.75%), Postives = 354/726 (48.76%), Query Frame = 3
Query:  621 LFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSG--CLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEP---------VLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRN---REGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL-KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISL 2753
            L+GEN  ++ I   + L  +  + P +VFQ+  V LW LD++  Y+   +FM     +  ++         R   +   +T+     K +  +  NEL+P D++ + R+     + CD  L+ G+ IVNE+ML+GES P+ K  +       P   N   D  ++I                    VL  GTK +Q    E++           LA+V +TG+ T++G LVR +++        N++AL FI  L +FA++   Y  +          K+++  + IIT ++PP LP+ +T+ +  + + L K  +YC  P  I   G I+V CFDKTGTLT + L   G+     D      +   +E     ++   A    + + DG+I GDP++    +++ W ++                   R+N   REG   ++ I+R+F FSS+L+R + I   +  +     VKG+PE +    R   +P+++      FT SG RVLALA + L K+S SK+  + R +VE EL F GFL+    LK +    I+ L  +  R IM+TGDN LTA+ VA++ GI+  + + +++D    S   +D  + F    D++  VS I         + SK       + +R D  +A++G  +A+   +    +  L+    V+AR +P QK  L+ +L+ +GY   MCGDG ND GALK AH GI+L
Sbjct:  176 LYGENSFDIPIPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYSLFNLFMIISMEAAAVFQRLTALKEFRTMGIK-PYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSAIVNEAMLSGESTPLLKESIK----LRPSEDNLQLDGVDKIA-------------------VLHGGTKALQVTPPEHKSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIASWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLAGISADSENIRHLYSAAEAPESTILVIGAAHALVKLEDGDIVGDPMEKATLKAVGWAVE-------------------RKNSNYREGTG-KLDIIRRFQFSSALKRSASIASHNDAL--FAAVKGAPETIRE--RLSDIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQSKIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV--FGETLILDRAGKS---DDNQLLFR---DVEETVS-IPFDPSKDTFDHSK-------LFDRYD--IAVTG--YALNALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 833          

HSP 2 Score: 64.3142 bits (155), Expect = 1.182e-10
Identity = 72/270 (26.67%), Postives = 115/270 (42.59%), Query Frame = 3
Query: 2574 KCPQLIPKLVVKGAVFA----RFAPDQKTQLIESLQSIGYYVSMCGDGA----NDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIV-LTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHA----NAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTL 3344
            K P  +  L  KG V      +   +  ++ +E ++  G       D A    N  G  +   A  +L   +AS A+PFTSK+AN+S V  +I++GRCAL  +   +K +A        S+ ++Y       D Q     L++ +  LSIS G  K   KLS + P   +    +M S++ Q+  +    I    Y+  +  Y L P   +  + +  A    N  IF + + Q +    V  +G PFR  I  N      L+ V    L
Sbjct:  887 KNPHYLKALESKGTVITPEIRKAVEEANSKPVEVIKPNGLSEKKPADLASLLLNSAGDAQGDEAP-ALKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKFGDGQATVSGLLLSVCFLSISRG--KPLEKLSKQRPQSGIFNVYIMGSILSQFAVH----IATLVYITTE-IYKLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRSNKGMYYGLLGVTGLAL 1148          
BLAST of Cation-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 124.405 bits (311), Expect = 5.236e-29
Identity = 201/871 (23.08%), Postives = 360/871 (41.33%), Query Frame = 3
Query:  534 EALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKI--EVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSI---QLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLI-SGNCIVNESMLTGESVPVTK-----------TPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYK-IVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGL---DLW------------------------------------------GVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNII---DGEIC----GDPLDIKM-FQSIKWDI------KEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRK-----------------ETLPRDFSSKLLQFTHSGYRVLALAYRPL---KISYSKMMRIP--RHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASV---ASPFTSKIANISCVPELIKEGR 2840
            EA + I  + TE      LT+ E  +R+   GEN +  + +I     ++L +  N   +  + S+ + F     +  G I F+ A+++ I   Q Y   K  NSL+N      H  V R+GK+   IN+ ++VPGDI  L + G  +  D  LI + N   +ES+LTGES+PV+K           T + +       S   VK   + IV +K  +  E+  + K  +     G   + SR+     +    + T  +T  G  + + +   P+  K ++ A+    +  LFA       IIVM +++ +V K + I ++ +   +IP +L V +TI +    + +  +++     +++   G +N  C DKTGTLT+  +    +W                                          G++ +  D  +E  + +  +M L       AT  ++  +   D   C    GDP +I +   + K D+       E      NE D S      + N +    Q   + +FPF S+++RMS +   +    YN+Y KG+ E + + C                   ET+ ++  S     ++ G RVL  A +     +++  ++  I   R   E +L FLG + + +  + ET   ++    A I   M+TGD + TA ++A++ GI+                N+      +HY++++                 DS                + M+G  +  + ++    +P L +   V AR +P  K ++IE+L     + +M GDG ND  +LK A+ GI++    + V   AS       N + +   ++EGR
Sbjct:   24 EAAEFIGTSLTE-----GLTQDEFVHRLKTVGENTLGDDTKI-DYKAMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAH--VIRNGKSET-INSKDVVPGDIC-LVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIV-IKTALNSEIGKIAKSLQ-----GDSGLISRDPSKSWLQNTWISTKKVT--GAFLGTNV-GTPLHRKLSKLAVLLFWIAVLFA-------IIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSS---LSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS----LSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT--------------NL------YHYSQEIV----------------DS----------------MVMTGSQFDGLSEEEVDDLPVLPL---VIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806          
BLAST of Cation-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 123.25 bits (308), Expect = 9.668e-29
Identity = 206/871 (23.65%), Postives = 362/871 (41.56%), Query Frame = 3
Query:  534 EALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKI--EVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSI---QLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLI-SGNCIVNESMLTGESVPVTK-----------TPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYK-IVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGL---DLW--------------------GVVASKP-----------DG------SFEDPV---DDPSEMALCPLIESMATCHSLNII-----DGEIC----GDPLDIKM-FQSIKWDI------KEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRK-----------------ETLPRDFSSKLLQFTHSGYRVLALAYRPL---KISYSKMMRIP--RHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASV---ASPFTSKIANISCVPELIKEGR 2840
            EA + I  + TE      LT+ E   R+   GEN +  + +I     ++L +  N   +  + S+ + F     +  G I F+ A+++ I   Q Y   K  NSL+N      H  V R+GK+   IN+ ++VPGDI  L + G  +  D  LI + N   +ES+LTGES+PV+K           T + +       S   VK   + IV +K  +  E+  + K        G   + SR+     +    + T  +T  G  + + +   P+  K ++ A+    +  LFA       IIVM +++ +V K + I ++ +   +IP +L V +TI +    + +  +++     +++   G +N  C DKTGTLT+  +    +W                    G V+  P           DG      +F+D +   D P ++ +    + + T    NI      D   C    GDP +I +   + K D+       E      NE D S      + N +    Q   + +FPF S+++RMS +   +    YN+Y KG+ E + + C                   ET+ ++  S     ++ G RVL  A +     +++  ++  I   R   E +L FLG + + +  + ET   ++    A I   M+TGD + TA ++A++ GI+                N+      +HY++++                 DS                + M+G  +  + ++    +P L +   V AR +P  K ++IE+L     + +M GDG ND  +LK A+ GI++    + V   AS       N + +   ++EGR
Sbjct:   24 EAAEFIGTSLTE-----GLTQDESLRRLKAVGENTLGDDTKID-YKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAH--VIRNGKSET-INSKDVVPGDIC-LVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIV-IKTALNSEIGKIAKS-----LQGDSGLISRDPSKSWLQNTWISTKKVT--GAFLGTNV-GTPLHRKLSKLAVLLFWIAVLFA-------IIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSS---LSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS----LSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT--------------NL------YHYSQEIV----------------DS----------------MVMTGSQFDGLSEEEVDDLPVLPL---VIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806          
BLAST of Cation-transporting ATPase vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 123.25 bits (308), Expect = 1.000e-28
Identity = 201/871 (23.08%), Postives = 358/871 (41.10%), Query Frame = 3
Query:  534 EALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKI--EVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSI---QLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLI-SGNCIVNESMLTGESVPVTK-----------TPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYK-IVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGL---DLW------------------------------------------GVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNII---DGEIC----GDPLDIKM-FQSIKWDI------KEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRK-----------------ETLPRDFSSKLLQFTHSGYRVLALAYRPL---KISYSKMMRIP--RHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASV---ASPFTSKIANISCVPELIKEGR 2840
            EA + I  + TE      LT+ E   R+   GEN +  + +I     ++L +  N   +  + S+ + F     +  G I F+ A+++ I   Q Y   K  NSL+N      H  V R+GK+   IN+ ++VPGDI  L + G  +  D  LI + N   +ES+LTGES+PV+K           T + +       S   VK   + IV +K  +  E+  + K        G   + SR+     +    + T  +T  G  + + +   P+  K ++ A+    +  LFA       IIVM +++ +V K + I ++ +   +IP +L V +TI +    + +  +++     +++   G +N  C DKTGTLT+  +    +W                                          G++ +  D  +E  + +  +M L       AT  ++  +   D   C    GDP +I +   + K D+       E      NE D S      + N +    Q   + +FPF S+++RMS +   +    YN+Y KG+ E + + C                   ET+ ++  S     ++ G RVL  A +     +++  ++  I   R   E +L FLG + + +  + ET   ++    A I   M+TGD + TA ++A++ GI+                N+      +HY++++                 DS                + M+G  +  + ++    +P L +   V AR +P  K ++IE+L     + +M GDG ND  +LK A+ GI++    + V   AS       N + +   ++EGR
Sbjct:   24 EAAEFIGTSLTE-----GLTQDESLRRLKAVGENTLGDDTKI-DYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAH--VIRNGKSET-INSKDVVPGDIC-LVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIV-IKTALNSEIGKIAKS-----LQGDSGLISRDPSKSWLQNTWISTKKVT--GAFLGTNV-GTPLHRKLSKLAVLLFWIAVLFA-------IIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSS---LSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS----LSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT--------------NL------YHYSQEIV----------------DS----------------MVMTGSQFDGLSEEEVDDLPVLPL---VIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGR 806          
BLAST of Cation-transporting ATPase vs. Ensembl Nematostella
Match: EDO41461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S465])

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 410/902 (45.45%), Postives = 555/902 (61.53%), Query Frame = 3
Query:  687 LNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKD-----------VQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFH----LAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYV-----LPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIV 3326
            +NPFY+FQ+ S+ LW  +DY  YA  I  MS  S+ I +  T+++  +LR+ V       V R+     +I + +LVPGD++ +P  G  M+CDA LISGNCIVNESMLTGE +P+   P   PTG     P   K               EV+    H RH LF GTKVIQ+R + N  VLAVV+RTG+ T KG L+RSIL P+P++ +F +D+++FI +LA+ A VGF Y++ V V +  ++  I+ +SLD+ITI +PPALP AM IG+V+A  RLKK+ IYCI P+ IN CG + + CFDKTGTLTEDGLDL GVV  + D  FE  V D + +   P++ +MATCHSL +ID E+ GDPLDIKMF++  W   E  + N+ +FD   P     + RE  D           +++GI+RQFPFSS +QRM+VIT+     + ++YVKG+PEV+++LCR ET+P +F  +L  +T  GYRVL +AY  L  K+++ +  R  R  +E +L F                                 DNMLTA+SV R+CG++   +KVIL  A L+     D I                SVL  N+    S PS +   +IE P +H    +A+SGKT+A IR+  PQ++ +L+V G VFAR +P+QKT L+E LQSIGY V MCGDGANDCGALKAA+AGISLSE EAS+ASPFTSKI NI CVP++IKEGRCAL TSF  FK+MA YS  QF+SVL+LY I +NLSD+QFLYIDL+++T+L++  GY      L    P   L+   ++ SLI Q +     Q+  + YV  Q WYV     +     K+V    H N  IF++S FQYI+LA+ F++G P+R PIY+N I   +LIV
Sbjct:    1 MNPFYIFQLFSILLWCTNDYYYYASAIFIMSLGSIIITIRQTKQHLVALRDMVAHADVVTVLRNKGVPEEILSTDLVPGDVVVIPPQGTTMHCDAALISGNCIVNESMLTGELIPL---PHHTPTG----PPQEQKA--------------EVYSPIVHKRHTLFNGTKVIQTRYYGNAKVLAVVIRTGFFTTKGRLIRSILNPRPVEFQFFKDSMRFISMLAVLASVGFAYSVYVFVQQGAKIGVIIEKSLDVITIAVPPALPAAMAIGMVYALQRLKKQYIYCIQPSRINMCGKLKLFCFDKTGTLTEDGLDLLGVVRVE-DARFEMIVKDATILPQGPMLFAMATCHSLTMIDNELTGDPLDIKMFEATGWVFDEPGEDNK-KFDTIAPSTVRPKTREMTDNQVYVRIKSVPLEVGIIRQFPFSSDVQRMTVITRILGSDHMDVYVKGAPEVIASLCRPETVPANFQEELEIYTKEGYRVLGVAYGALGSKVTWHQAQRAKRDVIEKDLIF--------------------------------SDNMLTAVSVGRECGMVGINEKVIL--AELEKQGNVDKI--------------RWSVLPGNK---KSGPS-LNDVLIEIPGYHHPYHIAVSGKTFAYIRENEPQIMKRLLVCGTVFARMSPEQKTHLVEELQSIGYSVGMCGDGANDCGALKAAYAGISLSEAEASIASPFTSKIPNIECVPKVIKEGRCALVTSFACFKYMALYSIVQFVSVLILYSIGSNLSDFQFLYIDLVIITSLALVMGYQHPYPILVSRRPGGSLVAPIVLVSLISQIVIQITVQVSGFVYVKQQSWYVPVNVSMLHQGGKDVQQECHDNTVIFTLSSFQYIILAVAFARGKPYRLPIYRNLILSQDLIV 827          
BLAST of Cation-transporting ATPase vs. Ensembl Nematostella
Match: EDO44727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV60])

HSP 1 Score: 311.997 bits (798), Expect = 4.962e-88
Identity = 230/745 (30.87%), Postives = 373/745 (50.07%), Query Frame = 3
Query:  588 LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIEL----PR-SGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSR-HVLFCGTKVIQSR---------NFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMV---NRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVI----TKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMR-IPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISL 2753
            L +  V    A FG N++E+ +   + L  +    PF+VFQ+  V LW LD+Y  Y+   +FM     +  +    +N   +R  + +  H +     K +  I +NEL+PGDI+ +    P+ S  L+ CD  L+ G+CIV+E+MLTGESVP  K P+                              EVFD+  H + H+L  GTKV+Q              +   +A V++TG+ T++G+L+R+ILF        N +   FI  L +FA+   +Y  +      NR    YK+ +    I+T ++PP LP+ +++ +  +   L+K  +YC  P  I   G ++V CFDKTGTLT D L + GV   + D    D +   SE+    L   +A+CHSL  +D  + GDPL+  + Q+I W + +G        D+ +P        +G+ + + I+ +  FSS+L+RMS +    T+ S+   Y   VKG+PE L  +  K  +P ++ +   + T  G RVLAL Y+ L    +K MR + R EVE +L+F+GF+V+   LK +++++I+ ++ +     M+TGDN LTA  VA++  +  +   +I++   + ++  N    ++H+ E   R  S +             PS     +I + D  +     ++     +  +L   ++    VFAR AP QK  +I  L+S GY   MCGDG ND GALK AH G++L
Sbjct:  166 LDDTMVNQAQAKFGTNELEMTVPDFMELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLFMLIAFEATLVQQQLRNMKEIRK-MGTKPHLIQVYRNKKWRPILSNELLPGDIVSIGMWRPKNSDVLIPCDMLLLRGSCIVDEAMLTGESVPQMKEPIEGLEA------------------------HEVFDMDVHGKLHLLSGGTKVVQHSPPPKTAAGIKASDNGCIAYVLQTGFNTSQGKLLRTILFGVKRVTANNLETFMFILFLLIFAVTAAVYVWVKGTEDPNR--NRYKLFLECTLILTSVVPPELPIELSLAVNSSLMALQKLGVYCTEPFRIPFAGKVDVCCFDKTGTLTSDNLVVQGVAGIRND----DEISSVSELPDNTL-HVLASCHSLVCLDDILVGDPLEKAVLQAIDWRLTKG--------DLVLP-------NKGRRLTMRIMHRHHFSSALKRMSAVVSMQTQGSNTSEYFAAVKGAPETLRNMYEK--VPDNYDAVYNKMTCQGSRVLALGYKKLGELGNKEMRDLGREEVESQLQFVGFVVIACPLKMDSKNVIKQIQESSHHVTMITGDNPLTACHVAKELRLTKK--PIIVLTPPVYNHVNNHVDGDWHW-EPADRSFSIL-----------LSPSGGSRELINKYDMCITGEAFSYLTTHPEASKLFDAILPFVRVFARVAPKQKELVITRLKSRGYVTLMCGDGTNDVGALKHAHCGVAL 847          

HSP 2 Score: 63.5438 bits (153), Expect = 6.185e-10
Identity = 66/256 (25.78%), Postives = 108/256 (42.19%), Query Frame = 3
Query: 2763 EASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAH-----ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVI---ANFLISYFIEFVIDNMSLRRQ 3506
            +AS+ASPFTSK ++I+CV  +IK+GRC L T+   FK +A  +     S  +LY      SD Q   +  ++L    +    SK  T LS   P    L        IL  +       IA  Y+      + P  S   V   +       N+ ++ +SV   ++   V  KG PF   + +N     +L+    F + +V      L +  ++  FP     + L + +I   A FL+   + F++    L+  
Sbjct:  927 DASIASPFTSKSSSINCVCHIIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLDGIKFSDGQ-ATLQGVLLAGCFLFISRSKPLTVLSKSRP----LPNIFNFYTILTVLGQFAVHFIALVYMVGHAKRLTPSSSAVHVNLESKFEPTILNSTVYIISVALQLLTFAVNYKGHPFMESLLENKPLTYSLLASTGFVVCMVTGSVPELTDQFEIVPFPPKFREVFLQTLLIDAMAVFLLDRVLNFILGKSRLKNH 1177          
BLAST of Cation-transporting ATPase vs. Ensembl Nematostella
Match: EDO44725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV58])

HSP 1 Score: 238.424 bits (607), Expect = 3.200e-65
Identity = 211/751 (28.10%), Postives = 353/751 (47.00%), Query Frame = 3
Query:  588 LTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFM-----SALSLSIQ--LYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANE-LVPGDIIELPR-SGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSR-HVLFCGTKVIQSR---------NFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMV---NRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGV--VASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDG-NENEFDMSV---PMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMR-IPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISL 2753
            L +  V    A FG N++E+ +   + L  +    PF+VFQ+  V LW LD+Y  Y+   +FM     + L   +Q  L  +      L  T+ ++G  L         QIN+ + L    I+  P+ S  L+ CD  L+ G+CIV+E+MLTGESVP  K P                     I  L+ +   EVFD+  H + H+L  GTKV+Q              +   +A V++TG+ T++G+L+R+ILF        N +   FI  L +FA+   +Y  +      NR    YK+ +    I+T ++PP LP+ +++ +  +   L+K  +YC  P  I   G ++V CFDKTGTLT D L + GV  +++K  G    PV                                + I +F +I   + +GV G  +    ++V    ++ +  +     +++ + +     +++       K   +  Y++   G+PE L  +   E +P ++ +   + T  G RVLAL Y+ L    +K MR + R EVE +L+F+GF+V+   LK +++++I+ ++ +     M+TGDN LTA  VA++  +  +   +I++   + ++  N    ++H+ E   R  S I +           PS     +I + D  +     ++     +  +L   ++    VFAR AP QK  +I  L+S GY   MCGDG ND GALK AH G++L
Sbjct:  166 LDDTMVNQAQAKFGTNELEMTVPDFMELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLFMLIAFEATLVQQVQWKLQGSNAGIYKLDITMATVGLALA--------QINSLDFLCVYLILGRPKNSDVLIPCDMLLLRGSCIVDEAMLTGESVPQMKEP---------------------IEGLEAQ---EVFDMDVHGKLHLLSGGTKVVQHSPPPKTAAGIKASDNGCIAYVLQTGFNTSQGKLLRTILFGVKRVTANNLETFMFILFLLIFAVTAAVYVWVKGTEDPNRN--RYKLFLECTLILTSVVPPELPIELSLAVNSSLMALQKLGVYCTEPFRIPFAGKVDVCCFDKTGTLTSDNLVVQGVAGISTKVGGVSPTPV--------------------------------ITIGVFLTIDNHVLQGVAGLGKRGVTLTVVDNHVVYYMGSPSQPYIRVELPKMLYLEAAVVLACQKLKRKIKCVYSITSNGAPETLRNI--YEKVPDNYDAVYNKMTCQGSRVLALGYKKLGELGNKEMRDLGREEVESQLQFVGFVVIACPLKMDSKNVIKQIQESSHHVTMITGDNPLTACHVAKELRLTKK--PIIVLTPPVYNHVNNHVDGDWHW-EPADRSFS-IPL----------SPSGGSRELINKYDMCITGEAFSYLTTHPEASKLFDAILPFVRVFARVAPKQKELVITRLKSRGYVTLMCGDGTNDVGALKHAHCGVAL 834          
BLAST of Cation-transporting ATPase vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 103.605 bits (257), Expect = 3.419e-22
Identity = 187/781 (23.94%), Postives = 307/781 (39.31%), Query Frame = 3
Query:  825 NSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLI-SGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGE---LVRSILFPK-PIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGL---DLWGVVASKPDGSFE-DPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDM----SVPMIAFRRNREGKDVQIGILRQFPFSSSLQ---RMSVITKFSSRMNYNLYVKGSPEVLSTLC-----RKETLPRD------FSSKLLQFTHSGYRVLALAYRPLK-----ISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKI---ANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVL--MLYWIVAN----LSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETP 3044
            +S +N V       + RDGK   + NA ++V GDII     G  +  D  +I S    V+ S LTGES P  + P      F   +P                           ++++ F  T  ++           +VV+TG  T  G    L   +   K PI ++         GV     +  FI ++++       + + VI  + II   +P  L   +T+ +     R+  K+    +   + T G  +  C DKTGTLT++ +    +W       + +FE D  +D S  A+    E   T  +L  I G +C     +    ++    ++ + GN +E  +     + + +  + RE    +   + + PF+S+ +    +  I   +S  +++L +KG+PE +   C     + E  P D      F    L     G RVL  A   L      I +      P   VE  L F+G + M +  +      +   ++A I+  MVTGD+ +TA ++A+  GIISE            +  V D  +       L+ PV E+   + + +V                     + G     + DK    I K   K  VFAR +P QK  ++E  Q  G  V++ GDG ND  ALK A  GI++  + + V+      I    N + +   ++EGR      F   K    Y+ T  I  +   L +IVA     L     L IDL      +IS  Y +A + +    P
Sbjct:  194 DSFKNMVPQ--EATILRDGKKVVK-NAEQVVIGDII-FVAIGDRVPADIRVIESKGFKVDNSSLTGESEPQARGPE-----FTHENP-------------------------LETKNLAFFSTNAVEGT------CTGIVVQTGDNTVMGRIAGLASGLGSGKTPIAIEIGHFIHIITGVAVALGVTFFIISLVLGYT----ILQAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW-----FDNKTFEADTTEDQSGTAM----EKTETWTALGRIAG-LCNRAEFVSGQDNVAVLRRDTMGGNASEAALLKCVELQVGSVTKMRE----EFHRVAEIPFNSTNKYHVSIHEINDENSTYSHHLLMKGAPERVLDRCSTILIKGELKPLDDDMKQAFEMAYLDLGGMGERVLGFAQHYLDKENFPIGFEFETDEPNFPVEG-LCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISE-----------GTETVEDISLR------LEIPVEEVDKSQADAIV---------------------VHGGELKDMTDKDIDDILK-NHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLI----FDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMP 872          
BLAST of Cation-transporting ATPase vs. Ensembl Nematostella
Match: EDO46433 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ50])

HSP 1 Score: 85.5001 bits (210), Expect = 1.491e-19
Identity = 58/135 (42.96%), Postives = 79/135 (58.52%), Query Frame = 3
Query: 2295 MLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFH----LAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYV 2687
            MLTA+SV R+CG++   +KVIL  A L+     D I                SVL  N+    S PS  ++ +IE P +H    +A+SGKT+A IR+  PQL+ +L+V G VFAR +P+QKT L+E LQSIG  V
Sbjct:    1 MLTAVSVGRECGMVGVNEKVIL--AELEKQGNVDKI--------------RWSVLPGNK---KSGPSLNEV-LIEIPGYHHPYHIAVSGKTFAYIRENEPQLMKRLLVCGTVFARMSPEQKTHLVEELQSIGSAV 115          
BLAST of Cation-transporting ATPase vs. Ensembl Medaka
Match: atp13a3 (ATPase 13A3 [Source:NCBI gene;Acc:101158596])

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 498/1204 (41.36%), Postives = 714/1204 (59.30%), Query Frame = 3
Query:  105 ITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVKLTLKNGES----------------------VKASQINYKRTFH-SIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ---TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMI--------------AFRRNREGKDV----QIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERP----DFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP------HSQKEVIHRAH------------ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVID 3485
            + +G+  + +++GY+   +++ L     + T   L L+ +WMP W +  + T  + R+A+++L +  D+++++++  V++ L  G +                        AS +    T H S      +L T+ +    DYQP Q+ RYF     KY WN ++ +F+ L G+E     C+  +   S  LT  + + R   FG N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IVFMS +S++  LY  +K    L + V   SI    VCR  K   +I + +LVPGD++ +P +G +M CDA L+SG CIVNESMLTGESVPVTKT LPN          SV+  G           D+ ++ ++H RH LFCGT VIQ+R + +E V AVVVRTG+ TAKG+LVRSIL+PKP D K  +DA  F+  L   A +GFIY+I++ +  ++    I+I SLDIITI +PPALP AMT GIV+AQ RLK+  I+CISP  IN CG IN+ CFDKTGTLTEDGLDLWGV   + + SF    ++  +  L     +  MATCHSL  I+G++ GDPLD+KMF++  W ++E  +   +  +  +P +              +  R+ E  ++    +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PEV+++LC+ ET+P DF+  L  +T  G+RV+ALA+R L  K+S+ K+  I R  +E  + FLG ++M+N+LK ET  I++DL  A IR +MVTGDNMLTA+SVARDCG+I   D VI+ DA    Y      I + YA+   +P       + N  + D       +C  + P     +H AM+GK++A I +  P ++ KLV++G VFAR APDQKTQLIE+LQ + YYV MCGDGANDCGALK AH GISLSE EASVASPFTS+  NISCVP LI+EGR AL TSF  FKFMA YS  Q+ISV +LY I++NL D QFL+ID+ ++  +  +   + A   L    P   L++  ++ S++ Q +    FQII + +V  Q WY V  P      HS +  +   +             N ++F VS FQY+++A+VFSKG PFR P YKN+ F+ + + +  F L+I+F P + +   L++   P     + LF  ++ N  +S  +E  ID
Sbjct:    9 LNKGEEEEMELHGYRLCRWRLALLGFGVLCTGGFLLLLLYWMPEWCVKSTCTRTTARDAEVVLLRSTDEFRRWFLARVQVMLAPGSNPFHSLETQTTSPSSPHSSPFSTPAASPVANGHTPHPSDGGPAQELMTRFS----DYQPTQI-RYFTFHSTKYYWNHELQNFQVLIGLEDMQPKCSTIHKEHSTGLTRNQQEYRKLFFGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSADEYYYYAVAIVFMSVVSIATSLYTIKKQYIMLHDMVTAHSIVRVSVCRTNKDIEEILSTDLVPGDVMVIPNNGTIMPCDAVLVSGTCIVNESMLTGESVPVTKTNLPN----------SVEGEG-----------DDAYNTEEHKRHTLFCGTNVIQTRFYTDELVKAVVVRTGFSTAKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYSIVLSIINKVPAKTIIIESLDIITITVPPALPAAMTAGIVYAQRRLKQSGIFCISPQRINICGQINLFCFDKTGTLTEDGLDLWGVQRVE-NSSFHLSEENAYKENLVKSQFVACMATCHSLTKIEGQLSGDPLDLKMFEATGWILEEATEEETSLHNRIMPTVVRPPKQLLPPEPASSSERDMELYELSSAYEIGIVRQFPFSSALQRMSVVARLLGEKRMDAYMKGAPEVVASLCKNETVPEDFAEVLEDYTKQGFRVIALAHRRLESKLSWHKVQNISRDHIETNMEFLGLIIMQNKLKNETPGILQDLHRANIRTVMVTGDNMLTAISVARDCGMIPPDDTVIIADAHPPQYG-QPARITWRYAD---KPSKTSRYEEVNITLED-------VCDADEPKSKEQYHFAMNGKSFATILEHFPDMLQKLVLRGTVFARMAPDQKTQLIEALQGVDYYVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSRTPNISCVPNLIREGRAALITSFCVFKFMALYSIIQYISVTLLYSILSNLGDLQFLFIDIAIILIIVFTMSLNPAWKDLVPRRPPSGLISGPLLFSVLTQILICLGFQIITFVWVQKQAWYTVWTPFTDVCNHSTQLNVSELNNTELDEHNIQNFENTSLFYVSSFQYLIVAVVFSKGKPFRQPSYKNWPFVLSTVGLYIFLLFILFHPVESIDETLEIVCVP-FEWRVKLFLIILVNAAVSVLVEGGID 1173          
BLAST of Cation-transporting ATPase vs. Ensembl Medaka
Match: atp13a3 (ATPase 13A3 [Source:NCBI gene;Acc:101158596])

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 498/1205 (41.33%), Postives = 716/1205 (59.42%), Query Frame = 3
Query:  105 ITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAK--DQYQQYWIHEVKLTLKNGES----------------------VKASQINYKRTFH-SIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQ---TCTEFYT--SLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMI--------------AFRRNREGKDV----QIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERP----DFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP------HSQKEVIHRAH------------ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE-FVID 3485
            + +G+  + +++GY+   +++ L     + T   L L+ +WMP W +  + T  + R+A+++L +  D+++++++  V++ L  G +                        AS +    T H S      +L T+ +    DYQP Q+ RYF     KY WN ++ +F+ L G+E     C+  +   S  LT  + + R   FG N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IVFMS +S++  LY  +K    L + V   SI    VCR  K   +I + +LVPGD++ +P +G +M CDA L+SG CIVNESMLTGESVPVTKT LPN          SV+  G           D+ ++ ++H RH LFCGT VIQ+R + +E V AVVVRTG+ TAKG+LVRSIL+PKP D K  +DA  F+  L   A +GFIY+I++ +  ++    I+I SLDIITI +PPALP AMT GIV+AQ RLK+  I+CISP  IN CG IN+ CFDKTGTLTEDGLDLWGV   + + SF    ++  +  L     +  MATCHSL  I+G++ GDPLD+KMF++  W ++E  +   +  +  +P +              +  R+ E  ++    +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PEV+++LC+ ET+P DF+  L  +T  G+RV+ALA+R L  K+S+ K+  I R  +E  + FLG ++M+N+LK ET  I++DL  A IR +MVTGDNMLTA+SVARDCG+I   D VI+ DA    Y      I + YA+   +P       + N  + D       +C  + P     +H AM+GK++A I +  P ++ KLV++G VFAR APDQKTQLIE+LQ + YYV MCGDGANDCGALK AH GISLSE EASVASPFTS+  NISCVP LI+EGR AL TSF  FKFMA YS  Q+ISV +LY I++NL D QFL+ID+ ++  +  +   + A   L    P   L++  ++ S++ Q +    FQII + +V  Q WY V  P      HS +  +   +             N ++F VS FQY+++A+VFSKG PFR P YKN+ F+ + + +  F L+I+F P + +   L++   P     + LF  ++ N  +S  +E F++D
Sbjct:    9 LNKGEEEEMELHGYRLCRWRLALLGFGVLCTGGFLLLLLYWMPEWCVKSTCTRTTARDAEVVLLRSTDEFRRWFLARVQVMLAPGSNPFHSLETQTTSPSSPHSSPFSTPAASPVANGHTPHPSDGGPAQELMTRFS----DYQPTQI-RYFTFHSTKYYWNHELQNFQVLIGLEDMQPKCSTIHKEHSTGLTRNQQEYRKLFFGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSADEYYYYAVAIVFMSVVSIATSLYTIKKQYIMLHDMVTAHSIVRVSVCRTNKDIEEILSTDLVPGDVMVIPNNGTIMPCDAVLVSGTCIVNESMLTGESVPVTKTNLPN----------SVEGEG-----------DDAYNTEEHKRHTLFCGTNVIQTRFYTDELVKAVVVRTGFSTAKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYSIVLSIINKVPAKTIIIESLDIITITVPPALPAAMTAGIVYAQRRLKQSGIFCISPQRINICGQINLFCFDKTGTLTEDGLDLWGVQRVE-NSSFHLSEENAYKENLVKSQFVACMATCHSLTKIEGQLSGDPLDLKMFEATGWILEEATEEETSLHNRIMPTVVRPPKQLLPPEPASSSERDMELYELSSAYEIGIVRQFPFSSALQRMSVVARLLGEKRMDAYMKGAPEVVASLCKNETVPEDFAEVLEDYTKQGFRVIALAHRRLESKLSWHKVQNISRDHIETNMEFLGLIIMQNKLKNETPGILQDLHRANIRTVMVTGDNMLTAISVARDCGMIPPDDTVIIADAHPPQYG-QPARITWRYAD---KPSKTSRYEEVNITLED-------VCDADEPKSKEQYHFAMNGKSFATILEHFPDMLQKLVLRGTVFARMAPDQKTQLIEALQGVDYYVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSRTPNISCVPNLIREGRAALITSFCVFKFMALYSIIQYISVTLLYSILSNLGDLQFLFIDIAIILIIVFTMSLNPAWKDLVPRRPPSGLISGPLLFSVLTQILICLGFQIITFVWVQKQAWYTVWTPFTDVCNHSTQLNVSELNNTELDEHNIQNFENTSLFYVSSFQYLIVAVVFSKGKPFRQPSYKNWPFVLSTVGLYIFLLFILFHPVESIDETLEIVCVP-FEWRVKLFLIILVNAAVSVLVETFILD 1174          
BLAST of Cation-transporting ATPase vs. Ensembl Medaka
Match: atp13a3 (ATPase 13A3 [Source:NCBI gene;Acc:101158596])

HSP 1 Score: 818.92 bits (2114), Expect = 0.000e+0
Identity = 476/1160 (41.03%), Postives = 671/1160 (57.84%), Query Frame = 3
Query:  105 ITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVV--SIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCP--LIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMI------------AFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPL--KISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWY-VLPP------HSQKEVIHRAH------------ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIE 3473
            + +G+  + +++GY+   +++ L     + T   L L+ +WMP W +  + T  + R+A+++L +                              T  S I    +L +     L    P+   RYF     KY WN ++ +F+ L  +                        FG N+I V++  +  LL+KE LNPFY+FQ+ SV LW  D+Y  YA  IVFMS +S++  LY  +K    L + V   SI    VCR  K   +I + +LVPGD++ +P +G +M CDA L+SG CIVNESMLTGESVPVTKT L          PNSV+  G           D+ ++ ++H RH LFCGT VIQ+R + +E V AVVVRTG+ TAKG+LVRSIL+PKP D K  +DA  F+  L   A +GFIY+I++ +  ++    I+I SLDIITI +PPALP AMT GIV+AQ RLK+  I+CISP  IN CG IN+ CFDKTGTLTEDGLDLWGV   + + SF    ++  +  L     +  MATCHSL  I+G++ GDPLD+KMF++  W ++E  +   +  +  +P +            A    R+    +IGI+RQFPFSS+LQRMSV+ +       + Y+KG+PEV+++LC+ ET+P DF+  L  +T  G+RV+ALA+R L  K+S+ K+  I R  +E  + FLG ++M+N+LK ET  I++DL  A IR +MVTGDNMLTA+SVARDCG+I   D VI+ DA    Y                +P     +  R  V +  +P S       +  +H AM+GK++A I +  P ++ KLV++G VFAR APDQKTQLIE+LQ + YYV MCGDGANDCGALK AH GISLSE EASVASPFTS+  NISCVP LI+EGR AL TSF  FKFMA YS  Q+ISV +LY I++NL D QFL+ID+ ++  +  +   + A   L    P   L++  ++ S++ Q +    FQII + +V  Q WY V  P      HS +  +   +             N ++F VS FQY+++A+VFSKG PFR P YKN+ F+ + + +  F L+I+F P + +   L++   P     + LF  ++ N  +S  +E
Sbjct:    9 LNKGEEEEMELHGYRLCRWRLALLGFGVLCTGGFLLLLLYWMPEWCVKSTCTRTTARDAEVVLLRS-----------------------------TVRSNIYVGFRLISFFFLFLFFGLPQI--RYFTFHSTKYYWNHELQNFQVLMKL-----------------------FFGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSADEYYYYAVAIVFMSVVSIATSLYTIKKQYIMLHDMVTAHSIVRVSVCRTNKDIEEILSTDLVPGDVMVIPNNGTIMPCDAVLVSGTCIVNESMLTGESVPVTKTNL----------PNSVEGEG-----------DDAYNTEEHKRHTLFCGTNVIQTRFYTDELVKAVVVRTGFSTAKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAVAGIGFIYSIVLSIINKVPAKTIIIESLDIITITVPPALPAAMTAGIVYAQRRLKQSGIFCISPQRINICGQINLFCFDKTGTLTEDGLDLWGVQRVE-NSSFHLSEENAYKENLVKSQFVACMATCHSLTKIEGQLSGDPLDLKMFEATGWILEEATEEETSLHNRIMPTVVRPPKQLLPPEPASSSERDMSAYEIGIVRQFPFSSALQRMSVVARLLGEKRMDAYMKGAPEVVASLCKNETVPEDFAEVLEDYTKQGFRVIALAHRRLESKLSWHKVQNISRDHIETNMEFLGLIIMQNKLKNETPGILQDLHRANIRTVMVTGDNMLTAISVARDCGMIPPDDTVIIADAHPPQYG---------------QPA---RITWRYDVCDADEPKS-------KEQYHFAMNGKSFATILEHFPDMLQKLVLRGTVFARMAPDQKTQLIEALQGVDYYVGMCGDGANDCGALKRAHGGISLSELEASVASPFTSRTPNISCVPNLIREGRAALITSFCVFKFMALYSIIQYISVTLLYSILSNLGDLQFLFIDIAIILIIVFTMSLNPAWKDLVPRRPPSGLISGPLLFSVLTQILICLGFQIITFVWVQKQAWYTVWTPFTDVCNHSTQLNVSELNNTELDEHNIQNFENTSLFYVSSFQYLIVAVVFSKGKPFRQPSYKNWPFVLSTVGLYIFLLFILFHPVESIDETLEIVCVP-FEWRVKLFLIILVNAAVSVLVE 1066          
BLAST of Cation-transporting ATPase vs. Ensembl Medaka
Match: atp13a2 (ATPase cation transporting 13A2 [Source:NCBI gene;Acc:101155028])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 442/1170 (37.78%), Postives = 664/1170 (56.75%), Query Frame = 3
Query:  120 NSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQY-QQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYTSL-----PLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEP--VLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKE---GVDGNENEFDMSVPMIAFRRNRE-----GKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPD-FHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAH----ANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSL------------RRQMKRIKIIL 3530
            +S  ++ GYK   ++++L     +L+  +L L+FHW PR  +    + C +  AD++L +D   QQ+ +  +   ++ G      +++         +C D ++  K         + + R+++ + L+YIW  +   F  +  + +  T  Y  L      L  +E  +R ++FG N I+V +   + LLL+E LNPFYVFQ+ S++LW +D+Y  YA CI+ +S +S+ + LY+TR+   +LRN    +    + R       +++ ELVPGD + +P+ G LM CDA L+ G C+VNESMLTGESVPV KTPLP  +G V +S +  +                        RH LFCGT++IQ++         +AVV  TG+ TAKG LV SIL+P+PID +F +D+ KF+ +L   A +G IY  +V+   R+   +++IRSLD++TI +PPALP A+T G ++AQSRLK + I+CISP  IN CG +++ CFDKTGTLTE+GLD+WGV+ + P G F D V DP  +A  PL   +A CH++ ++DG+  GDPL++KM +S+ W ++E     D    EF     +   R   +     G      I+R+FPFSS+LQRMSV+T          ++KGSPE++++LCR ET+P  F+ +L  F+  G RVLALA + ++ S S +  + R EVE +++FLG ++M+N +K E+  +I  L  A IR +MVTGDN+LTA++VAR CG++   +KV+ V A   S     T + F   E            +       + P  +   + +     H A+SGK++A + D  P  +PK++++  VFAR APDQKTQL+  LQ + Y V MCGDGANDCGAL+AA  G+SLSE EASVASPFTSK  NISCVP LI+EGRC+L TSF  F++MA YS  QF SVL+L  +  N+ D QFL+ DL ++T L+I  G      +L    P   LL   +  SL +     AL Q+ A+F    Q WYV P +S   V   A+     N  +F +S FQY+++A+V +K  P + P+Y N IFL  L++  +  LY                    +   ++L +    NFL+ +  E ++D   L            ++Q KR+K++L
Sbjct:   26 DSHMEVQGYKWVKWRVWLCRLAALLSLGLLLLVFHWRPRLAVLARCSSCPVASADVLLIRDSCGQQHVVEVLTEEVEEGSLDLLGKLDES-------ECRDTVQLYKDE-------KTLLRFYVFEGLRYIWLDRKGAFCRVSVLNEDWT--YRDLHRLQRGLDPLEQSSRRSMFGSNLIDVPVKSYMKLLLEEVLNPFYVFQVFSISLWMIDEYYYYALCILLISIVSIGVSLYETRRQSITLRNMARLVTKVTIRRGSGVEESVSSEELVPGDCLVIPQEGLLMPCDAALLVGECLVNESMLTGESVPVLKTPLP--SGDVTYSADGDR------------------------RHTLFCGTQLIQAKGGGPGGSGAVAVVTNTGFFTAKGHLVSSILYPQPIDFRFYRDSAKFLLILGFIASIGTIYIFVVLCRTRVTWLQLIIRSLDVVTIAVPPALPAAITTGTIYAQSRLKNRGIFCISPPRINVCGKVSLFCFDKTGTLTEEGLDVWGVMEAGPAG-FSDLVPDPRLLAPGPLQSGLACCHTVTLLDGQAIGDPLELKMVESVGWTLQEPEAAADALNAEFGGCRVLAVMRPPPQRPQAWGASEPAAIVRRFPFSSALQRMSVVTVGRGGRPALAFMKGSPEMVASLCRPETVPAQFAGRLHGFSSEGLRVLALACKAVRAS-SDVQSVERAEVERDMQFLGLMMMKNLVKAESPKVINTLSLAHIRSVMVTGDNILTAVNVARSCGMVGADEKVVFVTANPHSTQSAPT-LRFSLEE------------QGGAAAAANPPDGLSQHLYQGGSAHHFAISGKSFAALCDYFPDYLPKVLMQATVFARMAPDQKTQLVTELQKLNYRVGMCGDGANDCGALRAADVGVSLSEAEASVASPFTSKTENISCVPLLIREGRCSLVTSFSLFRYMALYSLIQFCSVLLLNTVKTNVGDLQFLFCDLFLVTLLAIVMGRGGPSEELHPSRPPASLLALPVFGSLFMHVCMLALGQLAAFFITTSQDWYV-PLNST--VFGTANLPNMENTGVFVLSGFQYVMMAVVVTKAYPHKKPLYHNKIFLLVLLIHFAVMLY----------------DITDMNFKMLLVAVAALNFLVCFVAEMLVDLGVLNCLRSLCGTRQSKKQYKRLKVLL 1119          
BLAST of Cation-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000005833.2 (pep primary_assembly:ASM223467v1:17:5612645:5626228:-1 gene:ENSORLG00000004634.2 transcript:ENSORLT00000005833.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 333/692 (48.12%), Postives = 451/692 (65.17%), Query Frame = 3
Query:  894 QINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMAL--CPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFR-----RNREGKD------VQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWI 2930
            Q  + ELVPGD+I +P +G +M CDA L  GNC+VNESMLTGES+PVTKT LP+              SG            E++++++H RH LFCGT+VIQ+R +  E V AVVVRTG+ T KG+LVRSIL+PKP D K  +DA  F+  L   A +GFIYT+++ +  +     I+I SLDIITI IPPALP AMT GIV+AQ RLK+  I+CISP  IN CG +N+ CFDKTGTLTEDGLDLWGV  +   GSF  P  + S  +L     +  MATCHSL  I+GE+ GDPLD+KMF +  W ++E  +      +  +P +           +G+        +IGI+ QFPFSS+LQRMSV+ +   + + + Y+KG+PEV+++LC+  T+P+ F+  L  +T  G+RV+ALA+R L+  ++ ++ +    +E  + FLG ++M+N++KPET  ++ DL+ A IR +MVTGDNMLTA+SVARDCG++   + +I+VDA     +     I ++Y                     D+ P +VK    +   +H A+SG+ +A+I +  PQL+ KL +K  VFAR AP+QKTQL+E LQS+ Y V MCGDGANDCGALK AH+GISLSE EASVASPFTS  +NISCVP LI+EGR AL TSF  FKFMA YS  Q+ISV++LYW+
Sbjct:    6 QAMSTELVPGDVIVIPANGMMMPCDAILFHGNCVVNESMLTGESIPVTKTSLPS--------------SGHDAA--------EIYNMEEHKRHTLFCGTQVIQTRFYAGELVKAVVVRTGFSTEKGQLVRSILYPKPTDFKLYRDAYLFLLCLVGVAGIGFIYTVVLSIMTK----TIIIESLDIITITIPPALPAAMTAGIVYAQRRLKRVGIFCISPQRINMCGQLNLVCFDKTGTLTEDGLDLWGVQRAHA-GSFVPPESEASGESLLNSSFVACMATCHSLTKIEGELSGDPLDLKMFAATGWILEEPTEEETALHNQLMPTVVHPPKPSLTGAQGRQFLPRISCEIGIVHQFPFSSALQRMSVVVRRLGQKHMDAYLKGAPEVVASLCKVHTVPQSFTETLESYTRQGFRVIALAHRQLE--HTHVLDL----IETNMDFLGLIIMQNKIKPETAGVLHDLQRANIRTLMVTGDNMLTAISVARDCGMVHAHEPIIIVDAA-PPKDSQPASIRWNY--------------------TDNTPQAVKD--HQEGPYHFALSGRGFAVITEFFPQLMHKLALKTTVFARMAPEQKTQLVEVLQSMDYIVGMCGDGANDCGALKRAHSGISLSELEASVASPFTSSTSNISCVPNLIREGRAALITSFCVFKFMALYSIIQYISVILLYWV 641          
BLAST of Cation-transporting ATPase vs. Planmine SMEST
Match: SMESG000002031.1 (SMESG000002031.1)

HSP 1 Score: 2519.58 bits (6529), Expect = 0.000e+0
Identity = 1242/1243 (99.92%), Postives = 1243/1243 (100.00%), Query Frame = 3
Query:   90 MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC 3818
            MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYF+HKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRLLTTTMMSSLILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYERIREEINNNSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC
Sbjct:    1 MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFMHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRLLTTTMMSSLILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYERIREEINNNSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC 1243          
BLAST of Cation-transporting ATPase vs. Planmine SMEST
Match: SMESG000002031.1 (SMESG000002031.1)

HSP 1 Score: 2491.84 bits (6457), Expect = 0.000e+0
Identity = 1233/1243 (99.20%), Postives = 1234/1243 (99.28%), Query Frame = 3
Query:   90 MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC 3818
            MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYK         NDKLKTKKTRLLIDYQPEQVNRYF+HKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRLLTTTMMSSLILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYERIREEINNNSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC
Sbjct:    1 MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKS--------NDKLKTKKTRLLIDYQPEQVNRYFMHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRLLTTTMMSSLILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYERIREEINNNSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC 1235          
BLAST of Cation-transporting ATPase vs. Planmine SMEST
Match: SMESG000002031.1 (SMESG000002031.1)

HSP 1 Score: 2471.04 bits (6403), Expect = 0.000e+0
Identity = 1224/1243 (98.47%), Postives = 1225/1243 (98.55%), Query Frame = 3
Query:   90 MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKRTFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC 3818
            MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGES                  NDKLKTKKTRLLIDYQPEQVNRYF+HKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRLLTTTMMSSLILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYERIREEINNNSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC
Sbjct:    1 MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRWYIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGES------------------NDKLKTKKTRLLIDYQPEQVNRYFMHKKLKYIWNWKILHFEALDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGLNPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRLLTTTMMSSLILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYERIREEINNNSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC 1225          
BLAST of Cation-transporting ATPase vs. Planmine SMEST
Match: SMESG000053287.1 (SMESG000053287.1)

HSP 1 Score: 1554.65 bits (4024), Expect = 0.000e+0
Identity = 755/995 (75.88%), Postives = 871/995 (87.54%), Query Frame = 3
Query:  774 MSALSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPD 3758
            MS +SLS+QLY+TRKNE SLRNT+ S G+T   RD     QI+  ELVPGDI+ELPRSG LM+CDA LISGNCIVNESMLTGESVP+TKTPLPNP G +PFSPN +  +   I   K    DE FDLKKH RHVLFCGT VIQ+RNFENEPVLAVVVRTG+LTAKGELVRSILFPKPID K N+D  KFIGVL+LFALVGF+YT+IVMV R+I +  IVIRSLDIITIIIPPALPVAMTIG++FAQSRLKKKSI+CISPNTIN CGGINVSCFDKTGTLTEDGLDLWGVVASK DGSF DP+ +P  + L   +E MATCHSLNII+GEI GDPLD+KMF+SI+W+IKEGVDGNEN+F+MSVP+IA++ N E K  QI ILRQFPFSSSLQRMSVITKF +RMN+N+YVKGSPEV+STLCRKETLPRDFSSKLL FTHSGYRV+ALA+RPLKISYSK+M+IPR +VE +LRFLGFLVMENRLKPETE+II  LK+AMIRPIMVTGDNMLTA+SVARDC +I+E DKVILVDAR+   N  D IIEFHYAEDLQR V+EI+V K      +    +VKIC++ERPDFHLAMSGKTW +IRDKCPQLIPKLVVKG VFARFAPDQK+QLIE+LQS+GYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKI NISCVPELIK+GRCALTTSFGTFKFMAGYSFTQFISVLMLYWI +N+SD+QFLYIDL+++TTLSI++GYSKAC KLSVETPS+RLLT  MM+SL+ Q   NALFQ+  YFYV +Q WYVLP  S+ EVIH++HAN A+FSV++FQYI+LA+VFSKGAPFRAPIY+NYIF+AN+   ++ T+Y++FKPFQWL+NLL+LESFPSL V+LIL  F +ANF ISY +EFVIDN++L++QMKRI+++LFP SVDQ EYE+IRE+INNN++SWPPIIKC SVQEMR EIFTD+SNLH SQSAQD+++TKD + DMD+L+EE E D
Sbjct:    1 MSTMSLSVQLYNTRKNEKSLRNTIASNGYTNTYRD-LALIQIDTTELVPGDIVELPRSGGLMHCDAVLISGNCIVNESMLTGESVPITKTPLPNPMGLIPFSPNQMSTNELDIKYCKTANNDEPFDLKKHGRHVLFCGTSVIQTRNFENEPVLAVVVRTGFLTAKGELVRSILFPKPIDAKLNKDGFKFIGVLSLFALVGFVYTVIVMVARKIAIISIVIRSLDIITIIIPPALPVAMTIGVIFAQSRLKKKSIFCISPNTINACGGINVSCFDKTGTLTEDGLDLWGVVASKSDGSFGDPITNPETLPLANFVECMATCHSLNIINGEISGDPLDVKMFESIQWNIKEGVDGNENDFEMSVPIIAYKDNYEAKPHQIAILRQFPFSSSLQRMSVITKFRTRMNFNIYVKGSPEVISTLCRKETLPRDFSSKLLHFTHSGYRVIALAHRPLKISYSKLMKIPRQQVESDLRFLGFLVMENRLKPETEAIINQLKSAMIRPIMVTGDNMLTAISVARDCEMIAENDKVILVDARMSPDNSTDPIIEFHYAEDLQRQVNEIAVFK------NENHKTVKICIMERPDFHLAMSGKTWELIRDKCPQLIPKLVVKGTVFARFAPDQKSQLIEALQSVGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIPNISCVPELIKQGRCALTTSFGTFKFMAGYSFTQFISVLMLYWISSNISDFQFLYIDLVIITTLSITFGYSKACKKLSVETPSMRLLTIPMMTSLVFQCTINALFQVAGYFYVKYQSWYVLPV-SKDEVIHQSHANMAVFSVAIFQYIILALVFSKGAPFRAPIYRNYIFIANITGTLALTVYVIFKPFQWLKNLLELESFPSLNVSLILLGFSLANFGISYLVEFVIDNITLQQQMKRIRLLLFPISVDQKEYEKIREDINNNASSWPPIIKCVSVQEMRSEIFTDSSNLHHSQSAQDINTTKDKESDMDILREESESD 987          
BLAST of Cation-transporting ATPase vs. Planmine SMEST
Match: SMESG000053287.1 (SMESG000053287.1)

HSP 1 Score: 1551.57 bits (4016), Expect = 0.000e+0
Identity = 753/992 (75.91%), Postives = 869/992 (87.60%), Query Frame = 3
Query:  783 LSLSIQLYDTRKNENSLRNTVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGNCIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVIDEVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSILFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRSLDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSCFDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHSLNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNREGKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRKETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRFLGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIISEWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSKPSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPDQKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVANLSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRXXXXXXXXXXILQWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQYIVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQLESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQSVDQVEYXXXXXXXXXXSASWPPIIKCASVQEMRPEIFTDASNLHVSQSAQDLSSTKDDQKDMDMLKEELEPD 3758
            +SLS+QLY+TRKNE SLRNT+ S G+T   RD     QI+  ELVPGDI+ELPRSG LM+CDA LISGNCIVNESMLTGESVP+TKTPLPNP G +PFSPN +  +   I   K    DE FDLKKH RHVLFCGT VIQ+RNFENEPVLAVVVRTG+LTAKGELVRSILFPKPID K N+D  KFIGVL+LFALVGF+YT+IVMV R+I +  IVIRSLDIITIIIPPALPVAMTIG++FAQSRLKKKSI+CISPNTIN CGGINVSCFDKTGTLTEDGLDLWGVVASK DGSF DP+ +P  + L   +E MATCHSLNII+GEI GDPLD+KMF+SI+W+IKEGVDGNEN+F+MSVP+IA++ N E K  QI ILRQFPFSSSLQRMSVITKF +RMN+N+YVKGSPEV+STLCRKETLPRDFSSKLL FTHSGYRV+ALA+RPLKISYSK+M+IPR +VE +LRFLGFLVMENRLKPETE+II  LK+AMIRPIMVTGDNMLTA+SVARDC +I+E DKVILVDAR+   N  D IIEFHYAEDLQR V+EI+V K      +    +VKIC++ERPDFHLAMSGKTW +IRDKCPQLIPKLVVKG VFARFAPDQK+QLIE+LQS+GYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKI NISCVPELIK+GRCALTTSFGTFKFMAGYSFTQFISVLMLYWI +N+SD+QFLYIDL+++TTLSI++GYSKAC KLSVETPS+RLLT  MM+SL+ Q   NALFQ+  YFYV +Q WYVLP  S+ EVIH++HAN A+FSV++FQYI+LA+VFSKGAPFRAPIY+NYIF+AN+   ++ T+Y++FKPFQWL+NLL+LESFPSL V+LIL  F +ANF ISY +EFVIDN++L++QMKRI+++LFP SVDQ EYE+IRE+INNN++SWPPIIKC SVQEMR EIFTD+SNLH SQSAQD+++TKD + DMD+L+EE E D
Sbjct:    1 MSLSVQLYNTRKNEKSLRNTIASNGYTNTYRD-LALIQIDTTELVPGDIVELPRSGGLMHCDAVLISGNCIVNESMLTGESVPITKTPLPNPMGLIPFSPNQMSTNELDIKYCKTANNDEPFDLKKHGRHVLFCGTSVIQTRNFENEPVLAVVVRTGFLTAKGELVRSILFPKPIDAKLNKDGFKFIGVLSLFALVGFVYTVIVMVARKIAIISIVIRSLDIITIIIPPALPVAMTIGVIFAQSRLKKKSIFCISPNTINACGGINVSCFDKTGTLTEDGLDLWGVVASKSDGSFGDPITNPETLPLANFVECMATCHSLNIINGEISGDPLDVKMFESIQWNIKEGVDGNENDFEMSVPIIAYKDNYEAKPHQIAILRQFPFSSSLQRMSVITKFRTRMNFNIYVKGSPEVISTLCRKETLPRDFSSKLLHFTHSGYRVIALAHRPLKISYSKLMKIPRQQVESDLRFLGFLVMENRLKPETEAIINQLKSAMIRPIMVTGDNMLTAISVARDCEMIAENDKVILVDARMSPDNSTDPIIEFHYAEDLQRQVNEIAVFK------NENHKTVKICIMERPDFHLAMSGKTWELIRDKCPQLIPKLVVKGTVFARFAPDQKSQLIEALQSVGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFTSKIPNISCVPELIKQGRCALTTSFGTFKFMAGYSFTQFISVLMLYWISSNISDFQFLYIDLVIITTLSITFGYSKACKKLSVETPSMRLLTIPMMTSLVFQCTINALFQVAGYFYVKYQSWYVLPV-SKDEVIHQSHANMAVFSVAIFQYIILALVFSKGAPFRAPIYRNYIFIANITGTLALTVYVIFKPFQWLKNLLELESFPSLNVSLILLGFSLANFGISYLVEFVIDNITLQQQMKRIRLLLFPISVDQKEYEKIREDINNNASSWPPIIKCVSVQEMRSEIFTDSSNLHHSQSAQDINTTKDKESDMDILREESESD 984          
The following BLAST results are available for this feature:
BLAST of Cation-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP13A30.000e+041.62ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113][more]
ATP13A30.000e+041.62ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113][more]
ATP13A30.000e+041.62ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113][more]
ATP13A30.000e+040.94ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113][more]
ATP13A30.000e+043.46ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113][more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
catp-60.000e+039.51Probable cation-transporting ATPase W08D2.5 [Sour... [more]
catp-70.000e+038.48Cation-transporting ATPase [Source:UniProtKB/TrEM... [more]
catp-70.000e+038.48Cation-transporting ATPase [Source:UniProtKB/TrEM... [more]
catp-60.000e+041.42Probable cation-transporting ATPase W08D2.5 [Sour... [more]
catp-70.000e+038.48Cation-transporting ATPase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anne0.000e+038.60gene:FBgn0052000 transcript:FBtr0113417[more]
anne0.000e+038.37gene:FBgn0052000 transcript:FBtr0089451[more]
anne0.000e+038.37gene:FBgn0052000 transcript:FBtr0333161[more]
anne0.000e+038.37gene:FBgn0052000 transcript:FBtr0089449[more]
anne0.000e+038.37gene:FBgn0052000 transcript:FBtr0089448[more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp13a20.000e+037.30ATPase cation transporting 13A2 [Source:ZFIN;Acc:Z... [more]
atp13a20.000e+037.30ATPase cation transporting 13A2 [Source:ZFIN;Acc:Z... [more]
atp13a12.433e-8731.76ATPase 13A1 [Source:ZFIN;Acc:ZDB-GENE-040426-2804][more]
atp13a33.694e-8639.34ATPase 13A3 [Source:ZFIN;Acc:ZDB-GENE-120521-1][more]
atp1a3b9.691e-3323.77ATPase Na+/K+ transporting subunit alpha 3b [Sourc... [more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP13A30.000e+041.53ATPase type 13A3 [Source:NCBI gene;Acc:100497750][more]
a4gnt0.000e+038.86alpha-1,4-N-acetylglucosaminyltransferase [Source:... [more]
ATP13A30.000e+039.73ATPase type 13A3 [Source:NCBI gene;Acc:100497750][more]
ATP13A30.000e+044.70ATPase type 13A3 [Source:NCBI gene;Acc:100497750][more]
tma160.000e+037.91translation machinery associated 16 homolog [Sourc... [more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp13a30.000e+040.30ATPase type 13A3 [Source:MGI Symbol;Acc:MGI:268538... [more]
Atp13a30.000e+040.49ATPase type 13A3 [Source:MGI Symbol;Acc:MGI:268538... [more]
Atp13a20.000e+040.04ATPase type 13A2 [Source:MGI Symbol;Acc:MGI:192202... [more]
Atp13a40.000e+038.98ATPase type 13A4 [Source:MGI Symbol;Acc:MGI:192445... [more]
Atp13a20.000e+040.37ATPase type 13A2 [Source:MGI Symbol;Acc:MGI:192202... [more]
back to top
BLAST of Cation-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H7F0|AT133_HUMAN0.000e+041.62Probable cation-transporting ATPase 13A3 OS=Homo s... [more]
sp|Q5XF89|AT133_MOUSE0.000e+040.30Probable cation-transporting ATPase 13A3 OS=Mus mu... [more]
sp|Q5ZKB7|AT134_CHICK0.000e+038.96Probable cation-transporting ATPase 13A4 OS=Gallus... [more]
sp|Q27533|YH2M_CAEEL0.000e+039.51Probable cation-transporting ATPase W08D2.5 OS=Cae... [more]
sp|Q9CTG6|AT132_MOUSE0.000e+040.04Cation-transporting ATPase 13A2 OS=Mus musculus OX... [more]
back to top
BLAST of Cation-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G5310.000e+048.40Cation-transporting ATPase OS=Macrostomum lignano ... [more]
A0A4S2LI190.000e+046.65Cation-transporting ATPase OS=Opisthorchis felineu... [more]
A0A4S2LFV30.000e+046.60Cation-transporting ATPase OS=Opisthorchis felineu... [more]
A0A267G6L10.000e+047.99Cation-transporting ATPase (Fragment) OS=Macrostom... [more]
A0A267EAN30.000e+047.99Cation-transporting ATPase OS=Macrostomum lignano ... [more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp13a20.000e+038.79ATPase cation transporting 13A2 [Source:NCBI gene;... [more]
atp13a20.000e+038.57ATPase cation transporting 13A2 [Source:NCBI gene;... [more]
ATP13A30.000e+049.51ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113][more]
ATP13A31.041e-8344.67ATPase 13A3 [Source:HGNC Symbol;Acc:HGNC:24113][more]
atp13a11.378e-8330.17ATPase 13A1 [Source:NCBI gene;Acc:103035743][more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP13A40.000e+038.61ATPase 13A4 [Source:HGNC Symbol;Acc:HGNC:25422][more]
atp13a31.713e-4947.44ATPase 13A3 [Source:ZFIN;Acc:ZDB-GENE-120521-1][more]
ENSPMAT00000002888.11.050e-1423.82pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1... [more]
ENSPMAT00000002145.11.225e-1227.44pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene... [more]
ENSPMAT00000007912.11.108e-1124.33pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 g... [more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPK90.000e+038.14Vacuolar protein with a possible role in sequester... [more]
SPF11.560e-7529.75P-type ATPase, ion transporter of the ER membrane;... [more]
ENA15.236e-2923.08P-type ATPase sodium pump; involved in Na+ and Li+... [more]
ENA29.668e-2923.65P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA51.000e-2823.08Protein with similarity to P-type ATPase sodium pu... [more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414610.000e+045.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447274.962e-8830.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447253.200e-6528.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364553.419e-2223.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464331.491e-1942.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cation-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp13a30.000e+041.36ATPase 13A3 [Source:NCBI gene;Acc:101158596][more]
atp13a30.000e+041.33ATPase 13A3 [Source:NCBI gene;Acc:101158596][more]
atp13a30.000e+041.03ATPase 13A3 [Source:NCBI gene;Acc:101158596][more]
atp13a20.000e+037.78ATPase cation transporting 13A2 [Source:NCBI gene;... [more]
ENSORLT00000005833.20.000e+048.12pep primary_assembly:ASM223467v1:17:5612645:562622... [more]
back to top
BLAST of Cation-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002031.10.000e+099.92SMESG000002031.1[more]
SMESG000002031.10.000e+099.20SMESG000002031.1[more]
SMESG000002031.10.000e+098.47SMESG000002031.1[more]
SMESG000053287.10.000e+075.88SMESG000053287.1[more]
SMESG000053287.10.000e+075.91SMESG000053287.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029665 ID=SMED30029665|Name=Cation-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=4180bp
TTTAAATGAACATTTTTTTGTAAAAGTTGGTTTTTAAAATCACTCAACAT
TTTTGTAAGACACTTTTAAAGATTTGTAGAGTGCGGTTAATGCTGAATCA
AAAAATTACCGAAGGTGACAATAGCAAAACAGACATTTATGGATATAAAA
GAAATAATTTTAAAATATTTTTAACATGGACTTTATACATTTTAACTGCT
TTTATTTTACGTTTGATTTTTCACTGGATGCCGAGATGGTATATATATAT
TAGCCATACACCATGTTCTTTACGAGAAGCTGATATAATTTTGGCAAAAG
ATCAATATCAACAATATTGGATTCATGAAGTTAAATTAACTTTAAAAAAT
GGTGAAAGTGTTAAAGCATCTCAGATTAATTACAAAAGAACTTTTCATTC
AATCATTAAATGCAACGATAAACTCAAAACCAAAAAGACTCGATTACTGA
TAGATTATCAGCCAGAACAAGTCAATCGTTATTTTATACACAAAAAATTG
AAATATATTTGGAATTGGAAAATCTTACATTTTGAAGCTTTGGATGGGAT
TGAACAGACTTGTACCGAGTTTTACACTTCACTTCCATTGACAGAAATTG
AAGTGCAAAATCGAATTGCACTATTTGGCGAAAATAAAATTGAAGTGCAA
ATTACTCCATTGCTTGTACTTTTATTGAAAGAGGGTCTCAATCCATTCTA
CGTGTTCCAAATATGCAGTGTTACATTGTGGTTTCTCGACGACTATGTCG
TTTACGCCGGCTGCATCGTTTTCATGTCTGCATTGTCATTGTCAATTCAA
CTTTATGATACAAGAAAGAATGAAAACTCGTTACGGAATACAGTGGTCAG
TATTGGGCATACTTTGGTTTGTCGAGATGGGAAAACTTTCTGTCAAATAA
ATGCTAATGAATTGGTTCCTGGAGACATAATAGAGTTGCCTAGATCTGGT
TGCTTAATGTACTGTGATGCCACACTAATCAGTGGAAATTGCATTGTCAA
TGAAAGCATGCTTACAGGGGAAAGTGTGCCTGTTACTAAAACTCCATTAC
CTAATCCAACGGGATTTGTTCCGTTTTCACCTAATTCTGTAAAAGACAGT
GGTGAGCAAATAGTCAGTTTAAAGAAAGAGGTCATTGATGAAGTCTTCGA
CTTGAAAAAACATAGCAGGCATGTTCTTTTCTGTGGAACCAAAGTTATAC
AGTCGAGAAATTTTGAGAATGAGCCTGTTTTAGCAGTAGTTGTTCGTACT
GGCTATTTGACAGCAAAGGGAGAATTAGTTCGTTCGATTCTGTTTCCGAA
ACCGATTGATGTAAAGTTCAATCAGGATGCCCTTAAGTTTATTGGGGTTT
TGGCACTGTTTGCACTCGTGGGATTTATTTACACTATTATAGTGATGGTC
AACAGGCGCATTGAAGTCTATAAAATCGTTATTAGGTCATTAGACATAAT
AACTATTATCATTCCCCCCGCATTGCCTGTTGCTATGACGATCGGAATAG
TATTTGCACAATCAAGATTGAAAAAGAAAAGTATTTATTGTATCAGCCCA
AATACTATAAATACATGCGGTGGAATCAATGTTTCGTGCTTTGATAAGAC
TGGAACATTAACTGAGGATGGATTAGATTTGTGGGGTGTAGTTGCAAGCA
AACCCGACGGGTCATTTGAGGATCCCGTTGATGATCCAAGTGAAATGGCT
TTGTGTCCTTTAATAGAAAGTATGGCAACTTGTCATTCATTGAATATAAT
TGACGGGGAAATTTGTGGAGATCCTCTCGATATAAAAATGTTTCAGTCTA
TTAAATGGGATATTAAAGAGGGTGTTGATGGCAATGAAAACGAATTCGAC
ATGTCTGTACCAATGATTGCGTTCAGGAGGAATAGAGAAGGAAAAGACGT
TCAAATTGGCATTCTTCGACAGTTTCCTTTTAGTTCTTCTTTGCAGCGAA
TGTCTGTTATTACAAAATTTAGTTCCAGAATGAATTACAATCTCTACGTA
AAAGGTTCCCCGGAGGTTTTAAGTACACTCTGTCGCAAAGAAACATTGCC
CAGAGACTTTAGTTCAAAGTTGCTTCAGTTCACCCATTCTGGCTATCGAG
TTTTAGCATTGGCTTATCGGCCATTAAAAATCAGTTATTCAAAAATGATG
CGTATACCTCGTCATGAAGTTGAGTGTGAATTGAGGTTTTTGGGGTTTTT
AGTGATGGAGAATAGATTGAAACCAGAAACTGAGAGCATTATTGAGGATC
TGAAGGCCGCCATGATTCGTCCCATTATGGTTACAGGTGACAATATGTTG
ACGGCGCTCTCAGTTGCCAGGGATTGTGGAATAATCTCTGAATGGGATAA
AGTTATTTTAGTCGATGCCAGGCTCGATTCGTATAATGTAAATGATACAA
TTATTGAGTTTCATTATGCTGAAGACCTTCAAAGGCCGGTCAGTGAAATA
TCTGTTCTGAAACGAAACCGTGTGGTGAATGATTCTAAACCCAGTTCGGT
TAAAATTTGTGTTATCGAGAGACCTGATTTTCATTTAGCCATGTCTGGGA
AGACTTGGGCCATTATCCGTGACAAGTGTCCACAATTAATTCCAAAGCTG
GTCGTCAAAGGAGCAGTGTTCGCTAGATTTGCACCGGATCAGAAAACCCA
ATTAATTGAATCTCTGCAGTCAATTGGTTATTACGTATCAATGTGCGGTG
ATGGTGCTAACGATTGCGGAGCATTGAAAGCGGCACATGCTGGAATATCA
TTGAGTGAAACGGAAGCCAGTGTAGCAAGTCCGTTCACATCTAAAATCGC
AAATATATCTTGTGTACCCGAACTAATCAAAGAAGGCCGTTGTGCTTTAA
CAACAAGTTTTGGTACATTTAAATTCATGGCCGGATACAGTTTCACTCAA
TTCATTTCAGTTCTCATGCTTTATTGGATCGTTGCGAATTTGTCGGATTA
TCAATTTCTCTATATAGATCTAATAGTTCTCACAACTCTCAGCATTTCAT
ATGGGTATTCAAAAGCCTGCACAAAATTATCCGTAGAAACCCCGAGTGTT
AGATTACTGACAACTACTATGATGTCCTCTCTGATACTTCAGTGGATTTG
TAATGCTTTATTCCAGATAATTGCCTATTTTTATGTGAATCATCAGCCTT
GGTATGTCTTACCGCCTCATTCTCAAAAAGAGGTCATTCATCGAGCTCAT
GCGAATGCTGCAATATTTTCAGTGTCGGTATTTCAGTATATTGTACTTGC
TATTGTCTTTTCCAAAGGTGCTCCTTTTCGTGCACCGATATACAAAAATT
ATATATTTCTTGCTAATCTGATCGTTGTTATTTCTTTTACGCTTTATATT
GTGTTCAAGCCTTTCCAATGGTTGAGAAATCTGTTACAGCTGGAGTCATT
TCCATCGTTACTTGTCAATCTGATCTTATTTTCATTTGTTATCGCCAATT
TCTTGATCTCATACTTTATCGAATTTGTCATTGATAATATGTCCTTGCGC
CGTCAAATGAAGCGTATCAAAATCATTCTCTTTCCTCAGTCTGTTGACCA
AGTTGAATACGAACGAATCCGAGAAGAAATCAATAATAATTCAGCATCAT
GGCCACCCATCATTAAATGTGCCAGTGTTCAGGAAATGAGGCCTGAAATA
TTTACCGATGCGTCGAATCTTCATGTTTCCCAATCTGCCCAAGATCTGAG
TAGTACAAAGGATGACCAGAAAGACATGGATATGTTAAAGGAAGAACTTG
AGCCGGACGACGTGCTGAGTGCTTCGGATGGTGAGACGAAACCAGTGCAA
TCCTTAACCAAAAGTTGCTAAATACGCCAACTCTAGCGATATGTGGGCAA
AATGATGTTTTTATTGTAATATTACAACGAATTATTTGCTTTTATTTATC
TTTCACCTAATATTACTATTGTTGATTTTGATTTTCTAATTGATCGTTAA
CCTTGGATAATATCCTGTGAATATTCATATTTTGTAATTTTTATAGCTAA
TTTTGCAATATATTTATATATTAATATATGCATATATTATTGATTAATAT
TTAGATGGCACGATCAATAATCAATATTCTTTCCGGTGATTTATTTTATG
GAATTTTGTAAATGAGTGCAAAATAAAATATAAATGTAGAATCGATTTGA
ATATTCGAGTGGAGTATTGATTAAAACTTT
back to top

protein sequence of SMED30029665-orf-1

>SMED30029665-orf-1 ID=SMED30029665-orf-1|Name=SMED30029665-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1244bp
MLNQKITEGDNSKTDIYGYKRNNFKIFLTWTLYILTAFILRLIFHWMPRW
YIYISHTPCSLREADIILAKDQYQQYWIHEVKLTLKNGESVKASQINYKR
TFHSIIKCNDKLKTKKTRLLIDYQPEQVNRYFIHKKLKYIWNWKILHFEA
LDGIEQTCTEFYTSLPLTEIEVQNRIALFGENKIEVQITPLLVLLLKEGL
NPFYVFQICSVTLWFLDDYVVYAGCIVFMSALSLSIQLYDTRKNENSLRN
TVVSIGHTLVCRDGKTFCQINANELVPGDIIELPRSGCLMYCDATLISGN
CIVNESMLTGESVPVTKTPLPNPTGFVPFSPNSVKDSGEQIVSLKKEVID
EVFDLKKHSRHVLFCGTKVIQSRNFENEPVLAVVVRTGYLTAKGELVRSI
LFPKPIDVKFNQDALKFIGVLALFALVGFIYTIIVMVNRRIEVYKIVIRS
LDIITIIIPPALPVAMTIGIVFAQSRLKKKSIYCISPNTINTCGGINVSC
FDKTGTLTEDGLDLWGVVASKPDGSFEDPVDDPSEMALCPLIESMATCHS
LNIIDGEICGDPLDIKMFQSIKWDIKEGVDGNENEFDMSVPMIAFRRNRE
GKDVQIGILRQFPFSSSLQRMSVITKFSSRMNYNLYVKGSPEVLSTLCRK
ETLPRDFSSKLLQFTHSGYRVLALAYRPLKISYSKMMRIPRHEVECELRF
LGFLVMENRLKPETESIIEDLKAAMIRPIMVTGDNMLTALSVARDCGIIS
EWDKVILVDARLDSYNVNDTIIEFHYAEDLQRPVSEISVLKRNRVVNDSK
PSSVKICVIERPDFHLAMSGKTWAIIRDKCPQLIPKLVVKGAVFARFAPD
QKTQLIESLQSIGYYVSMCGDGANDCGALKAAHAGISLSETEASVASPFT
SKIANISCVPELIKEGRCALTTSFGTFKFMAGYSFTQFISVLMLYWIVAN
LSDYQFLYIDLIVLTTLSISYGYSKACTKLSVETPSVRLLTTTMMSSLIL
QWICNALFQIIAYFYVNHQPWYVLPPHSQKEVIHRAHANAAIFSVSVFQY
IVLAIVFSKGAPFRAPIYKNYIFLANLIVVISFTLYIVFKPFQWLRNLLQ
LESFPSLLVNLILFSFVIANFLISYFIEFVIDNMSLRRQMKRIKIILFPQ
SVDQVEYERIREEINNNSASWPPIIKCASVQEMRPEIFTDASNLHVSQSA
QDLSSTKDDQKDMDMLKEELEPDDVLSASDGETKPVQSLTKSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001757P_typ_ATPase
IPR023298ATPase_P-typ_TM_dom_sf
IPR036412HAD-like_sf
IPR004014ATPase_P-typ_cation-transptr_N
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023299ATPase_P-typ_cyto_dom_N
IPR023214HAD_sf
IPR006544P-type_TPase_V
IPR018303ATPase_P-typ_P_site
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0016887ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006812cation transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 500..514
score: 55.21
coord: 869..888
score: 52.03
coord: 304..318
score: 57.42
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 526..650
e-value: 4.5E-7
score: 29.9
NoneNo IPR availableGENE3DG3DSA:2.70.150.20coord: 251..347
e-value: 3.2E-12
score: 48.3
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 258..480
e-value: 6.6E-36
score: 123.5
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 369..513
e-value: 1.8E-7
score: 32.2
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 482..919
e-value: 0.0
score: 250.4
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 482..919
e-value: 0.0
score: 250.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1199..1243
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1205..1228
NoneNo IPR availablePANTHERPTHR45630FAMILY NOT NAMEDcoord: 5..1146
NoneNo IPR availablePANTHERPTHR45630:SF8CATION-TRANSPORTING ATPASE 13A3-RELATEDcoord: 5..1146
NoneNo IPR availableCDDcd07542P-type_ATPase_cationcoord: 171..1033
e-value: 0.0
score: 1012.17
NoneNo IPR availableTMHMMTMhelixcoord: 954..973
NoneNo IPR availableTMHMMTMhelixcoord: 26..48
NoneNo IPR availableTMHMMTMhelixcoord: 220..239
NoneNo IPR availableTMHMMTMhelixcoord: 1036..1058
NoneNo IPR availableTMHMMTMhelixcoord: 994..1016
NoneNo IPR availableTMHMMTMhelixcoord: 451..473
NoneNo IPR availableTMHMMTMhelixcoord: 1070..1089
NoneNo IPR availableTMHMMTMhelixcoord: 414..436
NoneNo IPR availableTMHMMTMhelixcoord: 927..949
NoneNo IPR availableTMHMMTMhelixcoord: 1109..1131
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 147..219
e-value: 0.0063
score: 14.0
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 153..213
e-value: 1.3E-4
score: 21.6
IPR006544P-type ATPase, subfamily VTIGRFAMTIGR01657TIGR01657coord: 14..1109
e-value: 0.0
score: 1121.4
IPR006544P-type ATPase, subfamily VPFAMPF12409P5-ATPasecoord: 13..142
e-value: 1.4E-22
score: 80.1
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 516..702
e-value: 2.0E-15
score: 58.5
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 506..713
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 393..521
e-value: 1.5E-21
score: 74.3
coord: 843..947
e-value: 3.4E-26
score: 89.7
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 703..904
e-value: 2.3E-37
score: 130.4
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 502..508
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 153..1131
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 498..920
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 260..399