Zinc finger MYND domain-containing protein

Overview
NameZinc finger MYND domain-containing protein
Smed IDSMED30029664
Length (bp)3827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYND domain-containing protein (SMED30029664) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYND domain-containing protein (SMED30029664) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger MYND domain-containing protein (SMED30029664) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger MYND domain-containing protein (SMED30029664) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029664

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30029664SMESG000023144.1 SmedASXL_015789SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30029664SMESG000023144.1 dd_Smed_v4_9896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029664SMESG000023144.1 dd_Smed_v4_9896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029664SMESG000023144.1 dd_Smed_v4_9896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029664SMESG000023144.1 dd_Smed_v4_9896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029664SMESG000023144.1 dd_Smed_v4_9896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029664SMESG000023144.1 dd_Smed_v4_9896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029664SMESG000023144.1 dd_Smed_v4_9896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029664SMESG000023144.1 Contig54998newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029664SMESG000023144.1 Contig54998uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Human
Match: ZMYND11 (zinc finger MYND-type containing 11 [Source:HGNC Symbol;Acc:HGNC:16966])

HSP 1 Score: 178.718 bits (452), Expect = 1.496e-46
Identity = 108/383 (28.20%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + N N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSPWQCPVCRSIKKKNTN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 368          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Human
Match: ZMYND11 (zinc finger MYND-type containing 11 [Source:HGNC Symbol;Acc:HGNC:16966])

HSP 1 Score: 177.178 bits (448), Expect = 8.158e-46
Identity = 108/383 (28.20%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + N N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSPWQCPVCRSIKKKNTN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 368          

HSP 2 Score: 112.079 bits (279), Expect = 1.450e-24
Identity = 69/177 (38.98%), Postives = 101/177 (57.06%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATT-LPICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++ +M    +++ EK K    + +    T+H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  426 TMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 602          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Human
Match: ZMYND11 (zinc finger MYND-type containing 11 [Source:HGNC Symbol;Acc:HGNC:16966])

HSP 1 Score: 177.178 bits (448), Expect = 8.158e-46
Identity = 108/383 (28.20%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + N N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSPWQCPVCRSIKKKNTN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 368          

HSP 2 Score: 112.079 bits (279), Expect = 1.450e-24
Identity = 69/177 (38.98%), Postives = 101/177 (57.06%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATT-LPICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++ +M    +++ EK K    + +    T+H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  426 TMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 602          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Human
Match: ZMYND11 (zinc finger MYND-type containing 11 [Source:HGNC Symbol;Acc:HGNC:16966])

HSP 1 Score: 174.481 bits (441), Expect = 4.147e-45
Identity = 108/383 (28.20%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + N N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSPWQCPVCRSIKKKNTN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGD-SEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 367          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Human
Match: ZMYND11 (zinc finger MYND-type containing 11 [Source:HGNC Symbol;Acc:HGNC:16966])

HSP 1 Score: 162.925 bits (411), Expect = 2.936e-41
Identity = 105/383 (27.42%), Postives = 184/383 (48.04%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S                       I+KK+  K  +    R       ++V R     + +RK+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSPWQCPVCRS-----------------------IKKKNTNKQEMGTYLR-------FIVSR-----MKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 337          

HSP 2 Score: 112.079 bits (279), Expect = 1.248e-24
Identity = 69/177 (38.98%), Postives = 101/177 (57.06%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATT-LPICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++ +M    +++ EK K    + +    T+H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  395 TMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 571          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Celegans
Match: bra-2 (BMP Receptor Associated protein family [Source:UniProtKB/TrEMBL;Acc:O01918])

HSP 1 Score: 83.1889 bits (204), Expect = 1.404e-17
Identity = 41/106 (38.68%), Postives = 63/106 (59.43%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            I  EL  + K E E+ + +  NK  E ++++  ++ EK               H   L+ ++++QWC +C  EAIYHCCWNT+YCS++CQQ HWQ  H++ CRRK+
Sbjct:  100 IRSELLQQFKDELEQTRADLENKHRENLKMESAKLNEK---------------HKRELVASRKKQWCWSCDNEAIYHCCWNTAYCSVECQQGHWQT-HRKFCRRKK 189          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Celegans
Match: bra-1 (BMP Receptor Associated protein family [Source:UniProtKB/TrEMBL;Acc:Q20741])

HSP 1 Score: 78.5666 bits (192), Expect = 2.788e-16
Identity = 40/109 (36.70%), Postives = 62/109 (56.88%), Query Frame = 2
Query: 2468 LVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            LV L  KL  E+ E +         + ++++    +E+ +K     ++ +     +H   L   K++QWC  C  EAIYHCCWNT+YCS++CQQ HWQ  H++ CRRK+
Sbjct:   56 LVALTEKLHQEFMEDQERVRRDLLVQFKIELDQTKEELEKKHAENLKEEIEKLSEKHQRELAVAKKKQWCWQCNSEAIYHCCWNTAYCSVECQQGHWQI-HRKFCRRKK 163          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Fly
Match: CG1815 (gene:FBgn0039863 transcript:FBtr0085824)

HSP 1 Score: 90.8929 bits (224), Expect = 6.332e-18
Identity = 66/249 (26.51%), Postives = 110/249 (44.18%), Query Frame = 1
Query:  352 DWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVR-----KLLDFA---THFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLL-LEKSDGYEVRFFGGNHDRAFVKKHD 1071
            D +C+ C   G+L  C++C R +H +C +             K +  + CP C+    A +   R  V      +LL FA      +R     +  L + F   +   ++ V      E + + I++G Y   ++ + + +   H+  IL    +     ++ +++  + E +E+  C +CY+NA +   EW  K C   H L+WA+    P    YWPAK +    S    VRFF G HDRAFV   D
Sbjct:  343 DPFCWKCRGCGKLMPCSKCLRSFHSYCVRPAT---------TKFDSSWKCPECQVIEAAPKRLRRNGVSVDLLSQLLSFALDRMKHVRGAHKLRSPLEV-F--PLTYKKFFV-NPVSFESLAQCIRNGAYQSTDEFLSEVKWIQHNALILDAGDAKVEQASKAVVKVCRQEANEIDTCPECYLNANSS-DEWFVKVCRHPHLLLWAKLKGFP----YWPAKAMGSSNSTLVNVRFF-GKHDRAFVPVKD 572          

HSP 2 Score: 71.2478 bits (173), Expect = 7.329e-12
Identity = 35/99 (35.35%), Postives = 60/99 (60.61%), Query Frame = 2
Query: 2471 VELEN-KLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHGEALI------NTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHW 2746
            + LEN +LK  Y+  ++N++++ +E +  +M++ +E++        +++E R   A+         KR+QWC NC++EA  +CCWNTSYC   CQQ HW
Sbjct: 1334 LSLENERLKQHYDR-QINDLHRTSELMISEMRKTLEQEHKR-----VISELRQQNAIELMRAVEEAKRKQWCANCMREAQLYCCWNTSYCDYPCQQLHW 1426          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Fly
Match: CG1815 (gene:FBgn0039863 transcript:FBtr0085823)

HSP 1 Score: 89.3521 bits (220), Expect = 1.520e-17
Identity = 65/249 (26.10%), Postives = 109/249 (43.78%), Query Frame = 1
Query:  352 DWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVR-----KLLDFA---THFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLL-LEKSDGYEVRFFGGNHDRAFVKKHD 1071
            D +C+ C   G+L  C++C R +H +C +             K +  + CP C+    A +   R  V      +LL FA      +R     +  L +     +   ++ V      E + + I++G Y   ++ + + +   H+  IL    +     ++ +++  + E +E+  C +CY+NA +   EW  K C   H L+WA+    P    YWPAK +    S    VRFF G HDRAFV   D
Sbjct:  343 DPFCWKCRGCGKLMPCSKCLRSFHSYCVRPAT---------TKFDSSWKCPECQVIEAAPKRLRRNGVSVDLLSQLLSFALDRMKHVRGAHKLRSPLEVF---PLTYKKFFV-NPVSFESLAQCIRNGAYQSTDEFLSEVKWIQHNALILDAGDAKVEQASKAVVKVCRQEANEIDTCPECYLNANSS-DEWFVKVCRHPHLLLWAKLKGFP----YWPAKAMGSSNSTLVNVRFF-GKHDRAFVPVKD 572          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Fly
Match: CG8569 (gene:FBgn0033752 transcript:FBtr0087940)

HSP 1 Score: 84.7297 bits (208), Expect = 2.502e-16
Identity = 47/149 (31.54%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  640 IVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCY-INAKAKLAE-WITKPCEPSHKLIWARQSTTPGAHFYWPAKLLL---EKSDGYEVRFFGGNHDRAFVKKHD 1071
            +VK      +   L  I+R I   +Y YL + + D     H++ +  G  S + +  + L+R++  +I E++ C DCY  + +A L++ W  KPC   H+L++A+Q  +P     WPAK++     +   Y+VRFFGG H RA + + D
Sbjct:  277 LVKRLLFKTKILGLGDIERNIAAAKYTYLTEFLMDLLDLQHNMAVFFGQKSVEYNATKWLMRDVTHDIREIRRCPDCYRYSNEASLSDLWFAKPCLQRHELVFAKQVGSPP----WPAKVMSVSKRQPIKYDVRFFGGTHSRALISERD 421          

HSP 2 Score: 54.299 bits (129), Expect = 6.811e-7
Identity = 20/46 (43.48%), Postives = 33/46 (71.74%), Query Frame = 2
Query: 2636 LINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCR 2773
            L   KR+QWC +CL EA+++CC+  SYCS++CQ+   ++ H+  C+
Sbjct:  561 LAEVKRKQWCYHCLDEAVFNCCFTASYCSVECQRRD-KRRHQASCK 605          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Zebrafish
Match: zmynd11 (zinc finger, MYND-type containing 11 [Source:ZFIN;Acc:ZDB-GENE-050522-301])

HSP 1 Score: 189.504 bits (480), Expect = 6.319e-50
Identity = 107/376 (28.46%), Postives = 189/376 (50.27%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIER----GDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQG 1179
            R+   + ++ VW  I  IR QKQ A +D++ K +SR   +  + + R L++   DGL+      G   +   I         ++   + + SK +   S DWYCF CHLPG++  C  CFR YH+ C  E        HR   +   + C  C  R    +N +++++   L F    +++++V  D+   G   +    + L++   D+E IQ  I DG+Y    +   DA++ VH+  ILHG+ SD+ + AR+L  +   E++E+ +C  C+  + A+   W   PC P+H+L+WAR         YWPAK++  + +  +VRFFG  H RA++   + +       ++++K  S + +A  E++  +  + +G
Sbjct:    8 RQADPKVVQYVWSAIEVIRNQKQIANMDRISKYLSRVYGMHPKDTARQLVLAVKDGLVVETLTVGCKGSKAGIEQEGYWLPGDEMEQMSEGSKDWEAESHDWYCFECHLPGDVMECDGCFRVYHLRCVSE-------DHRPRDTTSHWQCGIC--RGSKRKNLNKQEMTTYLKFILGRMKERAV--DLHKRGKEAKQPIYKRLIHTPLDVENIQENISDGKYKSFEEFRADAQLIVHNTAILHGVNSDQTEIARLLYNDTCHELNELMLCRTCFYLSNARPDNWFCYPCSPNHELVWARMK----GFGYWPAKVMQREGNQVDVRFFGHQHQRAWIPSDNIQDITVSVQQLQVKRSSGWKKACDELELHQRFVREG 368          

HSP 2 Score: 108.612 bits (270), Expect = 1.378e-23
Identity = 52/110 (47.27%), Postives = 72/110 (65.45%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQMQ----EIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            +L E  +KL+ E EE K   +NKA    + +M+    ++ EK K    + +    ++H + L  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  +HKR CRRKR
Sbjct:  520 VLKEALDKLRGEMEEEKRQAVNKAVSSTQAEMERKCKQVKEKCKEELMEEMKKMVSQHKQLLSQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKRTCRRKR 629          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Zebrafish
Match: zmynd11 (zinc finger, MYND-type containing 11 [Source:ZFIN;Acc:ZDB-GENE-050522-301])

HSP 1 Score: 185.267 bits (469), Expect = 1.684e-48
Identity = 108/387 (27.91%), Postives = 190/387 (49.10%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIER----GDPQALKTISSVNGSYANNDFFNLPDFSKP-----------FNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQG 1179
            R+   + ++ VW  I  IR QKQ A +D++ K +SR   +  + + R L++   DGL+      G   +   I         ++   + + SKP           +   S DWYCF CHLPG++  C  CFR YH+ C  E        HR   +   + C  C  R    +N +++++   L F    +++++V  D+   G   +    + L++   D+E IQ  I DG+Y    +   DA++ VH+  ILHG+ SD+ + AR+L  +   E++E+ +C  C+  + A+   W   PC P+H+L+WAR         YWPAK++  + +  +VRFFG  H RA++   + +       ++++K  S + +A  E++  +  + +G
Sbjct:    8 RQADPKVVQYVWSAIEVIRNQKQIANMDRISKYLSRVYGMHPKDTARQLVLAVKDGLVVETLTVGCKGSKAGIEQEGYWLPGDEMEQMSEGSKPSLPSEALFPDDWEAESHDWYCFECHLPGDVMECDGCFRVYHLRCVSE-------DHRPRDTTSHWQCGIC--RGSKRKNLNKQEMTTYLKFILGRMKERAV--DLHKRGKEAKQPIYKRLIHTPLDVENIQENISDGKYKSFEEFRADAQLIVHNTAILHGVNSDQTEIARLLYNDTCHELNELMLCRTCFYLSNARPDNWFCYPCSPNHELVWARMK----GFGYWPAKVMQREGNQVDVRFFGHQHQRAWIPSDNIQDITVSVQQLQVKRSSGWKKACDELELHQRFVREG 379          

HSP 2 Score: 108.612 bits (270), Expect = 1.254e-23
Identity = 52/110 (47.27%), Postives = 72/110 (65.45%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQMQ----EIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            +L E  +KL+ E EE K   +NKA    + +M+    ++ EK K    + +    ++H + L  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  +HKR CRRKR
Sbjct:  531 VLKEALDKLRGEMEEEKRQAVNKAVSSTQAEMERKCKQVKEKCKEELMEEMKKMVSQHKQLLSQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKRTCRRKR 640          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Zebrafish
Match: zmynd11 (zinc finger, MYND-type containing 11 [Source:ZFIN;Acc:ZDB-GENE-050522-301])

HSP 1 Score: 183.726 bits (465), Expect = 5.964e-48
Identity = 110/393 (27.99%), Postives = 193/393 (49.11%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPD------------------FSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQG 1179
            R+   + ++ VW  I  IR QKQ A +D++ K +SR   +  + + R L++   DGL+       ++T++    GS A    + + LP                   F   +   S DWYCF CHLPG++  C  CFR YH+ C  E        HR   +   + C  C  R    +N +++++   L F    +++++V  D+   G   +    + L++   D+E IQ  I DG+Y    +   DA++ VH+  ILHG+ SD+ + AR+L  +   E++E+ +C  C+  + A+   W   PC P+H+L+WAR         YWPAK++  + +  +VRFFG  H RA++   + +       ++++K  S + +A  E++  +  + +G
Sbjct:    8 RQADPKVVQYVWSAIEVIRNQKQIANMDRISKYLSRVYGMHPKDTTRQLVLAVKDGLV-------VETLTVGCKGSKAGIEQEGYWLPGDEMVRHKPEHPSLPSEALFPDDWEAESHDWYCFECHLPGDVMECDGCFRVYHLRCVSE-------DHRPRDTTSHWQCGIC--RGSKRKNLNKQEMTTYLKFILGRMKERAV--DLHKRGKEAKQPIYKRLIHTPLDVENIQENISDGKYKSFEEFRADAQLIVHNTAILHGVNSDQTEIARLLYNDTCHELNELMLCRTCFYLSNARPDNWFCYPCSPNHELVWARMK----GFGYWPAKVMQREGNQVDVRFFGHQHQRAWIPSDNIQDITVSVQQLQVKRSSGWKKACDELELHQRFVREG 378          

HSP 2 Score: 108.612 bits (270), Expect = 1.399e-23
Identity = 52/110 (47.27%), Postives = 72/110 (65.45%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQMQ----EIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            +L E  +KL+ E EE K   +NKA    + +M+    ++ EK K    + +    ++H + L  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  +HKR CRRKR
Sbjct:  530 VLKEALDKLRGEMEEEKRQAVNKAVSSTQAEMERKCKQVKEKCKEELMEEMKKMVSQHKQLLSQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKRTCRRKR 639          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Zebrafish
Match: prkcbp1l (protein kinase C binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2199])

HSP 1 Score: 115.161 bits (287), Expect = 2.809e-25
Identity = 69/248 (27.82%), Postives = 116/248 (46.77%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCE---------SRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC+VCH  G++  C  C R YH  C K            A+    + CP CE         ++++A    + +Q+  LL FA   +++         +         EY ++   DL  +++ IK   Y      + D +  +H+  I +G        A+V+++  + E++E+++C +CY++A  K   W  +PC   H L+WA+    P    +WPAK L +K    + RFF G HDRA+V
Sbjct:  105 GRNDFYCWVCHREGQVLCCELCPRVYHAKCLK----------LAAEPEGDWFCPECEKITVAECIETQSKAMTMLNLEQLSYLLKFALQKMKQPGTEPFQKPVSLDQHPDYAEY-IFHPMDLSTLEKNIKKKMYGCTEAFLADVKWILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSACQKRDNWFCEPCSQPHPLVWAKLKGFP----FWPAKALRDKDGQVDARFF-GQHDRAWV 336          

HSP 2 Score: 73.1738 bits (178), Expect = 2.179e-12
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKA-AAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L+E+    E    +M++ +E+++     +     E    +A+  TK++QWC NC KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct:  984 ELSEMKHNLELTMAEMRQSLEQERERLVSEVKKQMELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHW-PEHMKSC 1069          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Zebrafish
Match: prkcbp1l (protein kinase C binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2199])

HSP 1 Score: 115.161 bits (287), Expect = 2.889e-25
Identity = 69/248 (27.82%), Postives = 116/248 (46.77%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCE---------SRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC+VCH  G++  C  C R YH  C K            A+    + CP CE         ++++A    + +Q+  LL FA   +++         +         EY ++   DL  +++ IK   Y      + D +  +H+  I +G        A+V+++  + E++E+++C +CY++A  K   W  +PC   H L+WA+    P    +WPAK L +K    + RFF G HDRA+V
Sbjct:   85 GRNDFYCWVCHREGQVLCCELCPRVYHAKCLK----------LAAEPEGDWFCPECEKITVAECIETQSKAMTMLNLEQLSYLLKFALQKMKQPGTEPFQKPVSLDQHPDYAEY-IFHPMDLSTLEKNIKKKMYGCTEAFLADVKWILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSACQKRDNWFCEPCSQPHPLVWAKLKGFP----FWPAKALRDKDGQVDARFF-GQHDRAWV 316          

HSP 2 Score: 73.1738 bits (178), Expect = 2.183e-12
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKA-AAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L+E+    E    +M++ +E+++     +     E    +A+  TK++QWC NC KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct:  964 ELSEMKHNLELTMAEMRQSLEQERERLVSEVKKQMELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHW-PEHMKSC 1049          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Xenopus
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:100125090])

HSP 1 Score: 169.088 bits (427), Expect = 3.391e-43
Identity = 102/386 (26.42%), Postives = 199/386 (51.55%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPD------FSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKN---EYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYY 1185
            R+  ++ I+ +W  I  IR QKQ A +D++ K ++R + +  +   R L +   DGLI       ++T++    GS A    + + LP        S  +   + DWYCF CH PGE+  C +CFR YH  C  + +       R   S++ + CP C+S  + N   +++++ K + F    ++++++      +  +G+  K+     LV+   D+  I  K+ +G+Y   ++   DA++ +H+  I +G  S++AD A+VL ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +       ++ +K    + +A  E+   +  + +G +
Sbjct:    8 RQADTKVIQYLWTAIEVIRNQKQIANIDRITKYMTRVHGMHPKEITRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIVKAISPDWETETHDWYCFECHSPGEVMMCDQCFRVYHPKCLPDDL-------RLRDSSNHWQCPVCKSMKKKNN--TKQEMGKYMRFIVSRMKERAI-----ELNKKGKDSKHPMYRRLVHTTIDVSTINEKVTEGKYKSYDEFKADAQLLLHNTIIFYGDDSEQADVAKVLYKDTCHELDELQLCKNCFYLSNARPENWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSDNIQEITVNVHQLHVKRSMGWKKACDELDLHQRFLREGRF 368          

HSP 2 Score: 102.449 bits (254), Expect = 1.429e-21
Identity = 50/110 (45.45%), Postives = 71/110 (64.55%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            ++ E  +KL+ E EE K   ++KA    + +M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  500 VVREALDKLRVEMEEEKRQAVSKAVSNAQAEMDRKCKQVKEKCKEEFLEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 609          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Xenopus
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:100125090])

HSP 1 Score: 167.933 bits (424), Expect = 9.792e-43
Identity = 100/389 (25.71%), Postives = 195/389 (50.13%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIER----GDPQALKTISSVNGSYANNDFFNLPDFSKPFN--------KGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKN---EYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYY 1185
            R+  ++ I+ +W  I  IR QKQ A +D++ K ++R + +  +   R L +   DGLI      G   +   I         ++  ++     PFN          + DWYCF CH PGE+  C +CFR YH  C  + +       R   S++ + CP C+S  + N   +++++ K + F    ++++++      +  +G+  K+     LV+   D+  I  K+ +G+Y   ++   DA++ +H+  I +G  S++AD A+VL ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +       ++ +K    + +A  E+   +  + +G +
Sbjct:    8 RQADTKVIQYLWTAIEVIRNQKQIANIDRITKYMTRVHGMHPKEITRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEILSVISLWFPFNIFSLQDWETETHDWYCFECHSPGEVMMCDQCFRVYHPKCLPDDL-------RLRDSSNHWQCPVCKSMKKKNN--TKQEMGKYMRFIVSRMKERAI-----ELNKKGKDSKHPMYRRLVHTTIDVSTINEKVTEGKYKSYDEFKADAQLLLHNTIIFYGDDSEQADVAKVLYKDTCHELDELQLCKNCFYLSNARPENWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSDNIQEITVNVHQLHVKRSMGWKKACDELDLHQRFLREGRF 378          

HSP 2 Score: 102.449 bits (254), Expect = 1.473e-21
Identity = 50/110 (45.45%), Postives = 71/110 (64.55%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            ++ E  +KL+ E EE K   ++KA    + +M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  510 VVREALDKLRVEMEEEKRQAVSKAVSNAQAEMDRKCKQVKEKCKEEFLEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 619          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Xenopus
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:100125090])

HSP 1 Score: 167.162 bits (422), Expect = 1.602e-42
Identity = 100/384 (26.04%), Postives = 195/384 (50.78%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISS---VNGSYANND----FFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKN---EYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYY 1185
            R+  ++ I+ +W  I  IR QKQ A +D++ K ++R + +  +   R L +   DGLI        K   +     G +   D     F  P+ +  +   + DWYCF CH PGE+  C +CFR YH  C  + +       R   S++ + CP C+S  + N   +++++ K + F    ++++++      +  +G+  K+     LV+   D+  I  K+ +G+Y   ++   DA++ +H+  I +G  S++AD A+VL ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +       ++ +K    + +A  E+   +  + +G +
Sbjct:    8 RQADTKVIQYLWTAIEVIRNQKQIANIDRITKYMTRVHGMHPKEITRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIVSIFFTPNMT-DWETETHDWYCFECHSPGEVMMCDQCFRVYHPKCLPDDL-------RLRDSSNHWQCPVCKSMKKKNN--TKQEMGKYMRFIVSRMKERAI-----ELNKKGKDSKHPMYRRLVHTTIDVSTINEKVTEGKYKSYDEFKADAQLLLHNTIIFYGDDSEQADVAKVLYKDTCHELDELQLCKNCFYLSNARPENWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSDNIQEITVNVHQLHVKRSMGWKKACDELDLHQRFLREGRF 372          

HSP 2 Score: 102.449 bits (254), Expect = 1.359e-21
Identity = 50/110 (45.45%), Postives = 71/110 (64.55%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            ++ E  +KL+ E EE K   ++KA    + +M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  505 VVREALDKLRVEMEEEKRQAVSKAVSNAQAEMDRKCKQVKEKCKEEFLEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 614          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Xenopus
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:100125090])

HSP 1 Score: 163.696 bits (413), Expect = 2.684e-41
Identity = 103/398 (25.88%), Postives = 200/398 (50.25%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLP------DFSKPFNKG------------SKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKN---EYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYY 1185
            R+  ++ I+ +W  I  IR QKQ A +D++ K ++R + +  +   R L +   DGLI       ++T++    GS A    + + LP          P  +G            + DWYCF CH PGE+  C +CFR YH  C  + +       R   S++ + CP C+S  + N   +++++ K + F    ++++++      +  +G+  K+     LV+   D+  I  K+ +G+Y   ++   DA++ +H+  I +G  S++AD A+VL ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +       ++ +K    + +A  E+   +  + +G +
Sbjct:    8 RQADTKVIQYLWTAIEVIRNQKQIANIDRITKYMTRVHGMHPKEITRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIMKQHHIPGREGKSVKSPEDWETETHDWYCFECHSPGEVMMCDQCFRVYHPKCLPDDL-------RLRDSSNHWQCPVCKSMKKKNN--TKQEMGKYMRFIVSRMKERAI-----ELNKKGKDSKHPMYRRLVHTTIDVSTINEKVTEGKYKSYDEFKADAQLLLHNTIIFYGDDSEQADVAKVLYKDTCHELDELQLCKNCFYLSNARPENWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSDNIQEITVNVHQLHVKRSMGWKKACDELDLHQRFLREGRF 380          

HSP 2 Score: 102.449 bits (254), Expect = 1.516e-21
Identity = 50/110 (45.45%), Postives = 71/110 (64.55%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            ++ E  +KL+ E EE K   ++KA    + +M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  513 VVREALDKLRVEMEEEKRQAVSKAVSNAQAEMDRKCKQVKEKCKEEFLEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 622          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Xenopus
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:100125090])

HSP 1 Score: 159.073 bits (401), Expect = 4.442e-40
Identity = 98/377 (25.99%), Postives = 186/377 (49.34%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYY 1185
            R+  ++ I+ +W  I  IR QKQ A +D++ K ++R + +  +   R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CH PGE+  C +CFR YH  C  + +       R   S++ + CP C+S  + N   +++++ K + F                            +V R     + +RK+ +G+Y   ++   DA++ +H+  I +G  S++AD A+VL ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +       ++ +K    + +A  E+   +  + +G +
Sbjct:    8 RQADTKVIQYLWTAIEVIRNQKQIANIDRITKYMTRVHGMHPKEITRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCFECHSPGEVMMCDQCFRVYHPKCLPDDL-------RLRDSSNHWQCPVCKSMKKKNN--TKQEMGKYMRF----------------------------IVSR-----MKERKVTEGKYKSYDEFKADAQLLLHNTIIFYGDDSEQADVAKVLYKDTCHELDELQLCKNCFYLSNARPENWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSDNIQEITVNVHQLHVKRSMGWKKACDELDLHQRFLREGRF 331          

HSP 2 Score: 102.064 bits (253), Expect = 1.526e-21
Identity = 50/110 (45.45%), Postives = 71/110 (64.55%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            ++ E  +KL+ E EE K   ++KA    + +M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  464 VVREALDKLRVEMEEEKRQAVSKAVSNAQAEMDRKCKQVKEKCKEEFLEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 573          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Mouse
Match: Zmynd11 (zinc finger, MYND domain containing 11 [Source:MGI Symbol;Acc:MGI:1913755])

HSP 1 Score: 173.711 bits (439), Expect = 7.922e-46
Identity = 107/383 (27.94%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + + N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSHWQCPVCRSIKKKHSN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGD-SEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 367          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Mouse
Match: Zmynd11 (zinc finger, MYND domain containing 11 [Source:MGI Symbol;Acc:MGI:1913755])

HSP 1 Score: 175.637 bits (444), Expect = 1.516e-45
Identity = 107/383 (27.94%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + + N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSHWQCPVCRSIKKKHSN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 368          

HSP 2 Score: 109.768 bits (273), Expect = 4.489e-24
Identity = 68/177 (38.42%), Postives = 99/177 (55.93%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLP-ICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++  M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  426 TMPQPIERVSVSTQTKKLSASSPRMLHRSTQTTSDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 602          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Mouse
Match: Zmynd11 (zinc finger, MYND domain containing 11 [Source:MGI Symbol;Acc:MGI:1913755])

HSP 1 Score: 175.637 bits (444), Expect = 1.516e-45
Identity = 107/383 (27.94%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + + N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSHWQCPVCRSIKKKHSN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 368          

HSP 2 Score: 109.768 bits (273), Expect = 4.489e-24
Identity = 68/177 (38.42%), Postives = 99/177 (55.93%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLP-ICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++  M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  426 TMPQPIERVSVSTQTKKLSASSPRMLHRSTQTTSDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 602          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Mouse
Match: Zmynd11 (zinc finger, MYND domain containing 11 [Source:MGI Symbol;Acc:MGI:1913755])

HSP 1 Score: 161.77 bits (408), Expect = 4.489e-41
Identity = 105/383 (27.42%), Postives = 183/383 (47.78%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S                       I+KK   K  +    R       ++V R     + +RK+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSHWQCPVCRS-----------------------IKKKHSNKQEMGTYLR-------FIVSR-----MKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 337          

HSP 2 Score: 109.768 bits (273), Expect = 4.533e-24
Identity = 68/177 (38.42%), Postives = 99/177 (55.93%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLP-ICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++  M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  395 TMPQPIERVSVSTQTKKLSASSPRMLHRSTQTTSDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 571          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Mouse
Match: Zmynd11 (zinc finger, MYND domain containing 11 [Source:MGI Symbol;Acc:MGI:1913755])

HSP 1 Score: 154.451 bits (389), Expect = 2.309e-38
Identity = 95/350 (27.14%), Postives = 175/350 (50.00%), Query Frame = 1
Query:  163 ISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + + N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    1 MSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSHWQCPVCRSIKKKHSN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 328          

HSP 2 Score: 110.538 bits (275), Expect = 3.275e-24
Identity = 68/177 (38.42%), Postives = 99/177 (55.93%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLP-ICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++  M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  442 TMPQPIERVSVSTQTKKLSASSPRMLHRSTQTTSDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 618          
BLAST of Zinc finger MYND domain-containing protein vs. UniProt/SwissProt
Match: sp|Q15326|ZMY11_HUMAN (Zinc finger MYND domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 3.918e-45
Identity = 108/383 (28.20%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + N N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSPWQCPVCRSIKKKNTN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 368          

HSP 2 Score: 112.079 bits (279), Expect = 6.965e-24
Identity = 69/177 (38.98%), Postives = 101/177 (57.06%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATT-LPICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++ +M    +++ EK K    + +    T+H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  426 TMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 602          
BLAST of Zinc finger MYND domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R5C8|ZMY11_MOUSE (Zinc finger MYND domain-containing protein 11 OS=Mus musculus OX=10090 GN=Zmynd11 PE=1 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 1.061e-44
Identity = 107/383 (27.94%), Postives = 195/383 (50.91%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGE 1203
            R+  ++ I+ +W  I  IR QKQ A +D++ K +SR + +  + + R L +   DGLI       ++T++    GS A    + + LP     +   + DWYCF CHLPGE+  C  CFR YH  C        S   R   S+  + CP C S  + + N  ++++   L F    ++++++  D+   G   +      LV+   D+  IQ K+ +G+Y    +   DA++ +H+  I +G  S++AD AR+L ++   E+ E+Q+C +C+  + A+   W   PC P+H+L+WA+         +WPAK++ ++ +  +VRFFG +H RA++   + +        + +K    + +A  E++  +  + +G +  S  E
Sbjct:    8 RQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLI-------VETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCFECHLPGEVLICDLCFRVYHSKCL-------SDEFRLRDSSSHWQCPVCRSIKKKHSN--KQEMGTYLRFIVSRMKERAI--DLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMK----GFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNE 368          

HSP 2 Score: 109.768 bits (273), Expect = 3.140e-23
Identity = 68/177 (38.42%), Postives = 99/177 (55.93%), Query Frame = 2
Query: 2285 TSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLP-ICN--CQEKFDXXXXXXXXXXXXXHSL----ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            T P PI +   S     +   S RM+H+   TT   +C   C +K+ K   + K +++ +H      ++ E   KL+ E EE K   +NKA   ++  M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  426 TMPQPIERVSVSTQTKKLSASSPRMLHRSTQTTSDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 602          
BLAST of Zinc finger MYND domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ULU4|PKCB1_HUMAN (Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 7.002e-23
Identity = 67/240 (27.92%), Postives = 114/240 (47.50%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTC-ESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC+VCH  G++  C  C R YH  C +  +        F    +K     C E++++A    + +Q+  LL FA   +++         +         EY ++   DL  +++  K   Y      + DA+  +H+  I +G        A+V+++  + E++E+++C +CY+ A  K   W  +PC   H L+WA+    P    +WPAK L +K    + RFF G HDRA+V
Sbjct:   85 GRNDFYCWVCHREGQVLCCELCPRVYHAKCLR--LTSEPEGDWFCPECEKITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPGTDAFQKPVPLEQHPDYAEY-IFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVIKICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPLVWAKLKGFP----FWPAKALRDKDGQVDARFF-GQHDRAWV 316          

HSP 2 Score: 73.1738 bits (178), Expect = 1.354e-11
Identity = 36/91 (39.56%), Postives = 54/91 (59.34%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKAAAQDALMV-----TETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L+E+    E    +M++ +E+++    D L+       E    +A+  TK++QWC NC KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct:  977 ELSEMKHNLELTMAEMRQSLEQER----DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHW-PEHMKSC 1062          
BLAST of Zinc finger MYND domain-containing protein vs. TrEMBL
Match: A0A183RLX0 (Bromo domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.140e-128
Identity = 203/420 (48.33%), Postives = 272/420 (64.76%), Query Frame = 1
Query:   85 IKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKS-------NDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGA---------HFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKH---------GSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTT 1269
            ++ VW+    ++  +     DK+ K + +  N+ ++  + LL  +E DGLIE+ +P   K     NG       + LPDFSK   +G  DWYCF CH PGE+  C +CFR YH  C +E    NS   +  +S        D F CP CESR +    FSRKQ+RKLL+FATH +RK+ +WK  + +G++GEI KNEYLVY+Y DLEL+QRKIKDGRY  L +   D ++ VHDVCILHG +S++AD+ R   R +  E++E+Q+C DCYINAKA++ +WI+KPC+P H+LIWAR  T+ GA          FYWPAK+LLE+ DGYE+RFFGG+H+R FVKK  T++FH   DE+ +           G  F+RAW EV KL+  I+ GYYTHSSGESDLPP++DDYSDE+YL  RR T
Sbjct:   31 VRQVWDAFGVLKSNRLAVPADKISKILRKTLNLKDDQIRLLLDEIEGDGLIEKIEPPFGK-----NGMVR----YQLPDFSKQHPRGKHDWYCFQCHRPGEVLRCLDCFRVYHSDCVQEASGPNSPSRKSMRSPTLHDGQEDNFTCPVCESRPKCE--FSRKQIRKLLEFATHQLRKQPLWKTFIQVGYKGEITKNEYLVYKYTDLELLQRKIKDGRYAALEEFSMDVQLLVHDVCILHGPYSNQADEIRFFFRSVNAELNEIQLCTDCYINAKARVTDWISKPCKPRHELIWARNRTSAGAGLFNDTSVSQFYWPAKVLLERDDGYEIRFFGGSHERMFVKKAHTRAFHLPADEVGVLRRSNATGVISGGGFERAWNEVSKLQANIDSGYYTHSSGESDLPPSDDDYSDEMYLGPRRKT 439          
BLAST of Zinc finger MYND domain-containing protein vs. TrEMBL
Match: A0A183JJS1 (Bromo domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS2949 PE=4 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 3.679e-128
Identity = 202/420 (48.10%), Postives = 272/420 (64.76%), Query Frame = 1
Query:   85 IKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKS-------NDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGA---------HFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKH---------GSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTT 1269
            ++ VW+    ++  +     DK+ K + +  ++ ++  + LL  +E DGLIE+ +P   K     NG       + LPDFSK   +G  DWYCF CH PGE+  C +CFR YH  C +E    NS   +  +S        D F CP CESR +    FSRKQ+RKLL+FATH +RK+ +WK  + +G++GEI KNEYLVY+Y DLEL+QRKIKDGRY  L +   D ++ VHDVCILHG +S++AD+ R   R +  E++E+Q+C DCYINAKA++ +WI+KPC+P H+LIWAR  T+ GA          FYWPAK+LLE+ DGYE+RFFGG+H+R FVKK  T++FH   DE+ +           G  F+RAW EV KL+  I+ GYYTHSSGESDLPP++DDYSDE+YL  RR T
Sbjct:   31 VRQVWDAFGVLKSHRLAVPADKISKILRKTLDLKDDQIRLLLDEIEGDGLIEKIEPPFGK-----NGMVR----YQLPDFSKQHPRGKHDWYCFQCHRPGEVLRCLDCFRVYHSDCVQEASGPNSPSRKSMRSPTLHDGQEDNFTCPVCESRPKCE--FSRKQIRKLLEFATHQLRKQPLWKTFIQVGYKGEITKNEYLVYKYTDLELLQRKIKDGRYAALEEFSMDVQLLVHDVCILHGPYSNQADEIRFFFRSVNTELNEIQLCTDCYINAKARVTDWISKPCKPRHELIWARNRTSAGAGLFNDTSVSQFYWPAKVLLERDDGYEIRFFGGSHERMFVKKAHTRAFHLPADEVGVLRRSNATGAISGGGFERAWNEVSKLQANIDSGYYTHSSGESDLPPSDDDYSDEMYLGPRRKT 439          
BLAST of Zinc finger MYND domain-containing protein vs. TrEMBL
Match: A0A183PPA5 (Bromo domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS16194 PE=4 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 3.895e-128
Identity = 202/420 (48.10%), Postives = 271/420 (64.52%), Query Frame = 1
Query:   85 IKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKS-------NDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGA---------HFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKH---------GSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTT 1269
            ++ VW+     +  +     DK+ K + +  ++ ++  + LL  +E DGLIE+ +P   K     NG       + LPDFSK   +G  DWYCF CH PGE+  C +CFR YH  C +E    NS   +  +S        D F CP CESR +    FSRKQ+RKLL+FATH +RK+ +WK  + +G++GEI KNEYLVY+Y DLEL+QRKIKDGRY  L +   D ++ VHDVCILHG +S++AD+ R   R +  E++E+Q+C DCYINAKA++ +WI+KPC+P H+LIWAR  T+ GA          FYWPAK+LLE+ DGYE+RFFGG+H+R FVKK  T++FH   DE+ +           G  F+RAW EV KL+  I+ GYYTHSSGESDLPP++DDYSDE+YL  RR T
Sbjct:   17 VRQVWDAFGVPKSHRLAVPADKISKILRKTLDLKDDQIRLLLDEIEGDGLIEKIEPPFGK-----NGMVR----YQLPDFSKQHPRGKHDWYCFQCHRPGEVLRCLDCFRVYHSDCVQEASGPNSPSRKSMRSPTLHDGQEDNFTCPVCESRPKCE--FSRKQIRKLLEFATHQLRKQPLWKTFIQVGYKGEITKNEYLVYKYTDLELLQRKIKDGRYAALEEFSMDVQLLVHDVCILHGPYSNQADEIRFFFRSVNTELNEIQLCTDCYINAKARVTDWISKPCKPRHELIWARNRTSAGAGLFNDTSVSQFYWPAKVLLERDDGYEIRFFGGSHERMFVKKAHTRAFHLPADEVGVLRRSNATGAISGGGFERAWNEVSKLQANIDSGYYTHSSGESDLPPSDDDYSDEMYLGPRRKT 425          
BLAST of Zinc finger MYND domain-containing protein vs. TrEMBL
Match: A0A183N5W1 (Bromo domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 7.729e-127
Identity = 201/420 (47.86%), Postives = 270/420 (64.29%), Query Frame = 1
Query:   85 IKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKS-------NDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGA---------HFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKH---------GSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTT 1269
            ++ VW+    ++  +      K+ K + +   + ++  + LL  +E DGLIE+ +P   K     NG       + LPDFSK   +G  DWYCF CH PGE+  C +CFR YH  C +E    NS   +  +S        D F CP CESR +    FSRKQ+RKLL+FATH +RK+ +WK  + +G++GEI KNEYLVY+Y DLEL+QRKIKDGRY  L +   D ++ VHDVCILHG +S++AD+ R   R +  E++E+Q+C DCYINAKA++ +WI+KPC+P H+LIWAR  T+ GA          FYWPAK+LLE+ DGYE+RFFGG+H+R FVKK  T++FH   DE+ +           G  F+RAW EV KL+  I+ GYYTHSSGESDLPP++DDYSDE+YL  RR T
Sbjct:   79 VRQVWDAFGVLKSHRLAVPAGKISKILRKTLGLKDDQIRLLLDEIEGDGLIEKIEPPFGK-----NGMVR----YQLPDFSKQHPRGKHDWYCFQCHRPGEVLRCLDCFRVYHSDCVQEASGPNSPSRKSMRSPTLHDGQEDNFTCPVCESRPKCE--FSRKQIRKLLEFATHQLRKQPLWKTFIQVGYKGEITKNEYLVYKYTDLELLQRKIKDGRYAALEEFSMDVQLLVHDVCILHGPYSNQADEIRFFFRSVNTELNEIQLCTDCYINAKARVTDWISKPCKPRHELIWARNRTSAGAGLFNDTSVSQFYWPAKVLLERDDGYEIRFFGGSHERMFVKKAHTRAFHLPADEVGVLRRSNATGAISGGGFERAWNEVSKLQANIDSGYYTHSSGESDLPPSDDDYSDEMYLGPRRKT 487          
BLAST of Zinc finger MYND domain-containing protein vs. TrEMBL
Match: A0A3P8DW67 (Bromo domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS23686 PE=4 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 7.810e-127
Identity = 201/420 (47.86%), Postives = 270/420 (64.29%), Query Frame = 1
Query:   85 IKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKS-------NDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGA---------HFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKH---------GSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTT 1269
            ++ VW+    ++  +      K+ K + +   + ++  + LL  +E DGLIE+ +P   K     NG       + LPDFSK   +G  DWYCF CH PGE+  C +CFR YH  C +E    NS   +  +S        D F CP CESR +    FSRKQ+RKLL+FATH +RK+ +WK  + +G++GEI KNEYLVY+Y DLEL+QRKIKDGRY  L +   D ++ VHDVCILHG +S++AD+ R   R +  E++E+Q+C DCYINAKA++ +WI+KPC+P H+LIWAR  T+ GA          FYWPAK+LLE+ DGYE+RFFGG+H+R FVKK  T++FH   DE+ +           G  F+RAW EV KL+  I+ GYYTHSSGESDLPP++DDYSDE+YL  RR T
Sbjct:   79 VRQVWDAFGVLKSHRLAVPAGKISKILRKTLGLKDDQIRLLLDEIEGDGLIEKIEPPFGK-----NGMVR----YQLPDFSKQHPRGKHDWYCFQCHRPGEVLRCLDCFRVYHSDCVQEASGPNSPSRKSMRSPTLHDGQEDNFTCPVCESRPKCE--FSRKQIRKLLEFATHQLRKQPLWKTFIQVGYKGEITKNEYLVYKYTDLELLQRKIKDGRYAALEEFSMDVQLLVHDVCILHGPYSNQADEIRFFFRSVNTELNEIQLCTDCYINAKARVTDWISKPCKPRHELIWARNRTSAGAGLFNDTSVSQFYWPAKVLLERDDGYEIRFFGGSHERMFVKKAHTRAFHLPADEVGVLRRSNATGAISGGGFERAWNEVSKLQANIDSGYYTHSSGESDLPPSDDDYSDEMYLGPRRKT 487          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Cavefish
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:103040052])

HSP 1 Score: 184.882 bits (468), Expect = 2.273e-48
Identity = 105/366 (28.69%), Postives = 186/366 (50.82%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVK 1152
            R+   + ++ VW  I  IR QKQ A +D++ K +SR   +  + + R L++   DGL+       ++T++    GS A    + + LP     +   S DWYCF CHLPG++  C  CFR YH+ C  E        HR   +   + C  C  R    +N  ++++   L F    +++++V  D+   G   +    + L++   D++ IQ  I +G+Y    +   DA++ VH+  ILHG  SD+ + AR+L  +   E++E+ +C +C+  + A+   W   PC P+H+L+WAR         YWPAK++  +    +VRFFG  H RA++   + +       ++++K  + + +A  E++
Sbjct:    8 RQADPKVVQYVWSAIEVIRNQKQIANMDRISKYLSRVYGMHPKETARQLVLAVKDGLV-------VETLTVGCKGSKAGVEQEGYWLPGDEMEWEAESHDWYCFECHLPGDVLECDGCFRVYHLRCLSE-------EHRPRDTTSHWQCTIC--RGSKRKNVGKQEMATYLKFILARMKERAV--DLHKRGKETKQPMYKRLIHTALDVDNIQENISEGKYKNFEEFKADAQLIVHNTAILHGAHSDQTEIARLLYNDTCHELNELLLCRNCFHLSNARPDNWFCYPCSPNHELVWARMK----GFGYWPAKVMQREGTQVDVRFFGHQHQRAWIPSDNIQEISVSVQQLQVKRSAGWKKACEELE 351          

HSP 2 Score: 103.99 bits (258), Expect = 3.022e-22
Identity = 50/110 (45.45%), Postives = 73/110 (66.36%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALM----VTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            +L E  +KL++E EE K   ++KA    + +M+   ++ K   ++ LM       ++H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  +HKR CRRKR
Sbjct:  541 LLKEALDKLRNEMEEEKRQAVSKAVASTQAEMERKCKQVKDKCKEELMEEMKKMVSQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKRTCRRKR 650          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Cavefish
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:103040052])

HSP 1 Score: 182.956 bits (463), Expect = 7.450e-48
Identity = 105/374 (28.07%), Postives = 188/374 (50.27%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN----------NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVK 1152
            R+   + ++ VW  I  IR QKQ A +D++ K +SR   +  + + R L++   DGL+       ++T++    GS A           ++   + + SK +   S DWYCF CHLPG++  C  CFR YH+ C  E        HR   +   + C  C  R    +N  ++++   L F    +++++V  D+   G   +    + L++   D++ IQ  I +G+Y    +   DA++ VH+  ILHG  SD+ + AR+L  +   E++E+ +C +C+  + A+   W   PC P+H+L+WAR         YWPAK++  +    +VRFFG  H RA++   + +       ++++K  + + +A  E++
Sbjct:    8 RQADPKVVQYVWSAIEVIRNQKQIANMDRISKYLSRVYGMHPKETARQLVLAVKDGLV-------VETLTVGCKGSKAGVEQEGYWLPGDEMEQMSEGSKEWEAESHDWYCFECHLPGDVLECDGCFRVYHLRCLSE-------EHRPRDTTSHWQCTIC--RGSKRKNVGKQEMATYLKFILARMKERAV--DLHKRGKETKQPMYKRLIHTALDVDNIQENISEGKYKNFEEFKADAQLIVHNTAILHGAHSDQTEIARLLYNDTCHELNELLLCRNCFHLSNARPDNWFCYPCSPNHELVWARMK----GFGYWPAKVMQREGTQVDVRFFGHQHQRAWIPSDNIQEISVSVQQLQVKRSAGWKKACEELE 359          

HSP 2 Score: 103.99 bits (258), Expect = 3.219e-22
Identity = 50/110 (45.45%), Postives = 73/110 (66.36%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALM----VTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            +L E  +KL++E EE K   ++KA    + +M+   ++ K   ++ LM       ++H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  +HKR CRRKR
Sbjct:  515 LLKEALDKLRNEMEEEKRQAVSKAVASTQAEMERKCKQVKDKCKEELMEEMKKMVSQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKRTCRRKR 624          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Cavefish
Match: zmynd8 (zinc finger MYND-type containing 8 [Source:NCBI gene;Acc:103045549])

HSP 1 Score: 114.775 bits (286), Expect = 3.509e-25
Identity = 69/248 (27.82%), Postives = 116/248 (46.77%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCE---------SRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC+VCH  G++  C  C R YH  C K            A+    + CP CE         ++++A    + +Q+  LL FA   +++         +         EY ++   DL  +++ IK   Y      + D +  +H+  I +G        A+V+++  + E++E+++C +CY++A  K   W  +PC   H L+WA+    P    +WPAK L +K    + RFF G HDRA+V
Sbjct:  131 GRNDFYCWVCHREGQVLCCELCPRVYHAKCLK----------LAAEPEGDWFCPECEKITVAECIETQSKAMTMLTLEQLSYLLKFALQKMKQPGTEPFQKPVCLEQHPDYAEY-IFHPMDLCTLEKNIKKKMYGSTEAFLADVKWILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSACQKRDNWFCEPCSNPHPLVWAKLKGFP----FWPAKALRDKDGQVDARFF-GQHDRAWV 362          

HSP 2 Score: 73.559 bits (179), Expect = 1.345e-12
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKA-AAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L+E+    E    +M++ +E+++     +     E    +A+  TK++QWC NC KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct: 1088 ELSEMKHNLELTMAEMRQSLEQERERLVAEVKKQMEMEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHW-PEHMKSC 1173          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Cavefish
Match: zmynd8 (zinc finger MYND-type containing 8 [Source:NCBI gene;Acc:103045549])

HSP 1 Score: 114.39 bits (285), Expect = 3.661e-25
Identity = 69/248 (27.82%), Postives = 116/248 (46.77%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCE---------SRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC+VCH  G++  C  C R YH  C K            A+    + CP CE         ++++A    + +Q+  LL FA   +++         +         EY ++   DL  +++ IK   Y      + D +  +H+  I +G        A+V+++  + E++E+++C +CY++A  K   W  +PC   H L+WA+    P    +WPAK L +K    + RFF G HDRA+V
Sbjct:   87 GRNDFYCWVCHREGQVLCCELCPRVYHAKCLK----------LAAEPEGDWFCPECEKITVAECIETQSKAMTMLTLEQLSYLLKFALQKMKQPGTEPFQKPVCLEQHPDYAEY-IFHPMDLCTLEKNIKKKMYGSTEAFLADVKWILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSACQKRDNWFCEPCSNPHPLVWAKLKGFP----FWPAKALRDKDGQVDARFF-GQHDRAWV 318          

HSP 2 Score: 73.559 bits (179), Expect = 1.231e-12
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKA-AAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L+E+    E    +M++ +E+++     +     E    +A+  TK++QWC NC KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct: 1044 ELSEMKHNLELTMAEMRQSLEQERERLVAEVKKQMEMEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHW-PEHMKSC 1129          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Cavefish
Match: zmynd8 (zinc finger MYND-type containing 8 [Source:NCBI gene;Acc:103045549])

HSP 1 Score: 114.39 bits (285), Expect = 3.661e-25
Identity = 69/248 (27.82%), Postives = 116/248 (46.77%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCE---------SRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC+VCH  G++  C  C R YH  C K            A+    + CP CE         ++++A    + +Q+  LL FA   +++         +         EY ++   DL  +++ IK   Y      + D +  +H+  I +G        A+V+++  + E++E+++C +CY++A  K   W  +PC   H L+WA+    P    +WPAK L +K    + RFF G HDRA+V
Sbjct:   87 GRNDFYCWVCHREGQVLCCELCPRVYHAKCLK----------LAAEPEGDWFCPECEKITVAECIETQSKAMTMLTLEQLSYLLKFALQKMKQPGTEPFQKPVCLEQHPDYAEY-IFHPMDLCTLEKNIKKKMYGSTEAFLADVKWILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSACQKRDNWFCEPCSNPHPLVWAKLKGFP----FWPAKALRDKDGQVDARFF-GQHDRAWV 318          

HSP 2 Score: 73.559 bits (179), Expect = 1.231e-12
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKA-AAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L+E+    E    +M++ +E+++     +     E    +A+  TK++QWC NC KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct: 1044 ELSEMKHNLELTMAEMRQSLEQERERLVAEVKKQMEMEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHW-PEHMKSC 1129          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Sea Lamprey
Match: zmynd11 (zinc finger, MYND-type containing 11 [Source:ZFIN;Acc:ZDB-GENE-050522-301])

HSP 1 Score: 152.91 bits (385), Expect = 1.050e-38
Identity = 97/339 (28.61%), Postives = 175/339 (51.62%), Query Frame = 1
Query:  190 ESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCY-KEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKS--VWKDMLTIG---FRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQG 1179
            E+S++L L V+ DGLI       ++T++    GS      + + LP    P  + + DWYCF CH  GE+ +C  CFR YH  C   E++P          ++ ++ CP C+S  +   N+ ++++   L F    +++KS  ++K +   G   +R        LV+   DL  IQ+ ++  +Y  +++ +  A++ +H+  +  G  S +A+ +++L R+ K E+ E+ +C  C+  + A+   W   PC P HKL+WAR       +  WPAK++    D  +VRFFG NH RA++++   +       E+ IK  S + +A  E+++ +E +  G
Sbjct:    5 ETSRQLGLAVK-DGLI-------VETMTVGCKGSKLGIEQEGYWLPGEDNPEEEETSDWYCFECHQAGEVLACESCFRVYHPRCVPSEMVP--------GDADTRWACPICQSFKQ--RNWPKQELCTYLKFVVQRMKEKSPDIYKKVNATGHPLYR-------RLVHTPMDLCSIQKNVELCKYRTVDEFLSHAQLLLHNAVLFFGEISPQAEVSKILYRDTKHEVDEMLLCKICFYMSNARPENWFCYPCNPPHKLVWARMK----GYGCWPAKVMQRVDDRVDVRFFGHNHQRAWIQEEFVRDISAGMHELVIKRSSGWSKARTELERHQEFVRSG 314          

HSP 2 Score: 103.99 bits (258), Expect = 5.405e-23
Identity = 50/110 (45.45%), Postives = 72/110 (65.45%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            ++ E   KL+ E +E K   + KA   ++ +M    +++ EK K    + +    T+H + + +TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  EHKR CRRKR
Sbjct:  507 LVREALEKLRSELDEDKRAAVTKAVANLQAEMDKKCKQVKEKCKEEFLEEIKKLATQHKQMISHTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHSEHKRTCRRKR 616          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Sea Lamprey
Match: zmynd8 (zinc finger, MYND-type containing 8 [Source:ZFIN;Acc:ZDB-GENE-041119-1])

HSP 1 Score: 116.701 bits (291), Expect = 1.685e-26
Identity = 69/248 (27.82%), Postives = 115/248 (46.37%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCE---------SRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC+VCH  G++  C  C R YH  C K            A+    + CP CE         ++++A    +  Q+  LL FA   ++          +         EY ++   DL  ++R IK   Y      + D +  +H+  I +G        A+++++  + E++E+++C +CY+++  K   W  +PC   H L+WA+    P    +WPAK L E+    +VRFF G HDRA+V
Sbjct:   86 GRNDFYCWVCHREGQVLCCELCPRVYHAKCLK----------LAAEPEGDWFCPECEKVTVAECIETQSKAMSMLTTDQLSYLLKFALQRMKHTGTEPFQKPVSLEQHPDYTEY-IFNPMDLSTLERNIKKKIYGCTEAFLADCKWILHNCIIYNGANHKLTTTAKMIIKICEHEMNEIEVCPECYLSSCQKRDNWFCEPCSIPHPLVWAKLKGFP----FWPAKALRERDGQVDVRFF-GQHDRAWV 317          

HSP 2 Score: 69.707 bits (169), Expect = 3.839e-12
Identity = 36/91 (39.56%), Postives = 50/91 (54.95%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKAAAQDALMV-----TETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L E+    E    +M++  E+++    D LM      TE      +  TK++QWC  C KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct:  970 ELLEMKHNAELTMAEMRQSFEQER----DRLMGEVRKQTEIEKLAVVEETKKKQWCAYCRKEAIFYCCWNTSYCDYPCQQAHW-PEHMKTC 1055          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Nematostella
Match: EDO33854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQY8])

HSP 1 Score: 115.161 bits (287), Expect = 2.219e-28
Identity = 71/237 (29.96%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  346 SKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYE--VRFFGGNHDR 1050
            + DWYC+ CH PGE+  C  C R +H  C ++           A S  K+ CP+C+ R E +   S  ++ K+L F    +++K+  KD L      +       V +  DL L+++ ++   Y       + A+  +H+  I  G   +  + A  ++ +   E+ E+  C DCYI +  + A W  KPC   H+L+WA+ +  P     WPAKLL    D     VRFFG  H R
Sbjct:   45 THDWYCWRCHRPGEVILCDFCPRVFHKRCVRD----------GAMSASKWRCPSCQVRPEMS--VSTDELSKMLKFTLERMKEKA--KDFLQPFCLEKYDDYLQFVIKPVDLSLLEKNVRKKHYKTAKQFREHAQWILHNAIIYFGEDRELTELAEAIMEDCDGELEEMVRCPDCYIQSNVRSANWFCKPCFFPHELVWAKMTGEPP----WPAKLLTWSDDQTRALVRFFGSAHQR 263          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Medaka
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:101165343])

HSP 1 Score: 192.971 bits (489), Expect = 3.911e-51
Identity = 123/424 (29.01%), Postives = 214/424 (50.47%), Query Frame = 1
Query:   64 RKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTIS-SVNGSYAN--NDFFNLP-DFSKPFNKGSKDW-------YCFVCHLPGELHSCTECFRGYHIHCY-KEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPP---TED--DYSDEIYLSERRTTGLSIT 1284
            R+   + ++ VW  I  IR QKQ A +D++ K +SR   +  + + R L +   DGL+       ++T++    GS A    + + LP D  +P  +GSKDW       YCF CHLPG++  C  CFR YH+ C  +E  PR+   H        + C  C  R    +N +++++ K L F    +++++V  D+   G   +      L++   D+  IQ  + +G+Y   ++   DA+  VH+  IL+G+ SD+A+ AR+L  +   E++E+ +C +C+  + A+   W   PC PSH L+WA+         YWPAK+L    +  +VRFFG  H RA++   + +       ++++K  + + +A  E++  +  +++G Y  +  E   PP    ED    SD +  +E   + +S T
Sbjct:   13 RQADPKVVQYVWAAIEVIRNQKQIANMDRISKYLSRVFGMHPKETARQLSLAVKDGLV-------VETLTVGCKGSKAGIEQEGYWLPGDEMEPKAEGSKDWEAESHDWYCFQCHLPGDVLPCDNCFRVYHLKCLSEEFKPRDGGSH--------WQCTVC--RGSKKKNLNKQEMSKYLRFIVQRMKERAV--DLNKKGKDTKHPMYRRLIHTALDVSNIQESLSEGKYKSFDEFKADAQQIVHNTAILYGVHSDQAEIARLLFSDTCHELNELMLCKNCFYLSNARPDNWFCYPCSPSHDLVWAKMK----GFGYWPAKVLQRDDNQVDVRFFGHQHQRAWIPSENIQDIKVNVQQLQVKRSNGWKKACEELEVYQRFLKEGRYWKTKLEDSPPPQRQQEDASGRSDRLERTEEAESSISST 413          

HSP 2 Score: 100.908 bits (250), Expect = 3.143e-21
Identity = 49/110 (44.55%), Postives = 70/110 (63.64%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            ++ E   KL+ E EE K   ++KA    + +M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  +HKR CRRKR
Sbjct:  531 VVREALEKLRAEMEEEKRQAVSKAVAGAQAEMDRKCKQVKEKCKEELVEEVKKLVAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKRTCRRKR 640          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Medaka
Match: zmynd11 (zinc finger MYND-type containing 11 [Source:NCBI gene;Acc:101165343])

HSP 1 Score: 115.546 bits (288), Expect = 3.537e-26
Identity = 59/217 (27.19%), Postives = 117/217 (53.92%), Query Frame = 1
Query:  535 NFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYY 1185
            N +++++ K L F    +++++V  D+   G   +      L++   D+  IQ  + +G+Y   ++   DA+  VH+  IL+G+ SD+A+ AR+L  +   E++E+ +C +C+  + A+   W   PC PSH L+WA+         YWPAK+L    +  +VRFFG  H RA++   + +       ++++K  + + +A  E++  +  +++G Y
Sbjct:   98 NLNKQEMSKYLRFIVQRMKERAV--DLNKKGKDTKHPMYRRLIHTALDVSNIQESLSEGKYKSFDEFKADAQQIVHNTAILYGVHSDQAEIARLLFSDTCHELNELMLCKNCFYLSNARPDNWFCYPCSPSHDLVWAKMK----GFGYWPAKVLQRDDNQVDVRFFGHQHQRAWIPSENIQDIKVNVQQLQVKRSNGWKKACEELEVYQRFLKEGRY 308          

HSP 2 Score: 100.908 bits (250), Expect = 1.975e-21
Identity = 49/110 (44.55%), Postives = 70/110 (63.64%), Query Frame = 2
Query: 2465 ILVELENKLKHEYEEAKLNEINKATEEIRVQM----QEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            ++ E   KL+ E EE K   ++KA    + +M    +++ EK K    + +     +H + +  TK++QWC NC +EA+YHCCWNTSYCSI+CQQEHW  +HKR CRRKR
Sbjct:  442 VVREALEKLRAEMEEEKRQAVSKAVAGAQAEMDRKCKQVKEKCKEELVEEVKKLVAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKRTCRRKR 551          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Medaka
Match: prkcbp1l (protein kinase C-binding protein 1 [Source:NCBI gene;Acc:101161311])

HSP 1 Score: 115.931 bits (289), Expect = 1.420e-25
Identity = 69/240 (28.75%), Postives = 115/240 (47.92%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTC-ESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC++CH  G++  C  C R YH  C K  +P       F    +K     C E++++A    +  Q+  LL FA   I++         +         EY ++   DL  +++ +K   Y      + D +  +H+  I +G        A+V+++  + E++E+++C +CY++A  K   W  +PC   H L+WA+    P    +WPAK L EK    + RFF G HDRA+V
Sbjct:  111 GRNDFYCWLCHREGQVLCCELCPRVYHAKCLK--LPAEPEGDWFCPECEKITVAECIETQSKAMTMLTIDQLSYLLKFALQKIKQPGTEPFQKPVSLDQHPDYAEY-IFHPMDLSTLEKNVKKKMYGCTEAFLADMKWILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSACQKRENWFCEPCSQPHPLVWAKLKGFP----FWPAKALREKDGQVDARFF-GQHDRAWV 342          

HSP 2 Score: 73.1738 bits (178), Expect = 1.465e-12
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKA-AAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L+E+    E    +M++ +E+++     +     E    +A+  TK++QWC NC KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct:  996 ELSEMKHNLELTMAEMRQSLEQERERLVAEVKKQMELEKQQAVDETKKKQWCANCRKEAIFYCCWNTSYCDYPCQQAHW-PEHMKSC 1081          
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000017105.2 (death-inducer obliterator 1 [Source:NCBI gene;Acc:101156246])

HSP 1 Score: 114.005 bits (284), Expect = 4.852e-25
Identity = 68/240 (28.33%), Postives = 115/240 (47.92%), Query Frame = 1
Query:  343 GSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTC-ESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFV 1059
            G  D+YC++CH  G++  C  C R YH  C K  +P       F    +K     C E++++A    +  Q+  LL FA   +++         +         EY ++   DL  +++ IK   Y      + D +  +H+  I +G        A+V+++  + E++E+++C +CY++A  K   W  +PC   H L+WA+    P    +WPAK L +K    + RFF G HDRA+V
Sbjct:  105 GRNDFYCWLCHREGQVLCCELCPRVYHAKCLK--LPSEPEGDWFCPECEKITVAECIETQSKAMMMLTIDQLSYLLKFALQKMKQPGTEPFQKPVSLEQHPDYAEY-IFHPMDLCTLEKNIKKKMYGCTEAFLADVKWILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSACQKRDNWFCEPCSNPHPLVWAKLKGFP----FWPAKALRDKDGQVDARFF-GQHDRAWV 336          

HSP 2 Score: 73.1738 bits (178), Expect = 1.746e-12
Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 2
Query: 2513 KLNEINKATEEIRVQMQEIIEKDKA-AAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            +L+E+    E    +M++ +E+++     +     E    +A   TK++QWC NC KEAI++CCWNTSYC   CQQ HW  EH + C
Sbjct:  925 ELSEMKHNLELTMAEMRQSLEQERERLVNEVKKQMEVEKQQATDETKKKQWCANCRKEAIFYCCWNTSYCDYPCQQAHW-PEHMKSC 1010          
BLAST of Zinc finger MYND domain-containing protein vs. Planmine SMEST
Match: SMESG000023144.1 (SMESG000023144.1)

HSP 1 Score: 1150.19 bits (2974), Expect = 0.000e+0
Identity = 661/663 (99.70%), Postives = 662/663 (99.85%), Query Frame = 1
Query:   31 MLSVNSRPQIIRKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTTGLSITDXXXXXXXXXXXXXXXXXXXXXXXEKNRKNVLPISINGKTAAKKMDHPNVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMTNNNVEKSVSSYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKSLNYKFSPKPSSIRSPSATTKSLRQNRKPSTKFSQLTSVRYLSLSDRIKMDLSSTDSSEFNPKEERPSYARKRPKKEKFKTSPQNKPFNANKPKRSPVFPVNLDLV 2019
            MLSVNSRPQIIRKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTTGLSITDNNLANGSNYSLLSSLSSRRSSALEKNRKNVLPISINGKTAAKKMDHPNVISKSTKRSSSKSGGGGGG GGGGGPLSKKPMTNNNVEKSVSSYVRSEKSTSGRSSKKRTKHSQSDSDTSDNSDNDVCDSDNSSSSVNIKSLNYKFSPKPSSIRSPSATTKSLRQNRKPSTKFSQLTSVRYLSLSDRIKMDLSSTDSSEF+PKEERPSYARKRPKKEKFKTSPQNKPFNANKPKRSPVFPVNLDLV
Sbjct:    1 MLSVNSRPQIIRKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTTGLSITDNNLANGSNYSLLSSLSSRRSSALEKNRKNVLPISINGKTAAKKMDHPNVISKSTKRSSSKSGGGGGGGGGGGGPLSKKPMTNNNVEKSVSSYVRSEKSTSGRSSKKRTKHSQSDSDTSDNSDNDVCDSDNSSSSVNIKSLNYKFSPKPSSIRSPSATTKSLRQNRKPSTKFSQLTSVRYLSLSDRIKMDLSSTDSSEFDPKEERPSYARKRPKKEKFKTSPQNKPFNANKPKRSPVFPVNLDLV 663          

HSP 2 Score: 489.574 bits (1259), Expect = 6.286e-155
Identity = 253/274 (92.34%), Postives = 258/274 (94.16%), Query Frame = 2
Query: 1970 PTNQKDLRFSPLI*ISF-LLSKKNT--FFPQNSIKHSETSSSNEDTDRCCSPDHLSTSPLFRSGPNQRLAKLPMVSSKRGVAAADSTSNNTGIASLNQPMPATPSVSTTSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLPICNCQEKFDXXXXXXXXXXXXXHSLILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            P N    + SP+  ++  L+S K    FFP NSIKHSETSSSNEDTDRCCSPDHLSTSPLFRSGPNQRLAKLPMVSSKRGVAAADSTSNNTGIASLNQPMPATPSVSTTSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLPICNCQEKFDKQLEEEKLKLQQEHSLILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR
Sbjct:  644 PFNANKPKRSPVFPVNLDLVSSKQEKHFFPPNSIKHSETSSSNEDTDRCCSPDHLSTSPLFRSGPNQRLAKLPMVSSKRGVAAADSTSNNTGIASLNQPMPATPSVSTTSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLPICNCQEKFDKQLEEEKLKLQQEHSLILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 917          
BLAST of Zinc finger MYND domain-containing protein vs. Planmine SMEST
Match: SMESG000023144.1 (SMESG000023144.1)

HSP 1 Score: 1145.57 bits (2962), Expect = 0.000e+0
Identity = 633/663 (95.48%), Postives = 640/663 (96.53%), Query Frame = 1
Query:   31 MLSVNSRPQIIRKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTTGLSITDXXXXXXXXXXXXXXXXXXXXXXXEKNRKNVLPISINGKTAAKKMDHPNVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMTNNNVEKSVSSYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKSLNYKFSPKPSSIRSPSATTKSLRQNRKPSTKFSQLTSVRYLSLSDRIKMDLSSTDSSEFNPKEERPSYARKRPKKEKFKTSPQNKPFNANKPKRSPVFPVNLDLV 2019
            MLSVNSRPQIIRKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTTGLSITDNNLANGSNYSLLSSLSSRRSSALEKNRKNVLPISINGKTAAKKMDHPNVISKSTKRSSSKSGGGGGG GGGGGPLSKKPMTNNNVEKSVSSYV      S      + +   S SD+  + ++D  DSDNSSSSVNIKSLNYKFSPKPSSIRSPSATTKSLRQNRKPSTKFSQLTSVRYLSLSDRIKMDLSSTDSSEF+PKEERPSYARKRPKKEKFKTSPQNKPFNANKPKRSPVFPVNLDLV
Sbjct:    1 MLSVNSRPQIIRKTTSEYIKVVWECIRNIRIQKQTATLDKLVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANNDFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAEWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDRAFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSGESDLPPTEDDYSDEIYLSERRTTGLSITDNNLANGSNYSLLSSLSSRRSSALEKNRKNVLPISINGKTAAKKMDHPNVISKSTKRSSSKSGGGGGGGGGGGGPLSKKPMTNNNVEKSVSSYV--RSEKSTSGRSSKKRTKHSQSDSDTSDNSDNDDSDNSSSSVNIKSLNYKFSPKPSSIRSPSATTKSLRQNRKPSTKFSQLTSVRYLSLSDRIKMDLSSTDSSEFDPKEERPSYARKRPKKEKFKTSPQNKPFNANKPKRSPVFPVNLDLV 661          

HSP 2 Score: 489.189 bits (1258), Expect = 7.981e-155
Identity = 253/274 (92.34%), Postives = 258/274 (94.16%), Query Frame = 2
Query: 1970 PTNQKDLRFSPLI*ISF-LLSKKNT--FFPQNSIKHSETSSSNEDTDRCCSPDHLSTSPLFRSGPNQRLAKLPMVSSKRGVAAADSTSNNTGIASLNQPMPATPSVSTTSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLPICNCQEKFDXXXXXXXXXXXXXHSLILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 2782
            P N    + SP+  ++  L+S K    FFP NSIKHSETSSSNEDTDRCCSPDHLSTSPLFRSGPNQRLAKLPMVSSKRGVAAADSTSNNTGIASLNQPMPATPSVSTTSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLPICNCQEKFDKQLEEEKLKLQQEHSLILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR
Sbjct:  642 PFNANKPKRSPVFPVNLDLVSSKQEKHFFPPNSIKHSETSSSNEDTDRCCSPDHLSTSPLFRSGPNQRLAKLPMVSSKRGVAAADSTSNNTGIASLNQPMPATPSVSTTSPYPIRQRINSGYNPPIINQSKRMVHKCIATTLPICNCQEKFDKQLEEEKLKLQQEHSLILVELENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRKR 915          
BLAST of Zinc finger MYND domain-containing protein vs. Planmine SMEST
Match: SMESG000032322.1 (SMESG000032322.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.151e-11
Identity = 51/242 (21.07%), Postives = 100/242 (41.32%), Query Frame = 1
Query:  352 DWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKSV-WKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYI----YLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYI----NAKAKLA-----EWITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFG 1035
            DWYCF+CH  G    C +C   +H  C  ++              D+F C TC    + + +F +  +    +     I    + WK +  +G+  +  +N++ +Y+  +   I +     +Y     Y  + + D  +  H+  +++GI           ++ +  E+  +  C  CYI     +  KL+     E  +  C+  H+++W      P  + +WP K++   SD    RF+G
Sbjct:   90 DWYCFLCHKCGPDMRCRKCDTSFHSSCNSDLF-------------DQFHCHTCRQSGQFSSDFQKFSIVTQSEIIRRVIYSNKIKWKSLNIVGYIKDEPRNKFFIYKTMNSAEIDKNYSSNKYFSTNKYRENFLFDLLLLKHNCSVIYGIDHAFYKLIAGYIKHLHMEMENI-YCDSCYILFSNKSSHKLSTVQKQELFSSVCDMKHQIMWG---LVP-PNIFWPFKVISHDSD----RFYG 309          
BLAST of Zinc finger MYND domain-containing protein vs. Planmine SMEST
Match: SMESG000070060.1 (SMESG000070060.1)

HSP 1 Score: 67.781 bits (164), Expect = 4.252e-11
Identity = 64/307 (20.85%), Postives = 119/307 (38.76%), Query Frame = 1
Query:  253 QALKTISSVNGSYANNDFFNLPDFSK----PFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIPRNSRHHRFAKSNDKFICPTCESRTEAN---------ENFSRKQVRKLLDFATHFIRKKSVWKDMLTIGFRGEIVKNEYLVYRY-CDLELIQRKIKDGRYIYLNDLVDDAEIFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADC------------------------------YINAKAKLAE--WITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFG 1035
            +A+K  S    S  + D+ N     K     F  G  D YC++CH       C+ C R +H++C +    +       A   + ++CP C S   A          ++ S  ++ ++L F    +   S       I    + +K+ Y + ++   ++L++ K+ +  Y  +     D +  +H+  + +G  S   + A+ + +    EI+ ++ C +C                              Y N + +L    W+TK C+  H L+W R    P     WP KL+    +   V FFG
Sbjct:   57 KAIKLKSKSQASVTSQDWDNEMTVQKYVPPSFTSGPHDIYCWICHKTENTLECSFCPRVFHMNCVQSCFSQT------AGEKEDWVCPECISVMVAECTLNVLPRWKHISIMELNEMLLFVLLRLYHIS-GSSHFQIAVDDQAIKDYYTIIKHPVYMDLLKEKVVNNEYCSVQAFHSDFKWILHNCLVYNGAASVLTNYAKNIDKVCSKEINLLRSCPECFQQRMPFMIKLLKEQGKSSPTKSTVSDKSWYFNLEDQLVNEMWMTKLCDSVHSLVWVRLHNYP----IWPGKLISLDDESALVLFFG 352          

HSP 2 Score: 57.3806 bits (137), Expect = 7.002e-8
Identity = 28/94 (29.79%), Postives = 50/94 (53.19%), Query Frame = 2
Query: 2501 YEEAKLNEINKATEEIR----VQMQEIIEKDKAAAQDALMVTETRHGEALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVC 2770
            + E  + E +K  +E++    + + E+++  ++   D       + G A+   K  +WC  C K A ++CCWNT YC+ +CQ +HW+  HK  C
Sbjct:  623 HHEENMLEFSKQQKELKKLYDIDVLEMVKHIRSKFDD-------KFGRAIQKVKSNEWCAFCSKVARFYCCWNTCYCNYECQSKHWEM-HKATC 708          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZMYND111.496e-4628.20zinc finger MYND-type containing 11 [Source:HGNC S... [more]
ZMYND118.158e-4628.20zinc finger MYND-type containing 11 [Source:HGNC S... [more]
ZMYND118.158e-4628.20zinc finger MYND-type containing 11 [Source:HGNC S... [more]
ZMYND114.147e-4528.20zinc finger MYND-type containing 11 [Source:HGNC S... [more]
ZMYND112.936e-4127.42zinc finger MYND-type containing 11 [Source:HGNC S... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bra-21.404e-1738.68BMP Receptor Associated protein family [Source:Un... [more]
bra-12.788e-1636.70BMP Receptor Associated protein family [Source:Un... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG18156.332e-1826.51gene:FBgn0039863 transcript:FBtr0085824[more]
CG18151.520e-1726.10gene:FBgn0039863 transcript:FBtr0085823[more]
CG85692.502e-1631.54gene:FBgn0033752 transcript:FBtr0087940[more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmynd116.319e-5028.46zinc finger, MYND-type containing 11 [Source:ZFIN;... [more]
zmynd111.684e-4827.91zinc finger, MYND-type containing 11 [Source:ZFIN;... [more]
zmynd115.964e-4827.99zinc finger, MYND-type containing 11 [Source:ZFIN;... [more]
prkcbp1l2.809e-2527.82protein kinase C binding protein 1, like [Source:Z... [more]
prkcbp1l2.889e-2527.82protein kinase C binding protein 1, like [Source:Z... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmynd113.391e-4326.42zinc finger MYND-type containing 11 [Source:NCBI g... [more]
zmynd119.792e-4325.71zinc finger MYND-type containing 11 [Source:NCBI g... [more]
zmynd111.602e-4226.04zinc finger MYND-type containing 11 [Source:NCBI g... [more]
zmynd112.684e-4125.88zinc finger MYND-type containing 11 [Source:NCBI g... [more]
zmynd114.442e-4025.99zinc finger MYND-type containing 11 [Source:NCBI g... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zmynd117.922e-4627.94zinc finger, MYND domain containing 11 [Source:MGI... [more]
Zmynd111.516e-4527.94zinc finger, MYND domain containing 11 [Source:MGI... [more]
Zmynd111.516e-4527.94zinc finger, MYND domain containing 11 [Source:MGI... [more]
Zmynd114.489e-4127.42zinc finger, MYND domain containing 11 [Source:MGI... [more]
Zmynd112.309e-3827.14zinc finger, MYND domain containing 11 [Source:MGI... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q15326|ZMY11_HUMAN3.918e-4528.20Zinc finger MYND domain-containing protein 11 OS=H... [more]
sp|Q8R5C8|ZMY11_MOUSE1.061e-4427.94Zinc finger MYND domain-containing protein 11 OS=M... [more]
sp|Q9ULU4|PKCB1_HUMAN7.002e-2327.92Protein kinase C-binding protein 1 OS=Homo sapiens... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183RLX01.140e-12848.33Bromo domain-containing protein OS=Schistosoma rod... [more]
A0A183JJS13.679e-12848.10Bromo domain-containing protein OS=Schistosoma cur... [more]
A0A183PPA53.895e-12848.10Bromo domain-containing protein OS=Schistosoma mat... [more]
A0A183N5W17.729e-12747.86Bromo domain-containing protein OS=Schistosoma mar... [more]
A0A3P8DW677.810e-12747.86Bromo domain-containing protein OS=Schistosoma mar... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmynd112.273e-4828.69zinc finger MYND-type containing 11 [Source:NCBI g... [more]
zmynd117.450e-4828.07zinc finger MYND-type containing 11 [Source:NCBI g... [more]
zmynd83.509e-2527.82zinc finger MYND-type containing 8 [Source:NCBI ge... [more]
zmynd83.661e-2527.82zinc finger MYND-type containing 8 [Source:NCBI ge... [more]
zmynd83.661e-2527.82zinc finger MYND-type containing 8 [Source:NCBI ge... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zmynd111.050e-3828.61zinc finger, MYND-type containing 11 [Source:ZFIN;... [more]
zmynd81.685e-2627.82zinc finger, MYND-type containing 8 [Source:ZFIN;A... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO338542.219e-2829.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zmynd113.911e-5129.01zinc finger MYND-type containing 11 [Source:NCBI g... [more]
zmynd113.537e-2627.19zinc finger MYND-type containing 11 [Source:NCBI g... [more]
prkcbp1l1.420e-2528.75protein kinase C-binding protein 1 [Source:NCBI ge... [more]
ENSORLT00000017105.24.852e-2528.33death-inducer obliterator 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000023144.16.286e-15599.70SMESG000023144.1[more]
SMESG000023144.17.981e-15595.48SMESG000023144.1[more]
SMESG000032322.11.151e-1121.07SMESG000032322.1[more]
SMESG000070060.14.252e-1120.85SMESG000070060.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029664 ID=SMED30029664|Name=Zinc finger MYND domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3827bp
ATCTATATAAATCTTATATGGATAGAAACTATGCTTTCAGTTAATTCAAG
ACCTCAAATTATCCGCAAAACAACATCAGAGTATATTAAAGTGGTATGGG
AATGCATTAGAAATATACGTATCCAAAAGCAAACTGCAACTTTGGATAAA
TTAGTTAAAGCAATTTCGAGAGAAAATAACATCGATGAAGAGTCTAGTAA
GCGCTTGTTATTAATGGTAGAAGCTGACGGGCTTATTGAAAGAGGAGATC
CTCAAGCATTAAAAACCATTTCTTCAGTTAATGGATCATATGCAAATAAT
GATTTTTTTAATCTGCCAGATTTTTCTAAACCATTTAACAAAGGTTCAAA
GGATTGGTATTGTTTTGTTTGTCATCTACCTGGCGAGTTGCATTCATGCA
CTGAGTGCTTCCGCGGTTATCATATTCATTGTTACAAAGAAATCATACCC
AGAAATTCACGACACCACCGATTTGCCAAATCCAACGATAAATTTATTTG
TCCAACTTGTGAAAGTCGAACCGAGGCTAATGAGAATTTCTCTCGGAAAC
AAGTTCGAAAATTGTTGGACTTTGCAACGCATTTCATTCGTAAAAAATCA
GTTTGGAAAGACATGCTAACGATTGGGTTTCGGGGAGAAATTGTCAAAAA
CGAGTATCTAGTTTATCGATATTGTGATTTAGAGTTGATCCAACGCAAGA
TCAAAGATGGTCGATACATATATTTAAATGATTTAGTTGATGACGCCGAG
ATATTTGTTCATGATGTTTGTATTCTCCACGGCATTTTCAGTGACAAAGC
CGACCAGGCCCGAGTTTTGCTCCGGGAAATAAAAGATGAAATCTCCGAGG
TGCAAATGTGTGCCGACTGCTACATTAATGCAAAAGCCAAGCTCGCTGAA
TGGATTACCAAGCCGTGTGAACCATCTCACAAATTGATTTGGGCTCGGCA
ATCCACAACACCGGGAGCGCATTTCTATTGGCCAGCAAAGTTGCTTTTAG
AGAAGAGTGACGGATATGAGGTTCGGTTTTTCGGCGGAAATCACGATCGA
GCATTCGTTAAAAAGCATGACACAAAATCGTTTCATTTCCGACCGGATGA
AATCGAAATCAAACACGGCAGCTGCTTTGATCGGGCTTGGATCGAGGTGA
AGAAGCTGAAGGAGAAAATCGAGCAAGGCTATTACACACACTCATCCGGT
GAGAGTGACCTACCGCCGACCGAGGACGATTATTCCGATGAGATCTATTT
GAGTGAGCGTCGGACAACCGGGCTTTCCATTACCGATAACAATCTCGCAA
ACGGAAGCAATTATTCTCTGTTGAGCAGTCTTTCAAGCCGAAGGTCTTCA
GCGCTGGAGAAAAATCGCAAAAACGTCCTTCCAATTTCTATCAACGGTAA
AACGGCTGCCAAGAAAATGGATCACCCAAACGTCATATCAAAATCGACAA
AGCGCAGCTCATCTAAAAGTGGCGGTGGCGGAGGCGGTGTCGGTGGCGGA
GGCGGGCCGTTATCCAAGAAGCCTATGACAAATAATAATGTAGAAAAATC
AGTATCGAGTTATGTGAGATCAGAGAAAAGCACATCTGGCAGGTCTAGCA
AGAAGCGCACCAAGCACAGCCAATCAGATTCTGATACCTCTGACAACAGT
GATAATGATGTATGTGATTCTGATAATTCCTCGTCCTCTGTAAATATTAA
ATCTCTCAATTACAAATTCTCCCCTAAACCATCTAGCATCAGATCTCCTA
GTGCTACAACGAAATCTCTGCGGCAGAACCGCAAACCGTCGACTAAATTT
TCCCAGCTCACATCTGTTAGATATCTCTCCTTAAGCGACCGTATCAAAAT
GGATTTATCCTCTACCGATTCCAGTGAATTCAATCCGAAAGAGGAACGCC
CTAGTTATGCTAGAAAACGCCCTAAAAAAGAAAAGTTCAAAACCTCTCCT
CAAAATAAACCTTTCAACGCCAACAAACCAAAAAGATCTCCGGTTTTCCC
CGTTAATTTAGATCTCGTTTCTTCTAAGCAAGAAAAACACTTTTTTTCCT
CAAAATTCCATAAAGCATTCAGAAACCAGCAGTAGTAACGAAGATACCGA
TCGCTGTTGTAGTCCAGATCACTTATCAACTTCGCCTTTGTTTCGATCTG
GACCCAATCAAAGATTAGCGAAGCTACCAATGGTATCATCCAAACGCGGT
GTAGCTGCAGCTGATAGCACCAGCAATAACACTGGCATTGCCTCATTAAA
TCAACCAATGCCCGCTACACCTAGTGTCAGCACGACGTCTCCTTATCCCA
TTCGACAACGAATAAATTCAGGGTACAATCCACCAATTATCAATCAATCA
AAGCGCATGGTGCACAAATGCATTGCCACCACGTTACCGATCTGTAATTG
TCAAGAGAAATTCGATAAACAATTAGAGGAAGAAAAATTAAAACTACAAC
AAGAACATTCTCTAATTCTAGTTGAATTGGAAAACAAATTGAAACATGAA
TACGAAGAGGCGAAGTTGAATGAAATTAATAAGGCCACAGAAGAAATCAG
AGTGCAAATGCAGGAAATCATTGAAAAAGACAAAGCAGCTGCTCAAGACG
CATTGATGGTCACTGAAACTCGCCATGGTGAAGCACTGATCAACACAAAA
CGACGCCAATGGTGTCGAAATTGTCTGAAAGAGGCAATCTATCATTGTTG
CTGGAACACATCATATTGCAGTATACAATGCCAACAAGAGCATTGGCAAA
AAGAACATAAACGTGTTTGCAGAAGAAAACGATGACTGATTTTTTCCATT
TATTTTCTTTTTTTTTGGAATTTTTCATTTAACCAACTATTTTGCGTGTA
TCTGAACATTATTTTATTTTCAATGATTTTAATGATTTTCTATGAAGGTG
TTATTTATTAATTTTAATTTCCAACACAATTCAAATCAAATGAAAGAATA
TATCAAAGCAATTGAATTCTACTTATAGATTTATTCCCCCCCGTCTCTCT
CTCTCTCTCCCACTCTCTTGTAAAAGTCGGTTTTCTCACTCTCTATCTCT
CCATCTATGTTCTACCTAAGCATTCGGGTGTATAATATTGGAATTGAAGG
GAAATTGATATAAAAGATTTAGAAATATATTAATAATCCAGCGGACTGTG
TTCATCTGTGGCCTTGATTTATTGTTAATATCGTTTTCAATTTATCGGTT
CAGAAACTAGTTACTCAAGATTTAGTTATTTATTTTTTATAAATAAATGT
TTGCTCGTTATTCTATATATATATAAATTATTATTAATAATGATGATGAT
AATAATAATGATAATCTGTTGAATCTTTTGCGACGGCAACGATCACCATC
AATACCAACAATCTGATATATTTCGACAAATATCTATATTTCGATTGGTT
GGCACAATTATCCAATAATAAACATTTCAATATTTATTTTATTTTGTCAC
TTTAGGAAATTTGTGTGTATATATATATAAATTGTATTTTAAACCGAAAA
GGAAAACTTTGTGGAACTAATATCTTCTTTCTATGCAGCTAAATTTGTAC
AAAGTCTCGTAGATTATTGTGTTTTATATATATACATTGTTTTATTTTTG
TTTCATGTATTTAATTTTACTGTCACGCCGTCTTGGAATCGATTTTTGTC
AGATCTAACACTTGTATGTGAAATTGTTGAGTTTCTATGATGATCAAATC
AATAATCAATAACCAATAAATCAATATTAAGAAAATCAATATAAAGAAAA
TCAATAGAAATTTGTAAATATCTATTATTGTTTATTAATGATATTCCTGA
AAGTATTGTTTAGACATTAATAAAAAT
back to top

protein sequence of SMED30029664-orf-1

>SMED30029664-orf-1 ID=SMED30029664-orf-1|Name=SMED30029664-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MVSSKRGVAAADSTSNNTGIASLNQPMPATPSVSTTSPYPIRQRINSGYN
PPIINQSKRMVHKCIATTLPICNCQEKFDKQLEEEKLKLQQEHSLILVEL
ENKLKHEYEEAKLNEINKATEEIRVQMQEIIEKDKAAAQDALMVTETRHG
EALINTKRRQWCRNCLKEAIYHCCWNTSYCSIQCQQEHWQKEHKRVCRRK
R*
back to top

protein sequence of SMED30029664-orf-2

>SMED30029664-orf-2 ID=SMED30029664-orf-2|Name=SMED30029664-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=695bp
IYINLIWIETMLSVNSRPQIIRKTTSEYIKVVWECIRNIRIQKQTATLDK
LVKAISRENNIDEESSKRLLLMVEADGLIERGDPQALKTISSVNGSYANN
DFFNLPDFSKPFNKGSKDWYCFVCHLPGELHSCTECFRGYHIHCYKEIIP
RNSRHHRFAKSNDKFICPTCESRTEANENFSRKQVRKLLDFATHFIRKKS
VWKDMLTIGFRGEIVKNEYLVYRYCDLELIQRKIKDGRYIYLNDLVDDAE
IFVHDVCILHGIFSDKADQARVLLREIKDEISEVQMCADCYINAKAKLAE
WITKPCEPSHKLIWARQSTTPGAHFYWPAKLLLEKSDGYEVRFFGGNHDR
AFVKKHDTKSFHFRPDEIEIKHGSCFDRAWIEVKKLKEKIEQGYYTHSSG
ESDLPPTEDDYSDEIYLSERRTTGLSITDNNLANGSNYSLLSSLSSRRSS
ALEKNRKNVLPISINGKTAAKKMDHPNVISKSTKRSSSKSGGGGGGVGGG
GGPLSKKPMTNNNVEKSVSSYVRSEKSTSGRSSKKRTKHSQSDSDTSDNS
DNDVCDSDNSSSSVNIKSLNYKFSPKPSSIRSPSATTKSLRQNRKPSTKF
SQLTSVRYLSLSDRIKMDLSSTDSSEFNPKEERPSYARKRPKKEKFKTSP
QNKPFNANKPKRSPVFPVNLDLVSSKQEKHFFSSKFHKAFRNQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036427Bromodomain-like_sf
IPR001965Znf_PHD
IPR013083Znf_RING/FYVE/PHD
IPR019787Znf_PHD-finger
IPR011011Znf_FYVE_PHD
IPR002893Znf_MYND
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 113..164
e-value: 4.5E-6
score: 36.2
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 106..179
e-value: 1.1E-8
score: 36.6
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 180..290
e-value: 2.6E-8
score: 35.6
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 297..404
e-value: 1.1E-21
score: 79.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 499..520
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 611..663
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 521..539
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 456..594
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 612..632
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 546..594
NoneNo IPR availablePANTHERPTHR46379FAMILY NOT NAMEDcoord: 13..545
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 293..382
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 111..166
score: 8.68
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 110..166