G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30029661
Length (bp)1313
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30029661) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30029661) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30029661) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30029661) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029661

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30029661SMESG000029598.1 dd_Smed_v4_13372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029661SMESG000029598.1 dd_Smed_v4_13372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029661SMESG000029598.1 dd_Smed_v4_13372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029661SMESG000029598.1 dd_Smed_v4_13372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: HCRTR2 (hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4849])

HSP 1 Score: 51.2174 bits (121), Expect = 2.420e-6
Identity = 31/103 (30.10%), Postives = 59/103 (57.28%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYL-TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVE 480
            ++FIV L+++D+LV +  +P+T+ V+   T+      CK   +L   ++  S + +S +ALDR+  ICHP +   T  R+   ++ + ++S  I I  A+ +E
Sbjct:   90 NYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVME 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: HCRTR2 (hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4849])

HSP 1 Score: 51.2174 bits (121), Expect = 2.420e-6
Identity = 31/103 (30.10%), Postives = 59/103 (57.28%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYL-TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVE 480
            ++FIV L+++D+LV +  +P+T+ V+   T+      CK   +L   ++  S + +S +ALDR+  ICHP +   T  R+   ++ + ++S  I I  A+ +E
Sbjct:   90 NYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVME 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-11 (Putative neuropeptide Y receptor 11 [Source:UniProtKB/Swiss-Prot;Acc:Q18179])

HSP 1 Score: 51.9878 bits (123), Expect = 4.806e-7
Identity = 29/74 (39.19%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTM-AVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHP 381
            + T +FFI+ LA+SD  VC+V  P+T+  V Y+ +  S   CK    L   N+  ST  I+++A+DRY+ I  P
Sbjct:   71 RTTRNFFILNLALSDFFVCIVTAPTTLYTVLYMFWPFSRTLCKIAGSLQGFNIFLSTFSIASIAVDRYVLIIFP 144          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 48.9062 bits (115), Expect = 4.127e-6
Identity = 33/102 (32.35%), Postives = 57/102 (55.88%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLV---IVPSTMAVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVAL 471
            + FIV L++SD+ V +V   + P T   +   F      C     L  + L FST+ ++A+A+DRY+ ICHP  + +   +++K++ F + IS  +G+ V L
Sbjct:   64 NMFIVSLSVSDIFVAIVSGSVTPITAFSKVWLFG--GPLCHLLPLLQGTALSFSTLTLTAIAIDRYILICHPTKEPIRKDQALKMISFNSAIS--VGLSVPL 161          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 48.9062 bits (115), Expect = 4.233e-6
Identity = 33/102 (32.35%), Postives = 57/102 (55.88%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLV---IVPSTMAVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVAL 471
            + FIV L++SD+ V +V   + P T   +   F      C     L  + L FST+ ++A+A+DRY+ ICHP  + +   +++K++ F + IS  +G+ V L
Sbjct:   64 NMFIVSLSVSDIFVAIVSGSVTPITAFSKVWLFG--GPLCHLLPLLQGTALSFSTLTLTAIAIDRYILICHPTKEPIRKDQALKMISFNSAIS--VGLSVPL 161          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-3 (FMRFamide Peptide Receptor family; VRFamide receptor 1 [Source:UniProtKB/TrEMBL;Acc:G5EG36])

HSP 1 Score: 48.521 bits (114), Expect = 5.547e-6
Identity = 32/117 (27.35%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  142 YKKKLYNKHTADFFIVVLAISDLLVCLVIVP---STMAVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFV--QYLTVGRSIKLVMFLALISFTIGIMVALNV 477
            Y +K + K + +  +  L++SDL VC++ +P   ST   + +   I+++     Y + I     S  L+ ++ +DRYL +CHPF+   Y T  R++           T+G++V  +V
Sbjct:   31 YTRKTFRKKSINVLLAALSMSDLCVCVLAIPVFASTQLQQVIPPTITAMIMVYLYPVTIMFQSVSVWLLVSITIDRYLAVCHPFMVNTYCTRNRAL----------ITVGVVVIFSV 137          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308316)

HSP 1 Score: 51.6026 bits (122), Expect = 8.145e-7
Identity = 30/81 (37.04%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  148 KKLYNKHTADFFIVVLAISDLLVCLVIVPSTMA---VEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHP 381
            +K   +   + FI+ LAISDLL+CLV +P T+     +Y  +   S+ CK    L    +  ST+ I+A+A DRY  I +P
Sbjct:  113 RKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYP 193          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308317)

HSP 1 Score: 51.6026 bits (122), Expect = 8.687e-7
Identity = 30/81 (37.04%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  148 KKLYNKHTADFFIVVLAISDLLVCLVIVPSTMA---VEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHP 381
            +K   +   + FI+ LAISDLL+CLV +P T+     +Y  +   S+ CK    L    +  ST+ I+A+A DRY  I +P
Sbjct:  113 RKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYP 193          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308318)

HSP 1 Score: 51.6026 bits (122), Expect = 8.701e-7
Identity = 30/81 (37.04%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  148 KKLYNKHTADFFIVVLAISDLLVCLVIVPSTMA---VEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHP 381
            +K   +   + FI+ LAISDLL+CLV +P T+     +Y  +   S+ CK    L    +  ST+ I+A+A DRY  I +P
Sbjct:  113 RKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYP 193          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0078590)

HSP 1 Score: 51.6026 bits (122), Expect = 9.044e-7
Identity = 30/81 (37.04%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  148 KKLYNKHTADFFIVVLAISDLLVCLVIVPSTMA---VEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHP 381
            +K   +   + FI+ LAISDLL+CLV +P T+     +Y  +   S+ CK    L    +  ST+ I+A+A DRY  I +P
Sbjct:  113 RKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYP 193          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CapaR (gene:FBgn0037100 transcript:FBtr0078379)

HSP 1 Score: 50.447 bits (119), Expect = 2.347e-6
Identity = 34/107 (31.78%), Postives = 58/107 (54.21%), Query Frame = 1
Query:  166 HTA-DFFIVVLAISDLLVCLVIVPSTMAVEYLTFN--ISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVG--RSIKLVMFLALISFTIGIMVAL 471
            HTA ++++  LA+SDLL  L  +P+ + + +  +       FCK   F++ +    S   I A +++R+L ICHP   Y  VG  R+I+++  L ++SF   I   L
Sbjct:  100 HTATNYYLFSLAVSDLLYLLFGLPTEVFLYWHQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIRIITALWIVSFISAIPFGL 206          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: htr2b (5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled [Source:ZFIN;Acc:ZDB-GENE-081022-57])

HSP 1 Score: 50.0618 bits (118), Expect = 4.038e-6
Identity = 38/118 (32.20%), Postives = 71/118 (60.17%), Query Frame = 1
Query:  145 KKKLYNKHTADFFIVVLAISDLLVCLVIVP-STMAVEY-LTFNISSVFCKGYYFLNISNLLFST---MLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISF-TIGIMVALNVE 480
            ++KL N    +FF++ LA++DLLV L+++P + + V Y  T+ ++   C  + FL++   LFST   M + A++LDRY+ I  P +Q+       K++  +AL+   +IGI + + ++
Sbjct:   42 ERKLQN--ATNFFLMSLAVADLLVGLLVMPIALVTVLYNSTWPLADFLCPIWLFLDV---LFSTASIMHLCAISLDRYIAIKKP-IQHSQFKSRAKVLAKIALVWLISIGIAIPIPIK 153          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ntsr1 (neurotensin receptor 1 (high affinity) [Source:ZFIN;Acc:ZDB-GENE-090313-372])

HSP 1 Score: 49.2914 bits (116), Expect = 5.278e-6
Identity = 34/111 (30.63%), Postives = 57/111 (51.35%), Query Frame = 1
Query:  145 KKKLYN-KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTF-------NISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPF--VQYLTVGRSIKLVMFLALISF 447
            KK L N + T  + +  LAISDLL+ ++ +P    +E   F             CKGYYFL       +   I++++++R++ ICHPF     ++  R+ KL+  + + SF
Sbjct:   81 KKSLQNLQSTVHYHLASLAISDLLILVLCMP----IELYNFIWVHHPWAFGEAVCKGYYFLRDGCSYATAFNIASLSVERFMAICHPFKAKSIMSRSRTKKLISAMWIASF 187          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ntsr1 (neurotensin receptor 1 (high affinity) [Source:ZFIN;Acc:ZDB-GENE-090313-372])

HSP 1 Score: 49.2914 bits (116), Expect = 5.278e-6
Identity = 34/111 (30.63%), Postives = 57/111 (51.35%), Query Frame = 1
Query:  145 KKKLYN-KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTF-------NISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPF--VQYLTVGRSIKLVMFLALISF 447
            KK L N + T  + +  LAISDLL+ ++ +P    +E   F             CKGYYFL       +   I++++++R++ ICHPF     ++  R+ KL+  + + SF
Sbjct:   81 KKSLQNLQSTVHYHLASLAISDLLILVLCMP----IELYNFIWVHHPWAFGEAVCKGYYFLRDGCSYATAFNIASLSVERFMAICHPFKAKSIMSRSRTKKLISAMWIASF 187          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: hcrtr2 (hypocretin (orexin) receptor 2 [Source:ZFIN;Acc:ZDB-GENE-070228-3])

HSP 1 Score: 49.2914 bits (116), Expect = 5.866e-6
Identity = 30/103 (29.13%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYL-TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVE 480
            ++FIV L+ +D+LV +  +P+++ V+   T+      CK   +L   ++  S + +S +A DR+  ICHP     T  R+ K ++ + L+S  + I  A+ +E
Sbjct:   90 NYFIVNLSFADILVTITCLPASLVVDITETWFFGQTLCKILPYLQTISVSVSVLTLSCIAQDRWYAICHPLKFKSTAKRARKSIVLIWLVSCIMMIPQAVVME 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: CU915819.2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 48.9062 bits (115), Expect = 8.759e-6
Identity = 32/107 (29.91%), Postives = 62/107 (57.94%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYLT-FNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTI----GIMVALNVE 480
            + FI+ LAISDLLV +  +P+T+    +T +   S+ CK    +   ++  S   + A+A+DR+ CI +PF Q LT+  +  +++ + +++ +I    G+M+ +  E
Sbjct:   82 NLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTATFIIVIIWVLAVSIMCPSGVMLQVTKE 188          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: HCRTR2 (hypocretin (orexin) receptor 2 [Source:NCBI gene;Acc:100495420])

HSP 1 Score: 57.3806 bits (137), Expect = 2.124e-8
Identity = 32/105 (30.48%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYL-TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVR 486
            ++FIV L+++D+LV ++ +P+T+ V+   T+      CK   +L   ++  S + +S +ALDR+  ICHP +   T  R+ + ++ + ++S  I I  A+ +E R
Sbjct:   88 NYFIVNLSLADVLVTIICLPATLLVDITETWFFGKTLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRAQQSIVIIWIVSCAIMIPQAIVMECR 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: HCRTR2 (hypocretin (orexin) receptor 2 [Source:NCBI gene;Acc:100495420])

HSP 1 Score: 56.9954 bits (136), Expect = 3.121e-8
Identity = 32/105 (30.48%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYL-TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVR 486
            ++FIV L+++D+LV ++ +P+T+ V+   T+      CK   +L   ++  S + +S +ALDR+  ICHP +   T  R+ + ++ + ++S  I I  A+ +E R
Sbjct:   88 NYFIVNLSLADVLVTIICLPATLLVDITETWFFGKTLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRAQQSIVIIWIVSCAIMIPQAIVMECR 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Hcrtr2 (hypocretin (orexin) receptor 2 [Source:MGI Symbol;Acc:MGI:2680765])

HSP 1 Score: 51.2174 bits (121), Expect = 1.466e-6
Identity = 31/103 (30.10%), Postives = 59/103 (57.28%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYL-TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVE 480
            ++FIV L+++D+LV +  +P+T+ V+   T+      CK   +L   ++  S + +S +ALDR+  ICHP +   T  R+   ++ + ++S  I I  A+ +E
Sbjct:   90 NYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVSCIIMIPQAIVME 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Hcrtr2 (hypocretin (orexin) receptor 2 [Source:MGI Symbol;Acc:MGI:2680765])

HSP 1 Score: 51.2174 bits (121), Expect = 1.506e-6
Identity = 31/103 (30.10%), Postives = 59/103 (57.28%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYL-TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVE 480
            ++FIV L+++D+LV +  +P+T+ V+   T+      CK   +L   ++  S + +S +ALDR+  ICHP +   T  R+   ++ + ++S  I I  A+ +E
Sbjct:   90 NYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVSCIIMIPQAIVME 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q18179|NPR11_CAEEL (Putative neuropeptide Y receptor 11 OS=Caenorhabditis elegans OX=6239 GN=npr-11 PE=3 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 6.114e-6
Identity = 29/74 (39.19%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTM-AVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHP 381
            + T +FFI+ LA+SD  VC+V  P+T+  V Y+ +  S   CK    L   N+  ST  I+++A+DRY+ I  P
Sbjct:   71 RTTRNFFILNLALSDFFVCIVTAPTTLYTVLYMFWPFSRTLCKIAGSLQGFNIFLSTFSIASIAVDRYVLIIFP 144          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VNM1|NPFR_DROME (Neuropeptide F receptor OS=Drosophila melanogaster OX=7227 GN=NPFR PE=1 SV=3)

HSP 1 Score: 51.6026 bits (122), Expect = 9.066e-6
Identity = 30/81 (37.04%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  148 KKLYNKHTADFFIVVLAISDLLVCLVIVPSTMA---VEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHP 381
            +K   +   + FI+ LAISDLL+CLV +P T+     +Y  +   S+ CK    L    +  ST+ I+A+A DRY  I +P
Sbjct:  113 RKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYP 193          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUC8 (GCR109 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=gcr109 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 5.447e-54
Identity = 135/366 (36.89%), Postives = 202/366 (55.19%), Query Frame = 1
Query:   31 MPSNEESVSQWQXXXXXXXXXXXXXXXXXXXXXXXXXYKKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMXXXXXXXXXXXHYYAMSNT----KYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKI-KEASIVNSDLNTFQDSGNTVE---------NTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFK 1086
            M SNEES+    + +T+ +L ++ +VG IGN LV++VY+ K  +++   FFI++LA SDL VC+++VP T+ VE   F IS + CK YYFLN SNL+FST+LI  +A DRYL ICHP    L + R+ KLV+FL  IS T GI+  L+V++++ST +                 Y  SNT    K++CDEI H  N+T++Q++FY IVEK NH +Y +SII +I+ YS I +V+++ R +D   K A     D  T     + V          + E+    W++  +                N    +  +         K   R        +QN+RSA++L VV   Y+++F PVL+IV+FK
Sbjct:    1 MVSNEESIPNSHLCVTIILLSVVTVVGAIGNFLVLLVYRNKRRHENNDIFFIIILAASDLAVCIILVPGTIYVELKAFEISEIACKSYYFLNTSNLVFSTLLILVIAFDRYLSICHPLKSILPLARAKKLVIFLFFISVTQGILAMLSVKLKLSTSSPGA--------------YISSNTSIVKKFICDEIKHNLNITKSQMIFYEIVEKSNHFLYTSSIILIILFYSSIFKVIIRFRRKDNCYKFAPHFTDDFTTEYQPKSFVSLPKPRPKYLSPEIETSKWRICCQ----------------NDFKTEFKREHFSNRNTDKKFERSKF-----LQNIRSASLLSVVTGAYVLSFLPVLLIVAFK 331          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A094ZFG1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma haematobium OX=6185 GN=MS3_01343 PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 3.317e-37
Identity = 126/344 (36.63%), Postives = 193/344 (56.10%), Query Frame = 1
Query:  169 TADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISS-VFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMXXXXXXXXXXXHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLNTFQDSGNTVENTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRER----TAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKFSFXXXXXXXXXXXXXXXXXXXCFMNLKFRKEL 1185
            T  FFI+VLA  DL+VC  +VP T  +EY+    S+ ++CK + FLNI N++FS++LI A+AL+RYL ICHP  + LT+ R+  L + LA+     GI+ AL+  + ++ D                      N K  CD      N T  + + Y I++K N   +I SI+SVIILYS ILRVV+K  HR + +   ++N   NT   +   + NT++ N   +  +         T  +  +   L  D ++++      T + + ++S +N+  +   + +RSA++LFVVA+VYII F+P L+  +    FNL+ YN YYLNN +NPLIYCFM+  FRK+L
Sbjct:  116 TPTFFILVLACVDLMVCCFVVPLTFYMEYIHLQPSTDIWCKTHAFLNICNIMFSSLLIIAIALERYLTICHPLRRILTMKRAKYLTLGLAIFCIIYGILGALHHSLGITNDE--------------------PNIKQCCDT-PEIPNATYIEKLTYDILQKGNTASFILSILSVIILYSLILRVVIKT-HRAQ-RYTPVINH--NTIPYNTIIIHNTKMLNRNQRSAISSNDLNNTTTTTTTNDIEHLTNDPHQHQHHRKSLTNRIKMNLSIKNITESTLWREIRSASVLFVVAVVYIIVFTPALLTANKLVQFNLLAYNTYYLNNMSNPLIYCFMSNAFRKKL 434          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A430PX59 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0000479 PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 5.944e-36
Identity = 128/345 (37.10%), Postives = 193/345 (55.94%), Query Frame = 1
Query:  169 TADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISS-VFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMXXXXXXXXXXXHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLNTFQDSGNTVENTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRER-----TAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKFSFXXXXXXXXXXXXXXXXXXXCFMNLKFRKEL 1185
            T  FFI+VLA  DLLVC  +VP T  +EY+    S+ ++CK + FLNI N++FS++LI A+AL+RYL ICHP  + LT+ R+  L + LA+     GI+ AL+  + ++ D                      N K  CD      N T  + + Y I++K N   +I SI+SVIILYS ILRVV+K  HR + +   ++N   NT   +   + NT++ N   +          N T  +  +   L  D +++ +      T + + ++S +N+  +   + +RSA++LFVVA+VYII F+P L+  +    FNL+ YN YYLNN +NPLIYCFM+  FRK+L
Sbjct:  119 TPTFFILVLACVDLLVCCFVVPLTFYMEYIHLQPSTDIWCKTHAFLNICNIMFSSLLIIAIALERYLTICHPLRRILTMKRAKYLTLGLAIFCILYGILGALHHSLGITNDE--------------------PNIKQCCDT-PEIPNATYIEKLTYDILQKGNTASFILSILSVIILYSLILRVVIKT-HRAQ-RYTPVINH--NTIPYNTIIIHNTKMLNRN-QRSAISSNDLNNTTTNTTNDIEHLTNDPHQHHQHHRKSLTNRIKMNLSIKNITESTLWREIRSASVLFVVAVVYIIVFTPALLTANKLVQFNLLAYNTYYLNNMSNPLIYCFMSNAFRKKL 437          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183MEC6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS14401 PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 9.563e-36
Identity = 126/340 (37.06%), Postives = 188/340 (55.29%), Query Frame = 1
Query:  169 TADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISS-VFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMXXXXXXXXXXXHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLNTFQDSGNTVENTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKFSFXXXXXXXXXXXXXXXXXXXCFMNLKFRKEL 1185
            T  FFI+VLA  DL+VC  +VP T  +EY+    S+ ++CK + FLNI N++FS++LI A+AL+RYL ICHP  + LT+ R+  L + LA+     GI+ AL+  + ++ D                      N K  CD      N T  + + Y I++K N   +I SI+SVIILYS ILRVV+K  HR + +   ++N   NT   +   + N ++ N   K  +         T   +   N      N  +  T + + ++S +N+  +   + +RSA++LFVVA+VYII F+P L+  +    FNL+ YN YYLNN +NPLIYCFM+  FRK+L
Sbjct:  118 TPTFFILVLACVDLMVCCFVVPLTFYMEYIHLQPSTDIWCKTHAFLNICNIMFSSLLIIAIALERYLTICHPLRRILTMKRAKYLTLGLAIFCILYGILGALHHSLGITNDE--------------------PNIKQCCD-TPEIPNATYIEKLTYDILQKGNTASFILSILSVIILYSLILRVVIKT-HRAQ-RYTPVINH--NTIPYNTIIIHNAKMLNRNQKSAISSNDLNNTTTNDIEHLTNDPHQHENHRKSLTNRIKMNLSIKNITESTLWREIRSASVLFVVAVVYIIVFTPALLTANKLVQFNLLAYNTYYLNNMSNPLIYCFMSNAFRKKL 432          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A068WA48 (Orexin receptor type 2 OS=Echinococcus granulosus OX=6210 GN=EgrG_000897300 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.048e-35
Identity = 106/307 (34.53%), Postives = 152/307 (49.51%), Query Frame = 1
Query:  169 TADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNIS-SVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVR-VSTDTTHDMXXXXXXXXXXXHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLNTFQDS--GNTVENTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIV 1077
            T DFFI+VLA+SDLLVC+VI+PST+ +E   F IS  V CK +Y L ++N  FS++LISAVALDRYL ICH     LT+ R+  LV  LAL S  +GI     V V+ +  + T D                   T Y+C+E  +   ++  Q     I++ +NH  Y+A I+ V+ILYS +   +V  R R +    S   S  N    S  G +  N+ ++                                   R+R A     + ++   +  T+QN+RSA MLF++ALVYI+ F P L+I 
Sbjct:   88 TLDFFILVLAVSDLLVCVVIIPSTITMEIHQFRISVDVLCKLFYVLFVTNTTFSSLLISAVALDRYLFICHSLKHILTLIRAKILVSTLALFSLCVGIAAGCVVGVKAIHHNATEDNVT----------------TNYICEENEYVRGISELQKTVSQIIKYLNHACYLACILIVLILYSCVFWAIVTSRSRSQKLTVSSQTSRQNGRNSSLQGKSTANSRMS-----------------------------------RQRIANLPAKLRQK---AQFTLQNLRSALMLFIIALVYILTFVPSLVIA 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: npffr1 (neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8106])

HSP 1 Score: 52.7582 bits (125), Expect = 3.778e-7
Identity = 39/118 (33.05%), Postives = 65/118 (55.08%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLT-FNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDM 513
            +   + FI+ LAISDLLV +  +P T+A   +T +    V CK    +  +++  S   + A+A++R+ CI +PF Q LT+ ++I  + F+  ++  I IM    V + VS D  H M
Sbjct:   77 RTVTNIFILNLAISDLLVGIFCLPITLADNLVTGWPFDEVTCKMSGLIQGASVSASVFTLVAIAVERFRCIVYPFQQKLTLRQAIITIAFIWALA--IIIMCPSAVTLTVSHDAFHFM 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 52.7582 bits (125), Expect = 4.177e-7
Identity = 35/115 (30.43%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLT-FNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTI----GIMVALNVEVRVS 492
            +   + FI+ LAISDLLV +  +P+T+    +T +   S+ CK    +   ++  S   +  +A+DR+ CI +PF Q LT+  S  +++ + +++ +I    G+M+ +  E RVS
Sbjct:   86 RTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIVYPFKQKLTISTSTVIIVIIWVLAISIMCPSGVMLQVTKESRVS 200          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: npffr1 (neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8106])

HSP 1 Score: 52.373 bits (124), Expect = 4.489e-7
Identity = 39/118 (33.05%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLT-FNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDM 513
            +   + FI+ LAISDLLV +  +P T+A   +T +    V CK    +  +++  S   + A+A++R+ CI +PF Q LT+ ++I  + F+   +  I IM    V + VS D  H M
Sbjct:   67 RTVTNIFILNLAISDLLVGIFCLPITLADNLVTGWPFDEVTCKMSGLIQGASVSASVFTLVAIAVERFRCIVYPFQQKLTLRQAIITIAFIW--ALAIIIMCPSAVTLTVSHDAFHFM 182          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 52.7582 bits (125), Expect = 4.893e-7
Identity = 35/115 (30.43%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLT-FNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTI----GIMVALNVEVRVS 492
            +   + FI+ LAISDLLV +  +P+T+    +T +   S+ CK    +   ++  S   +  +A+DR+ CI +PF Q LT+  S  +++ + +++ +I    G+M+ +  E RVS
Sbjct:   80 RTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIVYPFKQKLTISTSTVIIVIIWVLAISIMCPSGVMLQVTKESRVS 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: htr2b (5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled [Source:ZFIN;Acc:ZDB-GENE-081022-57])

HSP 1 Score: 51.2174 bits (121), Expect = 1.436e-6
Identity = 40/131 (30.53%), Postives = 75/131 (57.25%), Query Frame = 1
Query:  145 KKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFN----ISSVFCKGYYFLNISNLLFST---MLISAVALDRYLCICHPF--VQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHD 510
            ++KL N    ++F++ LA++DLLV L+++P  +A+  + FN    +    C  + FL++   LFST   M + A++LDRY+ I  P    QY +  +++  +  + LIS  IGI + + ++   S+D  ++
Sbjct:   59 ERKLQN--ATNYFLMSLAVADLLVGLLVMP--IALVTVLFNSGWPLPEFLCPIWLFLDV---LFSTASIMHLCAISLDRYIAIKKPIQHSQYKSRAKALAKIALVWLIS--IGIAIPIPIKGLKSSDHPNN 180          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ntsr1 (neurotensin receptor 1 (high affinity) [Source:ZFIN;Acc:ZDB-GENE-090313-372])

HSP 1 Score: 51.2174 bits (121), Expect = 1.562e-7
Identity = 36/124 (29.03%), Postives = 65/124 (52.42%), Query Frame = 1
Query:  169 TADFFIVVLAISDLLVCLVIVPSTMAVEYLTF-------NISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVG---RSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHD 510
            TA + +V +A SDLL  ++ +P    VE   F           + C+GYY+L  S    + + I++++++RYL +CHP  + +TV    R+ +LV  +   SF + + +AL +  +V  +  H 
Sbjct:   82 TAHYHLVSMAASDLLTLMLGLP----VELYNFIWVHDQWAFGDLGCRGYYYLRDSCTYATVLNITSLSVERYLAVCHPL-RAMTVASPRRTRRLVAAVWFTSFLLALPMALVMGQQVYVERRHG 200          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004593.1 (pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1 gene:ENSPMAG00000004184.1 transcript:ENSPMAT00000004593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 5.090e-6
Identity = 37/116 (31.90%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  145 KKKLYNKHTADFFIVVLAISDLLVCLVIVP-STMAVEY-LTFNISSVFCKGYYFLNISNLLFST---MLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNV 477
            +KKL  +   ++F++ LA++DLLV L ++P S + + Y + + +    C  + FL++   LFST   M + A++LDRY+ I  P        RS  L+   A+ + +IGI   + V
Sbjct:   32 EKKL--QTATNYFLMSLAVADLLVGLTVMPISVINILYNMRWPLPCEMCPVWVFLDV---LFSTASIMHLCAISLDRYIAIKRPIQHSRFNSRSKTLLKITAVWAISIGIASPIPV 142          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO47535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM40])

HSP 1 Score: 53.1434 bits (126), Expect = 7.632e-8
Identity = 33/94 (35.11%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  151 KLYNKHTADFFIVVLAISDLLVCLVIVPSTM---AVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLV 423
            + Y K T +F IV +AI+DLLV ++++P        ++++  I SV CK   F    ++  S + + A++LDRY  I HPF ++L + R+ KL+
Sbjct:   19 RAYMKTTFNFLIVNMAIADLLVSVMVMPLQFLYYGQQWISDWIGSVTCKWVNFSGTLSITASIIALVAISLDRYFAIIHPF-KHLPIIRNTKLI 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH9])

HSP 1 Score: 49.6766 bits (117), Expect = 9.311e-7
Identity = 31/103 (30.10%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  145 KKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTF--NISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISF 447
            +KK+  K   ++FI+ LA++DL +  + +P  + V+ + +     +V CK  Y L    L  S   ++AV+L RY  I HP  + L+V ++  LV+ + ++S 
Sbjct:   63 RKKM--KTVTNYFILNLAVADLALTCICIPFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLSVSKAKTLVIAIWVLSL 163          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO40944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Q4])

HSP 1 Score: 49.2914 bits (116), Expect = 1.156e-6
Identity = 29/96 (30.21%), Postives = 52/96 (54.17%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTMAVEYL--TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALIS 444
            K   ++F++ LAI+DL +  + +P  + V+ +   +      CK  Y L   +L  S   ++AV+L RY  I HP  Q L+V  S ++++ + +IS
Sbjct:   25 KTVTNYFVLNLAIADLALTCICIPFDIPVQEMNYVWPYGGFMCKILYPLQTLSLFASVFTLTAVSLTRYWAIVHPLRQQLSVSNSKRIIVAIWVIS 120          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO27481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T950])

HSP 1 Score: 48.9062 bits (115), Expect = 1.676e-6
Identity = 31/103 (30.10%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  145 KKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTF--NISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISF 447
            +KK+  K   ++FI+ LA++DL +  + +P  + V+ + +     +V CK  Y L    L  S   ++AV+L RY  I HP  + L+V ++  LV+ + ++S 
Sbjct:   31 RKKM--KTVTNYFILNLAVADLALTCICIPFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLSVSKAKTLVIAIWVLSL 131          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH8])

HSP 1 Score: 48.521 bits (114), Expect = 2.030e-6
Identity = 31/102 (30.39%), Postives = 55/102 (53.92%), Query Frame = 1
Query:  145 KKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTF--NISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALIS 444
            +KK+  K   ++FI+ LA++DL +  + +P  + V+ + +     +V CK  Y L    L  S   ++AV L RY  I HP  + L++ +S  ++ F+ L S
Sbjct:   35 RKKM--KTVTNYFILNLAVADLALTCICIPFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVGLTRYWAIVHPMKRQLSITQSKLVIAFIWLGS 134          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:101174760])

HSP 1 Score: 54.6842 bits (130), Expect = 1.166e-7
Identity = 37/119 (31.09%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLT-FNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTI----GIMVALNVE--VRVSTD 498
            +   + FI+ LAISDLLV +  +P+T+    +T +   S+ CK    +   ++  S   + A+A+DR+ CI +PF Q LT+G S  +++ + +++  I    G+M+ +  E  VR+  D
Sbjct:   77 RTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSIVCKLSGMVQGISVSASVFTLVAIAVDRFRCIVYPFRQKLTIGTSKMIIVIIWVLALFIMCPSGVMLQVTEEPTVRIVVD 195          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:101174760])

HSP 1 Score: 53.9138 bits (128), Expect = 1.557e-7
Identity = 37/119 (31.09%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  163 KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLT-FNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTI----GIMVALNVE--VRVSTD 498
            +   + FI+ LAISDLLV +  +P+T+    +T +   S+ CK    +   ++  S   + A+A+DR+ CI +PF Q LT+G S  +++ + +++  I    G+M+ +  E  VR+  D
Sbjct:   76 RTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSIVCKLSGMVQGISVSASVFTLVAIAVDRFRCIVYPFRQKLTIGTSKMIIVIIWVLALFIMCPSGVMLQVTEEPTVRIVVD 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ntsr1 (neurotensin receptor 1 [Source:NCBI gene;Acc:105354415])

HSP 1 Score: 51.6026 bits (122), Expect = 8.302e-7
Identity = 34/110 (30.91%), Postives = 63/110 (57.27%), Query Frame = 1
Query:  145 KKKLYN-KHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVF----CKGYYFLNISNLLFSTMLISAVALDRYLCICHPF--VQYLTVGRSIKLVMFLALISFTI 453
            KK L N + T  + +  LA+SDLL+ ++ +P  +   ++  +   VF    C+GY+FL  S    + + I++++++RY+ ICHPF     ++  R+ KL+  + L SF +
Sbjct:   78 KKSLQNLQSTVHYHLASLAVSDLLILIISMPIEI-YNFIWVHHPWVFGDAVCRGYFFLRDSCSYATALNIASLSVERYMAICHPFKAKSIMSRSRTKKLISAMWLASFAL 186          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: hcrtr2 (hypocretin receptor 2 [Source:NCBI gene;Acc:101170456])

HSP 1 Score: 51.2174 bits (121), Expect = 1.370e-6
Identity = 32/111 (28.83%), Postives = 63/111 (56.76%), Query Frame = 1
Query:  160 NKH---TADFFIVVLAISDLLVCLVIVPSTMAVEYL-TFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVE 480
            N+H     ++FIV L+ +D+LV ++ +P+++ V+   T+   +  CK   +L   ++  S + +S +A DR+  ICHP +   T  R+ K ++ + ++S  I I  A+ +E
Sbjct:   76 NRHMRTVTNYFIVNLSFADVLVTIICLPASLVVDITETWFFGNTLCKVVPYLQTISVCVSVLTLSCIAQDRWYAICHPLMFKSTARRARKSIVAIWVVSCIIMIPQAIVME 186          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042596.1 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:101169169])

HSP 1 Score: 50.0618 bits (118), Expect = 2.875e-6
Identity = 34/112 (30.36%), Postives = 65/112 (58.04%), Query Frame = 1
Query:  175 DFFIVVLAISDLLVCLVIVPSTMAVEYLT-FNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTI----GIMVALNVE--VRV 489
            + FI+ LA+SDLLV +  +P+T+    +T +   S+ CK    +   ++  S   + A+A+DR+ CI +PF Q LT+  +  +++ + +++ +I    G+M+ +  E  VRV
Sbjct:  128 NLFILNLAVSDLLVGIFCMPTTLLDNIITGWPFGSLVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTATMIIVIIWVLAVSIMCPSGVMLQVTKEHTVRV 239          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000029598.1 (SMESG000029598.1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 380/400 (95.00%), Postives = 381/400 (95.25%), Query Frame = 1
Query:   31 MPSNEESVSQWQXXXXXXXXXXXXXXXXXXXXXXXXXYKKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMXXXXXXXXXXXHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLNTFQDSGNTVENTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKFSFXXXXXXXXXXXXXXXXXXXCFMNLKFRKELANVFLRRSYGNNVDF 1230
            MPSNEESVSQWQILITLAILGIIGIVGGIGNALVIVVYKKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVFCK                  AVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMSISNSSDFSISHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLNTFQDSGNTVENTEVTNEMW+VKLKPKPKPRNRTPKSKRNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKFSFNLILYNLYYLNNAANPLIYCFMN KFRKELANVFLRRSYGNNVDF
Sbjct:    1 MPSNEESVSQWQILITLAILGIIGIVGGIGNALVIVVYKKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVFCK------------------AVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMSISNSSDFSISHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLNTFQDSGNTVENTEVTNEMWRVKLKPKPKPRNRTPKSKRNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKFSFNLILYNLYYLNNAANPLIYCFMNSKFRKELANVFLRRSYGNNVDF 382          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000064085.1 (SMESG000064085.1)

HSP 1 Score: 192.971 bits (489), Expect = 2.896e-57
Identity = 137/370 (37.03%), Postives = 206/370 (55.68%), Query Frame = 1
Query:   31 MPSNEESVSQWQXXXXXXXXXXXXXXXXXXXXXXXXXYKKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMXXXXXXXXXXXHYYAMSNT----KYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDK-IKEASIVNSDLNTFQDSGNTVE---------NTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVT----IQNMRSAAMLFVVALVYIIAFSPVLMIVSFK 1086
            M SNEES+    + +T+ +L  + +VG IGN LV++VY+ K  +++   FFI++LA SDL VC+++VP T+ VE   F IS + CK YYFLN SNL+FST+LI  +A DRYL ICHP    L + R+ KLV+FL  IS T GI+  L+V++++ST +                 Y  SNT    K++CDEI H  N+T++Q++FY IVEK NH +Y +SII +I+ YS I +V+++ R +D   K A     D  T     + V          + E+    W++                           +N  +T  K++ +S +N          +QN+RSA++L VV   Y+++F PVL+IV+FK
Sbjct:    1 MVSNEESIPNSHLCVTIILLSFVTVVGAIGNFLVLLVYRNKRRHENNDIFFIIILAASDLAVCIILVPGTIYVELKAFEISEIACKSYYFLNTSNLVFSTLLILVIAFDRYLSICHPLKSILPLARAKKLVIFLFFISVTQGILAMLSVKLKLSTSSPGT--------------YISSNTSIVKKFICDEIKHNLNITKSQMIFYEIVEKSNHFLYTSSIILIILFYSSIFKVIIRFRRKDNYYKFAPHFTDDFTTEYQPKSFVSLPKPRPKYLSPEIETSKWRICC-------------------------QNDFKTEFKREHLSNRNTDKKFERSKFLQNIRSASLLSVVTGAYVLSFLPVLLIVAFK 331          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078101.1 (SMESG000078101.1)

HSP 1 Score: 154.836 bits (390), Expect = 1.433e-42
Identity = 133/360 (36.94%), Postives = 198/360 (55.00%), Query Frame = 1
Query:  160 NKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTI----GIMVALNVEVRVSTDTTHDMXXXXXXXXXXXHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKI------KEASIVNS-DLNTFQDSGNTVENTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFK-FSFXXXXXXXXXXXXXXXXXXXCFMNLKFRKELANVFLR 1203
            N  T  FFI  LA+SDL+VCLVIVP TM+ E+  F+IS  FCK YYF+N +NLLFSTMLI+ +A+DR LCI  P  + LTV ++  +++ L L+S  +      +V  N  +  ST                     +     VC+EI    NV    L++Y + E+I H+V+I SII+VII Y+ +   ++KIR R+K       +E+    S D++T  ++ ++     +                                           +KS++ Q L  +   +N++SAA+LFVVA+VYI+ F+PV++I++FK   FN+ILYNLYYLNNAANP++YCFMN  FR++L+ +F R
Sbjct:   52 NNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKIMMLILLLLSIILGIMGATLVGQNPHIHNST---------------------VPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTP----------------------------------------RKSLA-QGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVILYNLYYLNNAANPIVYCFMNSNFRRDLSKLFRR 349          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000064403.1 (SMESG000064403.1)

HSP 1 Score: 130.954 bits (328), Expect = 5.546e-34
Identity = 111/352 (31.53%), Postives = 181/352 (51.42%), Query Frame = 1
Query:  142 YKKKLYNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVF-CKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMXXXXXXXXXXXHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLNTFQDSGNTVENTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKFSFXXXXXXXXXXXXXXXXXXXCFMNLKFRKELANV 1194
            Y +K +++ T   FI +LAI+D   C+ I+P T+ +EY  + ISS F CK YYF N   + FS  LIS +A+DRY+CICHPF +++T+ +S   V  +  +S  +GI     V++                     H   ++N+ Y C +I    N T  + +F++IV+KI    Y   II VI LY  I   V++ R +  I +        +   +S + + N    +E     +K        +       +K  + + K   R       +S +++      QN R+AAML VVAL+YII+F P  +++++     + L+ +YY+NNAANP+IYCFMN +FR+++  +
Sbjct:   47 YTRK-HDQLTTTLFINILAITDCFTCITIIPMTIYIEYWEWGISSAFLCKLYYFFNNCTIPFSAFLISLIAIDRYICICHPFNKFMTLFKSKVSVGLVLTVSVLLGIASTFQVKM-----------------IKGIHPNDLTNS-YECADISKLTNTTTTEKLFFSIVQKIQLLSYTTCIILVICLYVAIYCKVLQTRRKKSILKGIKNVKKPSYLWESRSNLTNVPDLDE---NPIKLPDGDTMLSSAKSTPNSKSFLTVPKPEHR------RVSLRSICDTQIFQNFRTAAMLSVVALMYIISFLPAFLMINYPQILYIPLFYMYYINNAANPIIYCFMNARFREDIKAI 370          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000030128.1 (SMESG000030128.1)

HSP 1 Score: 130.183 bits (326), Expect = 1.069e-33
Identity = 113/355 (31.83%), Postives = 191/355 (53.80%), Query Frame = 1
Query:  160 NKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNIS-SVFCKGYYFLNISNLLFSTMLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEV-RVSTDTTHDMXXXXXXXXXXXHYYAMSNT--KYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILR-VVVKIRHRDKIK---EASIVNSDLNTFQDSGNTVE-NTEVTNEMWXXXXXXXXXXXXXXXXXXXNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKFSFXXXXXXXXXXXXXXXXXXXCFMNLKFRKELANVF 1197
            +K TA+ FI  LAISD +VCLVI+P T+ +E+  + +S  + CK YYFLN S++ F  +LI+ +A+DR+ C+C+PF+  +TV RS   V  + ++S  +G++    V+  ++S ++T+                 M++T  +  C ++  + N T+ +L+F+TIV++     Y   I  VI LY  I R V+   R + ++K    +S  +   N F  S +    N++  N+                        + LM     +   +   K++ R+     + IQN ++A MLFVVA+ YI+ F P  ++V+   + NL ++ +YY+NNAANP+IYCFMN  FR+++ N F
Sbjct:   42 DKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFMMSVVLGVLSVFQVKTFKLSKNSTN-----------------MNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIKRINSDSNND---------------DTSVPCQTTEELM----TKPGPSNNDKAIKRK-FKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFF 359          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
HCRTR22.420e-630.10hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC... [more]
HCRTR22.420e-630.10hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
npr-114.806e-739.19Putative neuropeptide Y receptor 11 [Source:UniPr... [more]
npr-104.127e-632.35NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-104.233e-632.35NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
frpr-35.547e-627.35FMRFamide Peptide Receptor family; VRFamide recept... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPFR8.145e-737.04gene:FBgn0037408 transcript:FBtr0308316[more]
NPFR8.687e-737.04gene:FBgn0037408 transcript:FBtr0308317[more]
NPFR8.701e-737.04gene:FBgn0037408 transcript:FBtr0308318[more]
NPFR9.044e-737.04gene:FBgn0037408 transcript:FBtr0078590[more]
CapaR2.347e-631.78gene:FBgn0037100 transcript:FBtr0078379[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr2b4.038e-632.205-hydroxytryptamine (serotonin) receptor 2B, G pro... [more]
ntsr15.278e-630.63neurotensin receptor 1 (high affinity) [Source:ZFI... [more]
ntsr15.278e-630.63neurotensin receptor 1 (high affinity) [Source:ZFI... [more]
hcrtr25.866e-629.13hypocretin (orexin) receptor 2 [Source:ZFIN;Acc:ZD... [more]
CU915819.28.759e-629.91neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
HCRTR22.124e-830.48hypocretin (orexin) receptor 2 [Source:NCBI gene;A... [more]
HCRTR23.121e-830.48hypocretin (orexin) receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hcrtr21.466e-630.10hypocretin (orexin) receptor 2 [Source:MGI Symbol;... [more]
Hcrtr21.506e-630.10hypocretin (orexin) receptor 2 [Source:MGI Symbol;... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q18179|NPR11_CAEEL6.114e-639.19Putative neuropeptide Y receptor 11 OS=Caenorhabdi... [more]
sp|Q9VNM1|NPFR_DROME9.066e-637.04Neuropeptide F receptor OS=Drosophila melanogaster... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUC85.447e-5436.89GCR109 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A094ZFG13.317e-3736.63G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A430PX595.944e-3637.10G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183MEC69.563e-3637.06G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A068WA482.048e-3534.53Orexin receptor type 2 OS=Echinococcus granulosus ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr13.778e-733.05neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GE... [more]
npffr2b4.177e-730.43neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npffr14.489e-733.05neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GE... [more]
npffr2b4.893e-730.43neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
htr2b1.436e-630.535-hydroxytryptamine (serotonin) receptor 2B, G pro... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ntsr11.562e-729.03neurotensin receptor 1 (high affinity) [Source:ZFI... [more]
ENSPMAT00000004593.15.090e-631.90pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475357.632e-835.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364539.311e-730.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409441.156e-630.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274811.676e-630.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364732.030e-630.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr2b1.166e-731.09neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npffr2b1.557e-731.09neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
ntsr18.302e-730.91neurotensin receptor 1 [Source:NCBI gene;Acc:10535... [more]
hcrtr21.370e-628.83hypocretin receptor 2 [Source:NCBI gene;Acc:101170... [more]
ENSORLT00000042596.12.875e-630.36neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029598.10.000e+095.00SMESG000029598.1[more]
SMESG000064085.12.896e-5737.03SMESG000064085.1[more]
SMESG000078101.11.433e-4236.94SMESG000078101.1[more]
SMESG000064403.15.546e-3431.53SMESG000064403.1[more]
SMESG000030128.11.069e-3331.83SMESG000030128.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029661 ID=SMED30029661|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1313bp
CGAAAATCAAATCAGTTTCTTTTTTAAAAGATGCCCAGCAACGAAGAATC
AGTTTCTCAATGGCAAATTCTCATTACTTTAGCTATATTAGGAATTATTG
GTATTGTAGGAGGCATTGGGAATGCTCTAGTGATTGTTGTCTATAAGAAA
AAACTCTACAACAAACACACAGCCGATTTCTTCATTGTTGTTTTAGCGAT
TTCAGATTTATTAGTTTGTCTTGTTATTGTTCCCAGTACGATGGCAGTTG
AATATTTGACATTCAACATTTCATCGGTCTTTTGTAAAGGTTATTATTTC
TTGAATATTTCGAATTTACTATTTAGTACGATGCTCATTTCAGCCGTTGC
CCTTGATAGGTACCTTTGTATTTGTCATCCTTTCGTGCAGTATTTAACGG
TTGGAAGATCTATTAAACTTGTCATGTTTCTTGCATTAATATCATTCACA
ATTGGAATTATGGTAGCATTAAATGTTGAAGTTCGTGTCTCGACCGACAC
GACTCATGACATGTCGATTTCGAACTCTTCTGATTTCTCAATCTCTCATT
ACTATGCAATGTCAAATACGAAATATGTCTGCGATGAAATTATACATTTC
AATAACGTTACAAGAGCGCAATTAGTGTTCTATACAATCGTTGAAAAGAT
AAATCATACGGTTTATATTGCATCAATTATATCGGTCATCATCCTCTATT
CCTTCATTCTTAGAGTCGTCGTGAAAATTCGGCACCGAGACAAGATTAAA
GAAGCGTCAATAGTGAATTCCGATTTGAATACGTTTCAGGATAGCGGGAA
CACTGTTGAAAACACAGAGGTAACTAATGAAATGTGGAAAGTGAAACTGA
AACCGAAACCAAAACCGAGAAATAGAACTCCGAAGTCCAAACGAAATTAT
AACAAATTGCTGATGGATATCAATAAGAACCGTGAAAGAACTGCTAAAAA
GCAAAAAAGTATGTCAAGACAAAACCTGGTGAGTAACGTCACGATTCAGA
ACATGAGGTCAGCAGCGATGCTTTTTGTCGTCGCCCTCGTCTACATAATC
GCCTTTTCTCCGGTTTTAATGATTGTCAGTTTCAAATTCAGTTTCAATTT
GATATTATACAATTTGTATTATTTAAACAACGCTGCAAATCCGTTAATTT
ATTGTTTCATGAATTTGAAATTCCGGAAAGAACTGGCAAATGTTTTCCTT
CGCAGATCGTATGGAAATAATGTCGACTTTTAGATCTTTTTGGAACTCAA
AAGTTTTGGGAGGATTATTTACAATAGATTTGATAATTTAATTTTTATTT
AATTTTAATAGCG
back to top

protein sequence of SMED30029661-orf-1

>SMED30029661-orf-1 ID=SMED30029661-orf-1|Name=SMED30029661-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=401bp
MPSNEESVSQWQILITLAILGIIGIVGGIGNALVIVVYKKKLYNKHTADF
FIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVFCKGYYFLNISNLLFST
MLISAVALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVE
VRVSTDTTHDMSISNSSDFSISHYYAMSNTKYVCDEIIHFNNVTRAQLVF
YTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKIKEASIVNSDLN
TFQDSGNTVENTEVTNEMWKVKLKPKPKPRNRTPKSKRNYNKLLMDINKN
RERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVS
FKFSFNLILYNLYYLNNAANPLIYCFMNLKFRKELANVFLRRSYGNNVDF
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 356..382
score: 32.99
coord: 327..351
score: 17.47
coord: 48..69
score: 33.66
coord: 92..114
score: 26.64
coord: 15..39
score: 26.62
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 30..374
e-value: 1.1E-20
score: 74.0
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 98..114
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 3..389
e-value: 2.2E-47
score: 163.7
NoneNo IPR availablePANTHERPTHR24230G-PROTEIN COUPLED RECEPTORcoord: 9..397
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 31..378
e-value: 8.31706E-19
score: 83.481
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 8..393
NoneNo IPR availableTMHMMTMhelixcoord: 355..377
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 87..109
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 329..351
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
NoneNo IPR availableTMHMMTMhelixcoord: 209..231
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 30..374
score: 25.467