Polypeptide N-acetylgalactosaminyltransferase

Overview
NamePolypeptide N-acetylgalactosaminyltransferase
Smed IDSMED30029643
Length (bp)1938
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30029643) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30029643) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30029643) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30029643) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029643

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30029643SMESG000011837.1 dd_Smed_v4_6094_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029643SMESG000011837.1 dd_Smed_v4_6094_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029643SMESG000011837.1 dd_Smed_v4_6094_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029643SMESG000011837.1 SMESG000056433.1 OX_Smed_1.0.10563ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4123])

HSP 1 Score: 343.584 bits (880), Expect = 6.047e-110
Identity = 190/528 (35.98%), Postives = 306/528 (57.95%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E ++    G GE G+ V +  +++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP NLPT SV+I F+NE W TLLRT+HSV+NRSP   + EI+LVDD S ++ ++  + +Y++  + P   V V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+ISSR+ LR+ LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 EPVQKPHEGPGEMGKPVVIPKEDQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 334.724 bits (857), Expect = 1.580e-106
Identity = 188/523 (35.95%), Postives = 302/523 (57.74%), Query Frame = 3
Query:  228 NRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYH-GLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            N+ G GE G+AV +   ++  MK E+ KI   N   S  I+L+RSLPD R + CK+K YP  LP  SV+I F+NE W TLLRT++SV+NRSP   L E+ILVDD S ++ +++ + NY++N E P   VK+ R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +         +    N++R+ +VW+D++K  FY+  P + + + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   +   QLW Y+ E  +L ++   QCLD  + ++    T+Q C  S   Q+W
Sbjct:   53 NQEGPGEMGKAVLIPKDDQEKMK-ELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVP---VKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP-RRYYSLGEIRNVETNQCLDNMGRKE----NEKVGIFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVIMLKC-HHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 320.472 bits (820), Expect = 6.019e-101
Identity = 184/524 (35.11%), Postives = 297/524 (56.68%), Query Frame = 3
Query:  228 NRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYH-GLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDR-VTIQPCESSNPYQEW 1784
            N+ G GE G+AV +   ++  MK E+ KI   N   S  I+L+RSLPD R + CK+K YP  LP  SV+I F+NE W TLLRT++SV+NRSP   L E+ILVDD S ++ +++ + NY++N E P   VK+ R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +         +    N++R+ +VW+D++K  FY+  P + + + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N CLD + + E    N   G+++C  G    Q+FS +  K               +IR +  CL  ++ NG V  + C   +   QLW Y+ E+          CL  + + +  +  T++ C  S   Q+W
Sbjct:   53 NQEGPGEMGKAVLIPKDDQEKMK-ELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVP---VKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP-RRYYSLGEIRNVETNQCLDNMGRKE----NEKVGIFNCH-GMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVIMLKC-HHMRGNQLWEYDAES----------CLSVNKVADGSQHPTVETCNDST-LQKW 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT3 (polypeptide N-acetylgalactosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:4125])

HSP 1 Score: 320.087 bits (819), Expect = 5.072e-100
Identity = 190/534 (35.58%), Postives = 293/534 (54.87%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSL-PDFRSDECKSKNYPQ--NLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGS------FWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPE----LREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCV-----TELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
             +G+  +  NL+ +E+   +    K  ++   S RISLHR L PD R  EC  + + +   LPT SVII F+NE W TLLRT+HSV+  SP   L+EIILVDD S+ E +   +  Y++      IVK+ R  +R G + ++L GA +A    + FLD+H E   GWLEP+L R++ NY + V P +  ID+ TF F   +K   +GS      F W++ FGW+ +P H ++ R+  + PIKT T   G+F+ ++  F  +GS+D E+  +G EN+E+SFRVW CGG LEI+PCS +GH+   +S             N  R+ +VW+D+YK +FY    +    +++   G++S R ++++ LQCK+F W++ N+ PE ++PD N +  GY+K+    LCLD+    E ++G     +Y+C +G    Q F  S         ++I+ N    I++E  CL A +  G V    C      T +   Q+W   K+   L N   K CL A    N +  ++  C  S+P Q+W
Sbjct:  123 ASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQ---FSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEF---NKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDV---GENNQGGKPLIMYTC-HGLGGNQYFEYSA-------QHEIRHN----IQKEL-CLHAAQ--GLVQLKACTYKGHKTVVTGEQIWEIQKDQ-LLYNPFLKMCLSA----NGEHPSLVSCNPSDPLQKW 627          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT6 (polypeptide N-acetylgalactosaminyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:4128])

HSP 1 Score: 307.76 bits (787), Expect = 2.447e-95
Identity = 176/498 (35.34%), Postives = 277/498 (55.62%), Query Frame = 3
Query:  330 VSKRISLHRSL-PDFRSDECKSKNYPQNLP--TASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFK---NRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFY---LYRPEL-REANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNN---GKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
             S RISL RSL PD R  EC  + + +  P  T SVII F+NE W TLLRT++SV++ +P   L+EIILVDD S +E ++  +  Y++      +V+V R E+R G + ++L GA +A   V+ FLD+H E   GWLEP+L R++ +    V P ++ ID+ TF F     R ++   G+F W++ FGW+ +P H ++ R+  + PIK+ T   G+F+ ++  F ++G++D ++  +G EN+E+SFRVW CGG LEI+PCS +GH+   +S             N  R+ +VW+D YK++FY   L   ++ +E + G+IS R++LR  L C +F W++ NV PE F+PD     YG +KN  +N CLD+    E +RG     +YSC +G    Q F         +   D++ N   Q+     CL  +K     G   F    +++ + + W   ++   + N     CL + + K      + PC  S+P+Q W
Sbjct:  146 ASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQL---QVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDV---GENNRGGKPLIMYSC-HGLGGNQYF-------EYTTQRDLRHNIAKQL-----CLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQ-LIRNSGSGTCLTSQDKKP----AMAPCNPSDPHQLW 619          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-9 (Probable N-acetylgalactosaminyltransferase 9 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2C4])

HSP 1 Score: 377.867 bits (969), Expect = 2.799e-123
Identity = 205/524 (39.12%), Postives = 304/524 (58.02%), Query Frame = 3
Query:  231 RRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYP-QNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHI---AHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKN--SKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            R G GE G+ V LT K+    + ++ K   +   S +ISL R +PD R   CK   Y    LP  SVII F +E W  LLRT+HSV+NRSPP+ L+E+IL+DD S ++ +Q  +  +I+     G V++ R   R+G +++KL GA+ A+G++I+FLDSH E   GWLEPI+ R+S    + V P++  I   T A+     L   G F W + F W+ + +  QK R   +D I++ T+  G+ AANR  FF +G +D E+  +G ENLE+SFR WMCGG +E +PCS +GHI    H  +   R +NKD HG NSKR+ +VW+DDYKRL+Y++R +LR  + G++++R +LR  L CK F WF+ N+   KFI D +++ YG +    S + +C D L ++E  + +   GV+ CQ   SS Q+ SLS            K  N   +RRE  C  A++ NG +   TC  +    + W Y  EN  + NLK  +C+  +NLK  D   +  C+  + +Q+W
Sbjct:   72 REGPGEKGKPVVLTGKDAELGQADMKKWFMNVHASDKISLDRDVPDPRIQACKDIKYDYAALPKTSVIIIFTDEAWTPLLRTVHSVINRSPPELLQEVILLDDNSKRQELQEPLDEHIKRF--GGKVRLIRKHVRHGLIRAKLAGAREAVGDIIVFLDSHCEANHGWLEPIVQRISDERTAIVCPMIDSISDNTLAYHGDWSLST-GGFSWALHFTWEGLSEEEQKRRTKPTDYIRSPTMAGGLLAANREYFFEVGGYDEEMDIWGGENLEISFRAWMCGGSIEFIPCSHVGHIFRAGHPYNMTGRNNNKDVHGTNSKRLAEVWMDDYKRLYYMHREDLRTKDVGDLTARHELRKRLNCKPFKWFLDNIAKGKFIMDEDVVAYGALHTVVSGTRMCTDTLQRDE--KMSQLLGVFHCQGKGSSPQLMSLS------------KEGN---LRRENTC--ASEENGNIRMKTCSKKAQFNERWAY--ENKMIRNLKSGKCMSTANLKPGDNAIVVECDEKDEHQKW 571          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 327.405 bits (838), Expect = 3.060e-103
Identity = 189/524 (36.07%), Postives = 287/524 (54.77%), Query Frame = 3
Query:  240 AGENGQAV-----NLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKN-RHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNS--KSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWE 1787
            AGE G+AV      L+ +EK      +L   ++   S  IS+HR+LP     ECK++ Y +NLP  SVII F+NE W  LLRT+HSV+ R+P   L E++LVDDFS  +  +  +  Y+      G VK+ R EKR G ++++L GA +A G V+ +LDSH E  +GW+EP+LDR+  +  + V PV+  ID  TF + + +      G F W + F W  +P+  +K R    DP+++ T+  G+F+ ++  F  +G++D     +G ENLELSF++WMCGG LEI+PCS +GH+   RS    ++  +    NS R+ +VWLDDYK  +Y  R   +  + G+ISSR KLR  L CKSF W++ N+ PE F+P  ++   G V+NS  +   CLD +V       N   G Y C +G    Q + LS                  +IRR+  C+    ++  V    C   +   Q W YN + G L +   ++CL  +  K+  ++ +  C+  +PYQ W+
Sbjct:  112 AGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQF--GGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYK-TYYYERINNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESV-AKGEVRNSAVQPARCLDCMVGRH--EKNRPVGTYQC-HGQGGNQYWMLS---------------KDGEIRRDESCVDYAGSD--VMVFPC-HGMKGNQEWRYNHDTGRLQHAVSQKCLGMT--KDGAKLEMVACQYDDPYQHWK 608          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 327.405 bits (838), Expect = 3.060e-103
Identity = 189/524 (36.07%), Postives = 287/524 (54.77%), Query Frame = 3
Query:  240 AGENGQAV-----NLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKN-RHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNS--KSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWE 1787
            AGE G+AV      L+ +EK      +L   ++   S  IS+HR+LP     ECK++ Y +NLP  SVII F+NE W  LLRT+HSV+ R+P   L E++LVDDFS  +  +  +  Y+      G VK+ R EKR G ++++L GA +A G V+ +LDSH E  +GW+EP+LDR+  +  + V PV+  ID  TF + + +      G F W + F W  +P+  +K R    DP+++ T+  G+F+ ++  F  +G++D     +G ENLELSF++WMCGG LEI+PCS +GH+   RS    ++  +    NS R+ +VWLDDYK  +Y  R   +  + G+ISSR KLR  L CKSF W++ N+ PE F+P  ++   G V+NS  +   CLD +V       N   G Y C +G    Q + LS                  +IRR+  C+    ++  V    C   +   Q W YN + G L +   ++CL  +  K+  ++ +  C+  +PYQ W+
Sbjct:  112 AGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQF--GGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYK-TYYYERINNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESV-AKGEVRNSAVQPARCLDCMVGRH--EKNRPVGTYQC-HGQGGNQYWMLS---------------KDGEIRRDESCVDYAGSD--VMVFPC-HGMKGNQEWRYNHDTGRLQHAVSQKCLGMT--KDGAKLEMVACQYDDPYQHWK 608          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 327.405 bits (838), Expect = 3.060e-103
Identity = 189/524 (36.07%), Postives = 287/524 (54.77%), Query Frame = 3
Query:  240 AGENGQAV-----NLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKN-RHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNS--KSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWE 1787
            AGE G+AV      L+ +EK      +L   ++   S  IS+HR+LP     ECK++ Y +NLP  SVII F+NE W  LLRT+HSV+ R+P   L E++LVDDFS  +  +  +  Y+      G VK+ R EKR G ++++L GA +A G V+ +LDSH E  +GW+EP+LDR+  +  + V PV+  ID  TF + + +      G F W + F W  +P+  +K R    DP+++ T+  G+F+ ++  F  +G++D     +G ENLELSF++WMCGG LEI+PCS +GH+   RS    ++  +    NS R+ +VWLDDYK  +Y  R   +  + G+ISSR KLR  L CKSF W++ N+ PE F+P  ++   G V+NS  +   CLD +V       N   G Y C +G    Q + LS                  +IRR+  C+    ++  V    C   +   Q W YN + G L +   ++CL  +  K+  ++ +  C+  +PYQ W+
Sbjct:  112 AGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQF--GGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYK-TYYYERINNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESV-AKGEVRNSAVQPARCLDCMVGRH--EKNRPVGTYQC-HGQGGNQYWMLS---------------KDGEIRRDESCVDYAGSD--VMVFPC-HGMKGNQEWRYNHDTGRLQHAVSQKCLGMT--KDGAKLEMVACQYDDPYQHWK 608          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 326.635 bits (836), Expect = 5.429e-103
Identity = 186/522 (35.63%), Postives = 288/522 (55.17%), Query Frame = 3
Query:  240 AGENGQAV-----NLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKN-RHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWE 1787
            AGE G+AV      L+ +EK      +L   ++   S  IS+HR+LP     ECK++ Y +NLP  SVII F+NE W  LLRT+HSV+ R+P   L E++LVDDFS  +  +  +  Y+      G VK+ R EKR G ++++L GA +A G V+ +LDSH E  +GW+EP+LDR+  +  + V PV+  ID  TF + + +      G F W + F W  +P+  +K R    DP+++ T+  G+F+ ++  F  +G++D     +G ENLELSF++WMCGG LEI+PCS +GH+   RS    ++  +    NS R+ +VWLDDYK  +Y  R   +  + G+ISSR KLR  L CKSF W++ N+ PE F+P  ++   G ++N++++ CLD  V  E +  N     Y C     + Q + LS                  +IRR+  C+    ++  V    C   +   Q W YN + G L +   ++CL  +  K+  ++ +  C+  +PYQ W+
Sbjct:  112 AGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQF--GGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYK-TYYYERINNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESV-AKGELRNAQTSQCLDSAVGEEVE--NKAITPYPCHEQGGN-QYWMLS---------------KDGEIRRDESCVDYAGSD--VMVFPC-HGMKGNQEWRYNHDTGRLQHAVSQKCLGMT--KDGAKLEMVACQYDDPYQHWK 606          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant1 (gene:FBgn0034025 transcript:FBtr0087331)

HSP 1 Score: 340.502 bits (872), Expect = 1.784e-108
Identity = 185/542 (34.13%), Postives = 305/542 (56.27%), Query Frame = 3
Query:  201 YQQYESLEMNRR--GAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQN-LPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFK-NRHKLDRFGSFWWNMDFGWDEMP-KHFQKERRTSSD-----PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELR-EANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNG---KVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            Y+Q   L++ ++  G GE G AV+L+   K        KI  +  +S++++ +RS+ D R+  C  + +  + LPTASV+I F+NE +  LLRT+HS ++    + L+EIILVDD S    +   +  Y++   P G V + R + R G ++++L GA++A G+V+IFLD+H E   GW EP+L R+  +  S ++P++  ID   F +  N +K  + G F WN  F W  +P +  Q++RR         P  + T+  G+FA +R  F+ +GS+D ++  +G ENLE+SFR+W CGG +E +PCS +GHI          +++D HG+N+ RM  VW+D+Y  +F+L RP+L+  A+ G+++ R+ LR  L+CKSF+W++KN+ PEKF+P +++ G+G V    SN+CLD L+QN  +    + G+Y C      +Q+FS +               N   +R E  C T   +     +V  + C+      + W Y  E+  +++     CLD   LK++D   + PC+  +  Q W
Sbjct:   75 YEQIIQLDLQKQKVGLGEQGVAVHLSGAAKERGDEIYKKIALNEELSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEIILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDTHGINTARMALVWMDEYINIFFLNRPDLKFHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKVHAVNSNICLDDLLQN--NEKPYNAGLYPCGKVLQKSQLFSFT---------------NTNVLRNELSCATVQHSESPPYRVVMVPCMENDEFNEQWRY--EHQHIIHSNTGMCLDHQGLKSLDDAQVAPCDPHSESQRW 597          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant1 (gene:FBgn0034025 transcript:FBtr0087332)

HSP 1 Score: 340.502 bits (872), Expect = 1.784e-108
Identity = 185/542 (34.13%), Postives = 305/542 (56.27%), Query Frame = 3
Query:  201 YQQYESLEMNRR--GAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQN-LPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFK-NRHKLDRFGSFWWNMDFGWDEMP-KHFQKERRTSSD-----PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELR-EANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNG---KVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            Y+Q   L++ ++  G GE G AV+L+   K        KI  +  +S++++ +RS+ D R+  C  + +  + LPTASV+I F+NE +  LLRT+HS ++    + L+EIILVDD S    +   +  Y++   P G V + R + R G ++++L GA++A G+V+IFLD+H E   GW EP+L R+  +  S ++P++  ID   F +  N +K  + G F WN  F W  +P +  Q++RR         P  + T+  G+FA +R  F+ +GS+D ++  +G ENLE+SFR+W CGG +E +PCS +GHI          +++D HG+N+ RM  VW+D+Y  +F+L RP+L+  A+ G+++ R+ LR  L+CKSF+W++KN+ PEKF+P +++ G+G V    SN+CLD L+QN  +    + G+Y C      +Q+FS +               N   +R E  C T   +     +V  + C+      + W Y  E+  +++     CLD   LK++D   + PC+  +  Q W
Sbjct:   75 YEQIIQLDLQKQKVGLGEQGVAVHLSGAAKERGDEIYKKIALNEELSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEIILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDTHGINTARMALVWMDEYINIFFLNRPDLKFHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKVHAVNSNICLDDLLQN--NEKPYNAGLYPCGKVLQKSQLFSFT---------------NTNVLRNELSCATVQHSESPPYRVVMVPCMENDEFNEQWRY--EHQHIIHSNTGMCLDHQGLKSLDDAQVAPCDPHSESQRW 597          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant5 (gene:FBgn0031681 transcript:FBtr0111024)

HSP 1 Score: 326.635 bits (836), Expect = 8.878e-103
Identity = 191/538 (35.50%), Postives = 305/538 (56.69%), Query Frame = 3
Query:  216 SLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVF--RSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMP-KHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSS---IVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGY---GYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW--ESQF 1796
            S++  +   GE G+ V +    K  MK +  +  ++   S  ISL+RSL D R + C+ K+Y   LPT S++I F+NE W TLLRT+ SV+NRSP   L+EIILVDD S ++ +   +  Y+  + P   VK F  R+EKR+G ++++L GA+   G VI FLD+H E T+GWLEP+L R+  N ++ V P++  I  ETF +        +G F W ++F W  +P +   +     + P++T T+  G+F+ ++  F+ +GS+D  +  +G ENLE+SFRVWMCGG+LEI PCS +GH+  +R S          +    N+ R+V+VWLDD+K  +Y + P  R+A+AG++S R  LR+ L+CKSF W+++NV PE  +P    L Y   G ++N+++  CLD + +    + N   G+  C +G    Q+F+ +  +  +SD+                CL A+ +NG V+ + C   +   Q W+Y+ E   + +    QCL  +   + +   ++PC S    Q+W  ES+F
Sbjct:  121 SVQEAKGKPGEMGKPVKIPADMKDLMKEKFKENQFNLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYVA-KLP---VKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASD-STWGGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRVWMCGGVLEIAPCSRVGHV--FRKSTPYTFPGGTTEIVNHNNARLVEVWLDDWKEFYYSFYPGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMP----LDYYYLGEIRNAETETCLDTMGR----KYNEKVGISYC-HGLGGNQVFAYTKRQQIMSDDL---------------CLDASSSNGPVNMVRC-HNMGGNQEWVYDAEEKWIRHTNTGQCLQRATRDDANTPLLRPC-SYGKGQQWLMESKF 625          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant5 (gene:FBgn0031681 transcript:FBtr0079026)

HSP 1 Score: 316.62 bits (810), Expect = 5.623e-99
Identity = 185/536 (34.51%), Postives = 301/536 (56.16%), Query Frame = 3
Query:  216 SLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVF--RSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMP-KHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGL-NSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGY---GYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW--ESQF 1796
            S++  +   GE G+ V +    K  MK +  +  ++   S  ISL+RSL D R + C+ K+Y   LPT S++I F+NE W TLLRT+ SV+NRSP   L+EIILVDD S ++ +   +  Y+  + P   VK F  R+EKR+G ++++L GA+   G VI FLD+H E T+GWLEP+L R+  N ++ V P++  I  ETF +        +G F W ++F W  +P +   +     + P++T T+  G+F+ ++  F+ +GS+D  +  +G ENLE+SFR+W CGG+LEI+PCS +GH+   +S            L N+ R+ +VWLD+++  +Y      R+A+AG++S R  LR+ L+CKSF W+++NV PE  +P    L Y   G ++N+++  CLD + +    + N   G+  C +G    Q+F+ +  +  +SD+                CL A+ +NG V+ + C   +   Q W+Y+ E   + +    QCL  +   + +   ++PC S    Q+W  ES+F
Sbjct:  121 SVQEAKGKPGEMGKPVKIPADMKDLMKEKFKENQFNLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYVA-KLP---VKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASD-STWGGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRIWQCGGILEIIPCSHVGHVFRDKSPYTFPGGVAKIVLHNAARVAEVWLDEWRDFYYSMSTGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMP----LDYYYLGEIRNAETETCLDTMGR----KYNEKVGISYC-HGLGGNQVFAYTKRQQIMSDDL---------------CLDASSSNGPVNMVRC-HNMGGNQEWVYDAEEKWIRHTNTGQCLQRATRDDANTPLLRPC-SYGKGQQWLMESKF 625          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0087113)

HSP 1 Score: 304.679 bits (779), Expect = 2.458e-94
Identity = 184/520 (35.38%), Postives = 284/520 (54.62%), Query Frame = 3
Query:  243 GENGQAVNLTYKEKMNMKIEI----LKIGYHNSVSKRISLHRSLPDFRSDECKSK-NYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLD-RFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            GE G+ V L  +    MK  +     K  ++  VS  IS+HR+LPD R   CK +  Y  NLP   VII F+NE W  LLRT+HSV++RSP   + +IILVDD+S    ++  + +Y    +P   V++ R +KR G +++++ GA  A   V+ +LDSH E T+GWLEP+LDR++ N  + V PV+  I  ET  +  R       G F WN+ F W  +P+  +K   ++++P+ + T+  G+F+ +R  F  +G++D+    +G ENLELSF+ WMCGG LEI+PCS +GHI   RS    +S  +    NS R+ +VW+D+Y + +Y +R    + + G++S R KLRN L+CKSF W++ N+ PE FIP  ++  +G + N  + +CLD   ++E +       +Y C +G    Q + LS            KA    +IRR+  CL     +  V    C       Q W Y +    L +    +CL  S  K  D++ ++ C +S   Q+W
Sbjct:  147 GELGKPVRLPKEMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFA-AYPK--VQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGVNVLKKNSVRLAEVWMDEYSQ-YYYHRIGNDKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPELFIPGDSV-AHGEIANVPNGMCLDAKEKSEEE---TPVSIYEC-HGQGGNQYWMLS------------KAG---EIRRDDSCLDYAGKD--VTLFGCHGGK-GNQFWTYRENTKQLHHGTSGKCLAISESK--DKLLMEECSASLSRQQW 637          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 335.88 bits (860), Expect = 4.405e-107
Identity = 186/520 (35.77%), Postives = 300/520 (57.69%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+ V +   ++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LP  SV+I F+NE W TLLRT+HSV++RSP   L EI+LVDD S ++ ++  + +Y++  E P   V+V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R  LR  LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    SL+++   QCLD ++  +    +++ C  +   Q+W
Sbjct:   55 GPGEMGKPVVIAKDQQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVP---VRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARS-QQW 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 335.88 bits (860), Expect = 4.405e-107
Identity = 186/520 (35.77%), Postives = 300/520 (57.69%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+ V +   ++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LP  SV+I F+NE W TLLRT+HSV++RSP   L EI+LVDD S ++ ++  + +Y++  E P   V+V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R  LR  LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    SL+++   QCLD ++  +    +++ C  +   Q+W
Sbjct:   55 GPGEMGKPVVIAKDQQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVP---VRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARS-QQW 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 331.643 bits (849), Expect = 1.462e-105
Identity = 186/522 (35.63%), Postives = 299/522 (57.28%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSI---VRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
              GE G+AV +  +E+  MK E+ KI   N   S  I+L+RSLPD R D CK+K YP +LP  S++I F+NE W TLLRT+HS +NRSP Q L EI+LVDD S ++ ++  + +Y+   E P   V++ R E+R G ++++L GA    G VI FLD+H E T GWLEP++ R+  + ++ V P++  I  ETF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D+ +  +G ENLE+SFR+W CGG LEI+ CS +GH+  +R +               N++R+ +VW+D++K  FY+  P +   + G++SSR  LR SL+CK F W+++NV P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL A++ NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C S    Q+W
Sbjct:   56 APGEMGKAVVIPKEEQDKMK-ELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVP---VRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHV--FRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDASRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLKDC-SGRRSQQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNT3 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) [Source:NCBI gene;Acc:100331984])

HSP 1 Score: 323.168 bits (827), Expect = 2.125e-101
Identity = 194/540 (35.93%), Postives = 290/540 (53.70%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAV---NLTYKEKMNMKIEILKIGYHNSVSKRISLHRSL-PDFRSDECKSKNYPQ--NLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRF---GSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPE----LREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSP---VKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E    N    G +G+A    NL+  E+   +    K  ++   S RISL R L PD R  EC  + + +   LPT SVII F+NE W TLLRT++SV++ SP   L+EIILVDD S+ E ++  +  +++      IV+V R  +R G + ++L GA +A G+ + FLD+H E   GWLEP+L R++ N  + V P +  ID+ TF F       +    G+F W + FGW+ +P H ++ R+  + PIKT T   G+F+ +R  F+++GS+D E+  +G EN+E+SFRVW CGG LEI+PCS +GH+   +S             N  R+ +VW+DDYK +FY    +     +E + G++S R+ LR  LQCKSF W++KNV PE F+PD N L +G ++N     CLD+   NE   G     +Y C +G    Q F  S    ++++I     +   +   +R E       K +  +       EL E QL+ YNK +        KQCL A      +  ++ PC   + YQ W
Sbjct:  106 ERPPQNPSAPGASGKAFHTDNLSSSEQKEKERGEEKHCFNLYASDRISLSRDLGPDTRPPECIEQTFRRCPPLPTTSVIIVFHNEAWSTLLRTVYSVLHTSPALFLKEIILVDDASVDEHLKDKLDEFLKQL---HIVRVVRQHERKGLITARLLGASVATGDTLTFLDAHCECFHGWLEPLLARIAENSSAVVSPDITTIDLNTFEFMKPSPYGQHHNRGNFDWGLSFGWETLPDHERRRRKDETYPIKTPTFAGGLFSISRDYFYHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTQVIARNQVRLAEVWMDDYKEIFYRRNQQAAQIAKEHSFGDVSRRVDLRERLQCKSFSWYLKNVYPEVFMPDLNPLQFGAIRNMGKEACLDVGESNE---GGKPLIMYPC-HGMGGNQYFEYSTHHEIRHNIQKELCLDGTDGAMVRLE---ECQYKGHNTITSPQQKWELREDQLF-YNKAS--------KQCLSA----RPENPSLVPCNPDDKYQLW 622          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 317.39 bits (812), Expect = 1.241e-100
Identity = 172/467 (36.83%), Postives = 270/467 (57.82%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSI-VRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITC 1625
              GE G+AV +  +E+  MK E+ KI   N   S  I+L+RSLPD R D CK+K YP +LP  S++I F+NE W TLLRT+HS +NRSP Q L EI+LVDD S ++ ++  + +Y+   E P   V++ R E+R G ++++L GA    G VI FLD+H E T GWLEP++ R+  + ++ V P++  I  ETF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D+ +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P +   + G++SSR  LR SL+CK F W+++NV P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL A++ NG V  + C
Sbjct:   56 APGEMGKAVVIPKEEQDKMK-ELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVP---VRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDASRLNGPVVMLKC 496          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 345.895 bits (886), Expect = 8.854e-111
Identity = 195/528 (36.93%), Postives = 305/528 (57.77%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            +SL     G GE G+ V +  +E+  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LPT SV+I F+NE W TLLRT+HSV+NRSP   L+EIILVDD S +E ++  +  Y++    P   V V R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     RR     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   51 DSLNKPHEGPGEMGKPVVIPKEEQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVP---VHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 550          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 343.969 bits (881), Expect = 3.956e-110
Identity = 194/525 (36.95%), Postives = 303/525 (57.71%), Query Frame = 3
Query:  222 EMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E    G GE G+ V +  +E+  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LPT SV+I F+NE W TLLRT+HSV+NRSP   L+EIILVDD S +E ++  +  Y++    P   V V R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     RR     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   47 EKPHEGPGEMGKPVVIPKEEQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVP---VHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 543          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 343.969 bits (881), Expect = 4.635e-110
Identity = 193/520 (37.12%), Postives = 302/520 (58.08%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+ V +  +E+  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LPT SV+I F+NE W TLLRT+HSV+NRSP   L+EIILVDD S +E ++  +  Y++    P   V V R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     RR     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   56 GPGEMGKPVVIPKEEQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVP---VHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 343.584 bits (880), Expect = 5.806e-110
Identity = 193/520 (37.12%), Postives = 302/520 (58.08%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+ V +  +E+  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LPT SV+I F+NE W TLLRT+HSV+NRSP   L+EIILVDD S +E ++  +  Y++    P   V V R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     RR     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   59 GPGEMGKPVVIPKEEQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVP---VHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 550          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 343.584 bits (880), Expect = 6.715e-110
Identity = 203/568 (35.74%), Postives = 319/568 (56.16%), Query Frame = 3
Query:   93 FLGIFEFIYKQYVNKTNLMLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            FL +F  +Y    NK +    K +  L   D   +  + +E       G GE G+ V +  +E+  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LPT SV+I F+NE W TLLRT+HSV+NRSP   L+EIILVDD S +E ++  +  Y++    P   V V R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     RR     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R+ LR+ LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L+++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   19 FLDMFLLLYFSECNKCD---DKKERGLPGGDGPDINQKPHE-------GPGEMGKPVVIPKEEQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVP---VHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTASK---------------EIRTDDLCLDVSKLNGPVIMLKC-HHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 343.199 bits (879), Expect = 6.933e-110
Identity = 190/528 (35.98%), Postives = 305/528 (57.77%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E ++    G GE G+ V +  +++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP NLPT SV+I F+NE W TLLRT+HSV+NRSP   + EI+LVDD S ++ ++  + +Y++  + P   V V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+ISSR+ LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 ELVQKPHEGPGEMGKPVVIPKEDQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 343.199 bits (879), Expect = 6.933e-110
Identity = 190/528 (35.98%), Postives = 305/528 (57.77%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E ++    G GE G+ V +  +++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP NLPT SV+I F+NE W TLLRT+HSV+NRSP   + EI+LVDD S ++ ++  + +Y++  + P   V V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+ISSR+ LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 ELVQKPHEGPGEMGKPVVIPKEDQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 343.199 bits (879), Expect = 6.933e-110
Identity = 190/528 (35.98%), Postives = 305/528 (57.77%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E ++    G GE G+ V +  +++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP NLPT SV+I F+NE W TLLRT+HSV+NRSP   + EI+LVDD S ++ ++  + +Y++  + P   V V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+ISSR+ LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 ELVQKPHEGPGEMGKPVVIPKEDQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 330.102 bits (845), Expect = 5.983e-105
Identity = 186/523 (35.56%), Postives = 300/523 (57.36%), Query Frame = 3
Query:  228 NRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYH-GLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            N+ G GE G+AV +   ++  MK E+ KI   N   S  I+L+RSLPD R + CK+K YP  LP  SV+I F+NE W TLLRT++SV+NRSP   L E+ILVDD S ++ +++ + NY++  E P   VK+ R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +         +    N++R+ +VW+D++K  FY+  P + + + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ +G V  + C   +   QLW Y+ E  +L +    QCLD  + ++    T+Q C  S   Q+W
Sbjct:   53 NQEGPGEMGKAVLIPKDDQEKMK-ELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVP---VKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP-RRYYSLGEIRNVETNQCLDNMGRKE----NEKVGIFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLSGPVIMLKC-HHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 330.102 bits (845), Expect = 5.983e-105
Identity = 186/523 (35.56%), Postives = 300/523 (57.36%), Query Frame = 3
Query:  228 NRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYH-GLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            N+ G GE G+AV +   ++  MK E+ KI   N   S  I+L+RSLPD R + CK+K YP  LP  SV+I F+NE W TLLRT++SV+NRSP   L E+ILVDD S ++ +++ + NY++  E P   VK+ R E+R+G ++++L GA  + G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +         +    N++R+ +VW+D++K  FY+  P + + + G++S R  LR +L+CK F W+++N+ P+  IP R     G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  ++ +G V  + C   +   QLW Y+ E  +L +    QCLD  + ++    T+Q C  S   Q+W
Sbjct:   53 NQEGPGEMGKAVLIPKDDQEKMK-ELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVP---VKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP-RRYYSLGEIRNVETNQCLDNMGRKE----NEKVGIFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLSGPVIMLKC-HHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q9U2C4|GALT9_CAEEL (Probable N-acetylgalactosaminyltransferase 9 OS=Caenorhabditis elegans OX=6239 GN=gly-9 PE=2 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 3.561e-122
Identity = 205/524 (39.12%), Postives = 304/524 (58.02%), Query Frame = 3
Query:  231 RRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYP-QNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHI---AHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKN--SKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            R G GE G+ V LT K+    + ++ K   +   S +ISL R +PD R   CK   Y    LP  SVII F +E W  LLRT+HSV+NRSPP+ L+E+IL+DD S ++ +Q  +  +I+     G V++ R   R+G +++KL GA+ A+G++I+FLDSH E   GWLEPI+ R+S    + V P++  I   T A+     L   G F W + F W+ + +  QK R   +D I++ T+  G+ AANR  FF +G +D E+  +G ENLE+SFR WMCGG +E +PCS +GHI    H  +   R +NKD HG NSKR+ +VW+DDYKRL+Y++R +LR  + G++++R +LR  L CK F WF+ N+   KFI D +++ YG +    S + +C D L ++E  + +   GV+ CQ   SS Q+ SLS            K  N   +RRE  C  A++ NG +   TC  +    + W Y  EN  + NLK  +C+  +NLK  D   +  C+  + +Q+W
Sbjct:   72 REGPGEKGKPVVLTGKDAELGQADMKKWFMNVHASDKISLDRDVPDPRIQACKDIKYDYAALPKTSVIIIFTDEAWTPLLRTVHSVINRSPPELLQEVILLDDNSKRQELQEPLDEHIKRF--GGKVRLIRKHVRHGLIRAKLAGAREAVGDIIVFLDSHCEANHGWLEPIVQRISDERTAIVCPMIDSISDNTLAYHGDWSLST-GGFSWALHFTWEGLSEEEQKRRTKPTDYIRSPTMAGGLLAANREYFFEVGGYDEEMDIWGGENLEISFRAWMCGGSIEFIPCSHVGHIFRAGHPYNMTGRNNNKDVHGTNSKRLAEVWMDDYKRLYYMHREDLRTKDVGDLTARHELRKRLNCKPFKWFLDNIAKGKFIMDEDVVAYGALHTVVSGTRMCTDTLQRDE--KMSQLLGVFHCQGKGSSPQLMSLS------------KEGN---LRRENTC--ASEENGNIRMKTCSKKAQFNERWAY--ENKMIRNLKSGKCMSTANLKPGDNAIVVECDEKDEHQKW 571          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q10472|GALT1_HUMAN (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GALNT1 PE=1 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 2.904e-109
Identity = 190/528 (35.98%), Postives = 306/528 (57.95%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E ++    G GE G+ V +  +++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP NLPT SV+I F+NE W TLLRT+HSV+NRSP   + EI+LVDD S ++ ++  + +Y++  + P   V V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+ISSR+ LR+ LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 EPVQKPHEGPGEMGKPVVIPKEDQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q07537|GALT1_BOVIN (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Bos taurus OX=9913 GN=GALNT1 PE=1 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 4.358e-109
Identity = 190/528 (35.98%), Postives = 306/528 (57.95%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E ++    G GE G+ V +  +++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP NLPT SV+I F+NE W TLLRT+HSV+NRSP   L EI+LVDD S ++ ++  + +Y++  + P   V V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+ISSR+ LR+ LQC+ F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 EPVQKPHEGPGEMGKPVVIPKEDQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRHKLQCRPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATDEDSQVPSIRDCSGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|O08912|GALT1_MOUSE (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Galnt1 PE=1 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 4.849e-109
Identity = 190/528 (35.98%), Postives = 305/528 (57.77%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E ++    G GE G+ V +  +++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP NLPT SV+I F+NE W TLLRT+HSV+NRSP   + EI+LVDD S ++ ++  + +Y++  + P   V V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+ISSR+ LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 ELVQKPHEGPGEMGKPVVIPKEDQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIP-RHYFSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q29121|GALT1_PIG (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Sus scrofa OX=9823 GN=GALNT1 PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 7.356e-109
Identity = 190/528 (35.98%), Postives = 306/528 (57.95%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E ++    G GE G+ V +  +++  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP NLPT SV+I F+NE W TLLRT+HSV+NRSP   L EI+LVDD S ++ ++  + +Y++  + P   V V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+ H+ ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+ISSR+ LR+ LQC+ F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L ++   QCLD +  ++    +I+ C  S   Q+W
Sbjct:   49 EPVQKPHEGPGEMGKPVVIPKEDQDKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERDFLKRPLESYVKKLKVP---VHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKTFFYIISPGVTKVDYGDISSRLGLRHKLQCRPFSWYLENIYPDSQIP-RHYSSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVTMLKC-HHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCSGSRS-QQW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A267ENR0 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000326g1 PE=3 SV=1)

HSP 1 Score: 485.723 bits (1249), Expect = 2.680e-161
Identity = 237/558 (42.47%), Postives = 354/558 (63.44%), Query Frame = 3
Query:  147 MLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEIL--KIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPEL--REANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPD--RNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIET-----QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWE 1787
            + ++L +    +  RL R+ +Y+  E  R+G GE G  V LT  EK  +  + +  K  ++   S RISL RSL D R+ EC+S +YP +LPT SV+I F+ E W +L+RT+HSVVNR+PP++L+E++L+DDFS +E +  N+ NY+   +PDG+V+V RS +R G ++++L GAK A G+V+ FLDSH E TKGW EP+L R+  +  + + P++  +  ++ ++         GSFWW+  F WD +P+H  + R+  +DPI++ T+  G+FA +R  FF +G++D  +  +G ENLE+SFRVWMCGG LE +PCS +GHI           +KDYHGLN+ R+VDVW+D+YKRLFY++R +L  R A+ G++SSR+ LR  L CK F W+++NV+PEKFIPD  R++  YG ++N  +N+C+DLL  NEFDR     G+YSCQ GAS  QIFS S  +               +IRREWGCL A   + +V FITC T + +      Q W  + +  ++ +    +CL A  +KN +   +  C ++NP+Q WE
Sbjct:   59 ICRQLDVTPDVYQARLRRFTEYQKSEPFRQGPGEQGHGVYLTADEKNRLGYDAMFTKEAFNRISSDRISLDRSLNDMRAMECRSISYPADLPTLSVVIIFHEEAWSSLMRTVHSVVNRTPPRYLKEVVLLDDFSTKEHLLRNLDNYLARTFPDGVVRVVRSRERLGLIRARLEGAKAATGDVVAFLDSHCEATKGWAEPLLARIKESRSAVLCPIIESVSADSLSYNGGGSSYSVGSFWWSGHFTWDMIPEHELRRRQKHTDPIRSATMAGGLFAVDRKYFFEVGAYDEGMGIWGGENLEISFRVWMCGGTLEFIPCSRVGHIFRASHPYSFPGHKDYHGLNTMRLVDVWMDEYKRLFYMHRHDLVSRTADRGDVSSRVALRKRLNCKPFSWYLENVIPEKFIPDSTRDVTAYGMLRNPITNMCVDLLNYNEFDRNPTAAGLYSCQGGASGRQIFSYSRKQ---------------EIRREWGCLQAGPGSDRVSFITCTTRVTDPEAGAGQRWQLDPQAKTIRHSASGRCLSAEGVKNGEAAKLSDCSATNPHQVWE 601          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A267ENX5 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000649g1 PE=3 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 5.600e-161
Identity = 237/558 (42.47%), Postives = 354/558 (63.44%), Query Frame = 3
Query:  147 MLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEIL--KIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPEL--REANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPD--RNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIET-----QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWE 1787
            + ++L +    +  RL R+ +Y+  E  R+G GE G  V LT  EK  +  + +  K  ++   S RISL RSL D R+ EC+S +YP +LPT SV+I F+ E W +L+RT+HSVVNR+PP++L+E++L+DDFS +E +  N+ NY+   +PDG+V+V RS +R G ++++L GAK A G+V+ FLDSH E TKGW EP+L R+  +  + + P++  +  ++ ++         GSFWW+  F WD +P+H  + R+  +DPI++ T+  G+FA +R  FF +G++D  +  +G ENLE+SFRVWMCGG LE +PCS +GHI           +KDYHGLN+ R+VDVW+D+YKRLFY++R +L  R A+ G++SSR+ LR  L CK F W+++NV+PEKFIPD  R++  YG ++N  +N+C+DLL  NEFDR     G+YSCQ GAS  QIFS S  +               +IRREWGCL A   + +V FITC T + +      Q W  + +  ++ +    +CL A  +KN +   +  C ++NP+Q WE
Sbjct:   56 ICRQLDVTPDVYQVRLRRFTEYQKSEPFRQGPGEQGHGVYLTADEKNRLGYDAMFAKEAFNRISSDRISLDRSLNDMRAMECRSISYPADLPTLSVVIIFHEEAWSSLMRTVHSVVNRTPPRYLKEVVLLDDFSTKEHLLRNLDNYLARTFPDGVVRVVRSRERLGLIRARLEGAKAATGDVVAFLDSHCEATKGWAEPLLARIKESRSAVLCPIIESVSADSLSYNGGGSSYSVGSFWWSGHFTWDMIPEHELRRRQKHTDPIRSATMAGGLFAVDRKYFFEVGAYDEGMGIWGGENLEISFRVWMCGGTLEFIPCSRVGHIFRASHPYSFPGHKDYHGLNTMRLVDVWMDEYKRLFYMHRHDLVSRTADRGDVSSRVALRKRLNCKPFSWYLENVIPEKFIPDSTRDVTAYGMLRNPITNMCVDLLNYNEFDRNPTAAGLYSCQGGASGRQIFSYSRKQ---------------EIRREWGCLQAGPGSDRVSFITCTTRVTDPEAGAGQRWQLDPQAKTIRHNASGRCLSAEGVKNGEAAKLSDCSATNPHQVWE 598          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1I8GE26 (Ricin B-type lectin domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 1.128e-150
Identity = 235/555 (42.34%), Postives = 352/555 (63.42%), Query Frame = 3
Query:  147 MLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEIL--KIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPEL--REANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPD--RNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIET-----QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQ 1778
            + ++L +    +  RL R+ +Y+  E  R+G GE G  V LT  EK  +  + +  K  ++   S RISL RSL D R+ EC+S +YP +LPT SV+I F+ E W +L+RT+HSVVNR+PP++L+E++L+DDFS +E +  N+ NY+   +PDG+V+V RS +R G ++++L GAK A G+V+ FLDSH E TKGW EP+L R+  +  + + P++  +  ++ ++         GSFWW+  F WD +P+H  + R+  +DPI++ T+  G+FA +R  FF +G++D  +  +G ENLE+SFRVWMCGG LE +PCS +GHI           +KDYHGLN+ R+VDVW+D+YKRLFY++R +L  R A+ G++SSR+ LR  L CK F W+++NV+PEKFIPD  R++  YG ++N  +N+C+DLL  NEFDR     G+YSCQ GAS  QIFS S  +               +IRREWGCL A   + +V FITC T + +      Q W  + +  ++ +    +CL A  +KN +   +  C ++NP+Q
Sbjct:  730 ICRQLDVTPDVYQVRLRRFTEYQKSEPFRQGPGEQGHGVYLTADEKNRLGYDAMFAKEAFNRISSDRISLDRSLNDMRAMECRSISYPADLPTLSVVIIFHEEAWSSLMRTVHSVVNRTPPRYLKEVVLLDDFSTKEHLLRNLDNYLARTFPDGVVRVVRSRERLGLIRARLEGAKAATGDVVAFLDSHCEATKGWAEPLLARIKESRSAVLCPIIESVSADSLSYNGGGSSYSVGSFWWSGHFTWDMIPEHELRRRQKHTDPIRSATMAGGLFAVDRKYFFEVGAYDEGMGIWGGENLEISFRVWMCGGTLEFIPCSRVGHIFRASHPYSFPGHKDYHGLNTMRLVDVWMDEYKRLFYMHRHDLVSRTADRGDVSSRVALRKRLNCKPFSWYLENVIPEKFIPDSTRDVTAYGMLRNPITNMCVDLLNYNEFDRNPTAAGLYSCQGGASGRQIFSYSRKQ---------------EIRREWGCLQAGPGSDRVSFITCTTRVTDPEAGAGQRWQLDPQAKTIRHNASGRCLSAEGVKNGEAAKLSDCSATNPHQ 1269          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1I8GCD2 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 1.497e-146
Identity = 220/502 (43.82%), Postives = 321/502 (63.94%), Query Frame = 3
Query:  309 KIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPEL--REANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPD--RNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIET-----QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWE 1787
            K  ++   S RISL RSL D R+ EC+S +YP +LPT SV+I F+ E W +L+RT+HSVVNR+PP++L+E++L+DDFS +E +  N+ NY+   +PDG+V+V RS +R G ++++L GAK A G+V+ FLDSH E TKGW EP+L R+  +  + + P++  +  ++ ++         GSFWW+  F WD   KH        +DPI++ T+  G+FA +R  FF +G++D  +  +G ENLE+SFRVWMCGG LE +PCS +GHI           +KDYHGLN+ R+VDVW+D+YKRLFY++R +L  R A+ G++SSR+ LR  L CK F W+++NV+PEKFIPD  R++  YG ++N  +N+C+DLL  NEFDR     G+YSCQ GAS  QIFS S  +               +IRREWGCL A   + +V FITC T + +      Q W  + +  ++ +    +CL A  +KN +   +  C ++NP+Q WE
Sbjct:   11 KEAFNRISSDRISLDRSLNDMRAMECRSISYPADLPTLSVVIIFHEEAWSSLMRTVHSVVNRTPPRYLKEVVLLDDFSTKEHLLRNLDNYLARTFPDGVVRVVRSRERLGLIRARLEGAKAATGDVVAFLDSHCEATKGWAEPLLARIKESRSAVLCPIIESVSADSLSYNGGGSSYSVGSFWWSGHFTWDM--KH--------TDPIRSATMAGGLFAVDRKYFFEVGAYDEGMGIWGGENLEISFRVWMCGGTLEFIPCSRVGHIFRASHPYSFPGHKDYHGLNTMRLVDVWMDEYKRLFYMHRHDLVSRTADRGDVSSRVALRKRLNCKPFSWYLENVIPEKFIPDSTRDVTAYGMLRNPITNMCVDLLNYNEFDRNPTAAGLYSCQGGASGRQIFSYSRKQ---------------EIRREWGCLQAGPGSDRVSFITCTTRVTDPEAGAGQRWQLDPQAKTIRHSASGRCLSAEGVKNGEAAKLSDCSATNPHQVWE 487          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A2C9JSS3 (Polypeptide N-acetylgalactosaminyltransferase OS=Biomphalaria glabrata OX=6526 GN=106066598 PE=3 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 2.788e-146
Identity = 228/543 (41.99%), Postives = 332/543 (61.14%), Query Frame = 3
Query:  168 NLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNG-KVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWESQ 1793
            +L+ +  R LRYQ Y+  E  R G GE G+ V L  +EK      I K  ++   S +ISL RSL D R   CKS  YP +LP ASV+I F+NE W  LLRT HSVVNRSPPQ+L+E+IL+DDFS ++ ++  +  YI   WPDGIV++ R+++R+G +++K+ GAK A+G+V++FLDSH EV  GW+EPIL R+  +  + + P +  ID +T  +         G FWW++ F W  +PK     R++  DPI++ T+  G+ AA+R  FF +G++D  +  +G ENLE+SFRVWMCGG LE +PCS +GHI           NKD HG+NS R+ +VW+DDYKRLFY +R +L   + G+IS R +LR  L C +F W++ NV PEKFIPD N+  +G V+N  S +CLD L ++E  +     G++SCQNG S++Q+FSL+                  ++RRE  CL ++  +G +V    C  +  + Q WI++K   ++++    +CLD    K+ D V +  C S N  Q+W  Q
Sbjct:   40 SLAQYSVRYLRYQHYKQTEAYREGPGEKGEPVYLEGEEKKLADSLIEKEAFNRIASDKISLERSLKDVRDPRCKSIVYPSDLPKASVVIIFHNEAWSPLLRTAHSVVNRSPPQYLQEVILLDDFSDKDFLKEKLEQYIAATWPDGIVRLVRTQERSGLIRAKVAGAKAAVGDVLVFLDSHCEVNTGWIEPILSRIKEDPTAVLCPEIDLIDKDTLQYAGTGSYS-VGGFWWSLHFSWRPVPKRESLRRKSEIDPIRSPTMAGGLLAADRKXFFEIGAYDPGMDVWGGENLEISFRVWMCGGKLEFIPCSRVGHIFRSSHPYTFPGNKDTHGINSMRLAEVWMDDYKRLFYTHRKDLLGTDYGDISERKELRKKLNCHTFKWYLDNVYPEKFIPDENVKAWGMVRNPDSGICLDTLQRDE--KTVFDVGMFSCQNGGSASQVFSLTLTN---------------ELRREEACLDSSGQDGSRVSLRPCTGQ--QNQKWIHDKSKNTIVHQASGKCLDTGGQKSGDNVVVNTC-SENGNQKWTMQ 561          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 336.265 bits (861), Expect = 2.653e-107
Identity = 186/520 (35.77%), Postives = 299/520 (57.50%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+ V +  ++   MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LP  SV+I F+NE W TLLRT+HSV+NRSP   L E++LVDD S ++ ++  +  Y++  E P   V++ R E+R+G ++++L GA L+ G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+I++R  LR  LQCK F W+++NV P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    SL+++   QCLD ++  +    +++ C  S   Q+W
Sbjct:   55 GPGEMGKPVVIPKEQHEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVP---VRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWDYDPLKLSLVHVNSNQCLDKASEDDSQVPSVRDCTGSRS-QQW 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 331.257 bits (848), Expect = 2.866e-105
Identity = 185/521 (35.51%), Postives = 298/521 (57.20%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSI-VRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDR-VTIQPCESSNPYQEW 1784
            G GE G+AV +   ++  MK E+ KI   N   S  I+L+RSLPD R D CK+K YP +LP  S++I F+NE W TLLRT+HSV+NRSP   L EI+LVDD S ++ ++  + +Y++  E P   V++ R E+R+G ++++L GA    G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  ETF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P +   + G++S+R  LR +LQCK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   +   Q++ Y+ E G+ M++  + CL  S L++     T++ C+ S P Q W
Sbjct:   56 GPGEMGKAVIIPKDDQEKMK-ELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVP---VRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIP-RRYFSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAEKGTFMHIITQSCLTISRLEDGTYGPTVEYCDDS-PLQTW 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 328.561 bits (841), Expect = 1.858e-104
Identity = 184/522 (35.25%), Postives = 299/522 (57.28%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSI---VRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+AV +   ++  MK E+ KI   N   S  I+L+RSLPD R D CK+K YP +LP  S++I F+NE W TLLRT+HSV+NRSP   L EI+LVDD S ++ ++  + +Y++  E P   V++ R E+R+G ++++L GA    G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  ETF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+  +R +               N++R+ +VW+D++K  FY+  P +   + G++S+R  LR +LQCK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   56 GPGEMGKAVIIPKDDQEKMK-ELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVP---VRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHV--FRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIP-RRYFSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: poc1bl (polypeptide N-acetylgalactosaminyltransferase 4 [Source:NCBI gene;Acc:103026965])

HSP 1 Score: 315.849 bits (808), Expect = 3.370e-99
Identity = 188/557 (33.75%), Postives = 300/557 (53.86%), Query Frame = 3
Query:  141 NLMLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQA--VNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYP-QNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSK-SNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTE---LIETQLWIYNKENGSLMNLKFKQCLDA-SNLKNMDRVTIQPCESSNPYQEWE 1787
            N+M+++        D   L+   YE    +    GE G+A  +NL  +EK   +  I +   +  +S +ISLHR + D R  EC+SK Y  ++LPT SVII FYNE W TLLRTIHSV+  +P   L+EIIL+DDFS +  ++  + +YI N      V++ R+ KR G ++++L GA  A G+V+ FLD H E   GW+EP+L+R+  N  + + PV+  ID  TF F  + +    G F W + F W  +P+  +K R++ +DPI++ T+  G+FA ++  F  +G++D  +  +G ENLELSFRVW CGG LEI PCS +GH+   ++   R +       N+ R  +VW+D YK+ FY   P  R+   G+IS RI LR  L+C+SFDW++KN+ P+  +P+     +G V++S   + CLD    +    G  H  ++ C +G    Q F         + N +I+ N+  ++     C         +    C  +   +  T +W + +++GS+ +     C+ +    +    V +  C S +  Q W+
Sbjct:   45 NIMVRQFATEAEE-DVANLQRPIYEKPPPDPNAPGEWGKATRLNLNSEEKKQEEDSIERYAINILISDKISLHRHIQDNRMHECRSKKYDIRHLPTTSVIIAFYNEAWSTLLRTIHSVLETTPAVLLKEIILIDDFSDRVYLKSQLEHYISNL---ERVRLIRTNKREGLVRARLIGATYATGDVLTFLDCHCECVPGWIEPLLERIGQNESTIICPVIDTIDWNTFEFYMQTEEPMVGGFDWRLTFQWHSVPEMDRKRRKSRTDPIRSPTMAGGLFAVSKSYFEYLGTYDMGMEVWGGENLELSFRVWQCGGSLEIHPCSHVGHVFPKKAPYARPNFLQ----NTVRAAEVWMDSYKQHFYNRNPPARKETYGDISDRILLRERLKCQSFDWYLKNIYPDLHVPEDRTGWHGAVRSSGIPSECLDYNAPDHSPTG-AHLSLFGC-HGQGGNQYFEY-------TSNKEIRFNSVTEL-----CAEVPTGQTYIGMRHCPRDGEPVPPTIVWNF-RDDGSIFHPHSDMCITSYRTTQGRTDVQMSRCSSGDMNQRWK 578          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: GALNT3 (polypeptide N-acetylgalactosaminyltransferase 3 [Source:NCBI gene;Acc:103045087])

HSP 1 Score: 313.538 bits (802), Expect = 6.690e-98
Identity = 188/500 (37.60%), Postives = 277/500 (55.40%), Query Frame = 3
Query:  330 VSKRISLHRSL-PDFRSDECKSKNYPQ--NLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDR---FGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPE----LREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIET-----QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
             S RISL R L PD R  EC  + + +   LPT SVII F+NE W TLLRT++SV++ SP   L+E+ILVDD S+   ++  +  Y++      IV+V R  +R G + ++L GA +A G+ + FLD+H E   GWLEP+L R++ NY + V P +  ID+ TF F       +    G+F W + FGW+ +P H ++ R+  + PIKT     G+F+ ++  F+++GS+D E+  +G EN+E+SFRVW CGG LEI+PCS +GH+   +S             N  R+ +VW+DDYK +FY    +     +E + G++S R+ LR  LQCKSF W++KNV PE F+PD N L +G +KN   + CLD    NE   G     +Y C +G    Q F         S +++I+ N    I++E  CL     +G V    C  +   T     Q W   +E+    N+ +K CL A   +N   VT   C S++ YQ W
Sbjct:  149 ASDRISLSRDLGPDTRPPECIEQTFRRCPPLPTTSVIIVFHNEAWSTLLRTVYSVLHTSPALLLKEVILVDDASIDGRLKGELDEYLKQL---HIVRVVRQLERKGLITARLLGASVATGDTLTFLDAHCECFHGWLEPLLARIAENYTAVVSPDITTIDLNTFEFMKPSPYGQNHNRGNFDWGLSFGWESLPDHEKQRRKDETYPIKTPAFAGGLFSISKDYFYHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIIPCSIVGHVFRTKSPHTFPKGTQVIARNQVRLAEVWMDDYKEIFYRRNQQASQMAKERSFGDVSKRLDLRERLQCKSFSWYLKNVYPEVFMPDLNPLQFGAIKNIGKDSCLDAGENNE---GGKTLIMYPC-HGMGGNQYFEY-------STHHEIRHN----IQKEL-CLHG--KDGAVKLEECQYKGHNTFAGAEQKWEL-REDQLFYNVAWKLCLSA-RYENPSLVT---CSSADRYQLW 622          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt12 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 [Source:ZFIN;Acc:ZDB-GENE-060503-704])

HSP 1 Score: 311.997 bits (798), Expect = 5.234e-99
Identity = 193/544 (35.48%), Postives = 291/544 (53.49%), Query Frame = 3
Query:  183 DYRLLRYQQYESLEMNRRGAGENGQAV--NLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYP-QNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSK-SNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCV------TELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            DY LL+   YE   ++    GE G+AV  NL  +EK   +  I K   +  VS RISLHR LP+  +  C+ K Y  + LPT SV+I FYNE W TLLRT+HSV+  SP   L EIILVDD+S +E ++  +  YI        V++ R+ KR G ++++L GA +A G+V+ FLD H E   GWLEP+L+R++    + V PV+  I+  TF +       + G F W + F W  +P H QK R++  D I++ T+  G+FA ++  F  +G++DT +  +G ENLE SFR+W CGG LE+ PCS +GH+   ++   R         NS R  +VW+D YK L+Y   P  R    G+++ R  LR  LQCK+F WF++NV P+  +P+     +G +KN   SN C D    +E         +Y C +G    Q F         +   +I+ N     R+   C  A  +NG +D++T        + + E Q + + +E+GS+ ++  ++CL+A    N   + +      N  Q W
Sbjct:    8 DYELLKRPVYEKPPLDSNALGEMGKAVRLNLEGEEKRKEEESINKHQINIYVSDRISLHRQLPEKWNPLCREKKYNYRQLPTTSVVIAFYNEAWSTLLRTVHSVLETSPDALLNEIILVDDYSDREHLRDRLEQYIATL---RKVRLVRARKREGLVRARLLGAGVATGDVLTFLDCHCECHVGWLEPLLERIAEEESAVVCPVIDVIEWNTFEYMGNAGEPQIGGFDWRLVFTWHTVPGHEQKRRKSPIDVIRSPTMAGGLFAVSKKYFDYLGTYDTGMEVWGGENLEFSFRIWQCGGTLEVHPCSHVGHVFPKQAPYSRSKAL----ANSVRAAEVWMDGYKELYYHRNPHARMEPFGDVTERRNLRERLQCKTFKWFLENVYPDIHVPEDRPGKFGMLKNRGLSNYCFDYNPPDENQVTGQRIILYGC-HGMGQNQFFEY-------TSEQEIRYNT----RQPEAC--AAVDNG-MDYLTMYYCHSKNSPVTENQKFDF-REDGSIFHILTQKCLEAVEQPNSGPLPLLRTCDGNTRQRW 528          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) [Source:ZFIN;Acc:ZDB-GENE-060929-998])

HSP 1 Score: 296.975 bits (759), Expect = 1.282e-93
Identity = 173/500 (34.60%), Postives = 256/500 (51.20%), Query Frame = 3
Query:  300 EILKIGYHNS-----VSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            E   +GY        +S R+  HR++PD R   C +K+YP  LPTASV+I FYNE    LLRT+HSV  R+PP  L E++LVDDFS    ++  +   ++ ++P   VK+ R+EKR G ++ ++ GA  A G+V++FLDSH EV   WLEP+L R++ N  + V P++  ++ +TF + +   L R G F W + F WD +P            PIK+ T+  G+FA +R  F  +G +D  +  +G ENLE+SFR+WMCGG LEI+PCS IGHI   R      +  D    NS R+  VWLD+YK  +   RPELRE   G++S R  LR  L C+ F W+++NV PE             ++  +  L   +L         +H      Q G    ++  L   K  ++ N+                   ++  G V    C +  IE Q+W+YN+  G  + L    CLD   ++      +  C  S   Q+W
Sbjct:   10 ETRDLGYQKHAFNLLISNRLDPHRTIPDTRHPRCATKSYPAQLPTASVVICFYNEAVSALLRTVHSVTERTPPALLHEVLLVDDFSDLVDLREGLEKELKEKFPKK-VKLVRNEKREGLIRGRMVGANHATGDVLVFLDSHCEVNVAWLEPLLARVAENPSTVVCPIIDIVNPDTFLY-SASPLVR-GGFNWGLHFRWDPVPSSLLSGPDGEMAPIKSPTMAGGLFAMDRKYFNKLGQYDGGMDIWGGENLEISFRIWMCGGSLEIIPCSRIGHIFRKRRPYGSPAGADTMSRNSLRLAHVWLDEYKEQYLALRPELREREYGDVSERKALRERLGCRPFRWYLQNVYPE-------------IEVGRPQLPQAVL-------SKMHKRPKPVQRG----RLRHLQTGKCLVAHND------------------PSEKGGLVVVRPCDSGDIE-QVWVYNE--GQELQLANLLCLDMPEMEPRASPRLMKCHGSGGSQQW 461          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008097.1 (pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1 gene:ENSPMAG00000007303.1 transcript:ENSPMAT00000008097.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 299.671 bits (766), Expect = 3.163e-93
Identity = 191/552 (34.60%), Postives = 297/552 (53.80%), Query Frame = 3
Query:  192 LLRYQQYESLEMNRRGA-GENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSL-PDFRSDECKSKNYPQ--NLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETF------AFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELRE----ANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDL-LVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCV----TELIET-QLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWE 1787
            L  +Q+  SL+ N  GA G   +  +L+ +EK   +  + K  ++   S ++SLHR L PD R  EC  + + +  ++P+ SVII F+NE W TLLRT+HSV+  SP   L+EIILVDD S+ + ++  +  Y++     GIVKV R ++R G + ++L GA +A G V+ FLD+H E   GWLEP+L R+  N  S V P +  ID+ TF      A+   H     G+F W + FGW+ +P   +  R+  + PI++ T   G+F+ ++  F  +G++D ++  +G EN+E+SFRVW CGG LEI+PCS +GH+   +S             N  R+ +VW+DDYK +FY    +  E       G+++ R +LR+ LQCK+F W++ NV PE F+PD +   +G +KN     CLD    QNE  +  +   +Y C +G    Q F  S  K       +++ N    + +E  CL A    G +    C     + L  T +LW    E     N+  +QCL +      +  T+ PC+  + +Q+WE
Sbjct:  107 LRPFQERPSLDANAPGASGRAYKTDDLSPEEKAIKEKGMEKHCFNVYASDKVSLHRDLGPDTRPPECIEQKFKRCPSMPSTSVIIVFHNEAWSTLLRTVHSVMYTSPSVLLKEIILVDDASVDDYLKGPLDEYVKQF---GIVKVVRQQERKGLITARLLGASVAQGEVLTFLDAHCECFNGWLEPLLARIRQNETSVVSPDISTIDMNTFEVNKPSAYSPAHNR---GNFDWGLTFGWEPIPSRERTLRKDQTYPIRSPTFAGGLFSISKKYFEYLGTYDDQMEIWGGENIEMSFRVWQCGGQLEIIPCSIVGHVFRTKSPHTFPQGVSVITRNLVRLAEVWMDDYKDIFYRRNSQAAEIVKNKAYGDVTWRKRLRDKLQCKNFTWYLTNVYPEMFVPDLHPNIFGAIKNKAKGNCLDTGSFQNEVGKPLI---LYPC-HGMGGNQYFEYSSQK-------ELRHN----VAKEM-CLHAAM--GAMHLEDCKYKGGSSLPPTYELWELRPEK-LFFNMGTQQCLTSKG----ENPTMAPCDHMDEHQQWE 629          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: poc1bl (POC1 centriolar protein homolog B (Chlamydomonas), like [Source:ZFIN;Acc:ZDB-GENE-050306-41])

HSP 1 Score: 296.204 bits (757), Expect = 2.381e-92
Identity = 180/538 (33.46%), Postives = 277/538 (51.49%), Query Frame = 3
Query:  210 YESLEMNRRGAGENGQAVNLTYKE-KMNMKIE---ILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYP-QNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSK-SNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTEL---IETQLWIYNKENGSLMNLKFKQCLDA-SNLKNMDRVTIQPCESSNPYQEWESQ 1793
            Y     + R  GE  +A  L   E     K+E   I +   +  +S RISLHR +PD R  ECK++ +  + LPT SV+I FYNE W TLLRT+HSV+  SP   LREIILVDDFS +  ++  + +YI        V++ R+ +R G ++++L GA  A G V+ FLD H E   GW+EP+L R+     + V PV+  ID  TF F  +      G F W + F W  +P+H +  R +  +PI++ T+  G+FA ++  F ++G++D  +  +G ENLELSFRVW CGG LE+ PCS +GH+   ++   R         N+ R  +VW+D YK  FY   P  R+   G++S R  LR  L CKSF+W++KN+ P+  +P+     +G ++N    + C+D    +    G +   +Y C +G    Q F  +  K       D++ N+  ++     C        +V    C  +      + +W + +E+G++ N     CL A         + I+PC   +  Q W  Q
Sbjct:   67 YSKPPPDERALGEWAKAARLNLPEGSSERKLEEESIERYALNIYLSDRISLHRHIPDGRMYECKAQKFDYRRLPTTSVVIAFYNEAWSTLLRTVHSVLESSPAVLLREIILVDDFSDRAYLKSPLEDYISTL---ERVRLVRTTQREGLVRARLLGATHATGQVLTFLDCHCECVPGWIEPLLQRIWEKETAVVCPVIDTIDWNTFEFYMQTSEPAIGGFDWRLTFQWHGVPEHERSRRASRIEPIQSPTMAGGLFAVSKKYFDHIGTYDQGMEVWGGENLELSFRVWQCGGSLEVHPCSHVGHVFPKKAPYPRPRFLQ----NTVRAAEVWMDSYKEHFYNRNPPGRKEKYGDLSERKTLREKLGCKSFEWYLKNIYPDLHVPEDRPGFHGAIQNKGIQSECIDYNAPDNNPTGAM-LSLYPC-HGQGGNQFFEYTTRK-------DLRFNSATEL-----CAEVRDGKPQVAMRHCPPDSQSNPPSVMWDF-REDGTVYNAHRNACLTAFRKPDGRADIEIRPCMPDDKNQMWTFQ 582          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000477.1 (pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 gene:ENSPMAG00000000418.1 transcript:ENSPMAT00000000477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 289.271 bits (739), Expect = 3.108e-91
Identity = 161/471 (34.18%), Postives = 264/471 (56.05%), Query Frame = 3
Query:  384 CKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTS-SDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLM--NLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            CK+K YP  LP  SV+I F+NE W TLLRT+HS++ RSP   L EIILVDD S ++ ++  +  Y  ++ P   V + R E R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  ETF +     +  +G F W ++F W  +P+     R+   + P+++ T+  G+FA +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + +   G++S R  LR+ L+CK F WF++NV P   IP R+    G V+N ++N CLD + + E    N   G+++C +   + Q+FS +  K               ++R +  CL  ++ NG V  + C   +   QLW Y+++   L+  +    QCLD +  ++    T++ C+     Q+W
Sbjct:    1 CKTKVYPDGLPKTSVVIVFHNEAWSTLLRTVHSIIGRSPRHMLEEIILVDDASERDFLKSPLEEY-ASKLPVP-VHIVRMESRSGLIRARLRGAAVSRGQVITFLDAHCECTTGWLEPLLARIKADRKNVVCPIIDVISDETFEYLAGSDMT-YGGFNWKLNFRWYPVPQSEMDRRKGDRTIPVRSPTMAGGLFAIDRDYFQEIGTYDAGMDIWGGENLEMSFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDNFKDFFYIISPGVTKVEYGDVSQRKALRDRLKCKPFSWFLENVYPNSQIP-RHYYSLGEVRNVETNQCLDNMGRKE----NEKIGIFNCHSMGGN-QVFSYTADK---------------ELRTDDLCLDVSRMNGPVLMLKC-HHMKGNQLWDYDQQMQKLIMRHTNSNQCLDKATEQDRQVPTMRECDGGRS-QQW 445          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV8])

HSP 1 Score: 342.813 bits (878), Expect = 1.844e-112
Identity = 166/391 (42.46%), Postives = 246/391 (62.92%), Query Frame = 3
Query:  318 YHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFS-------LQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQN 1469
            ++   S +++L RS+PD R   C S +YP  LPTASVII F+NE W TLLRT+HSV+ RSPP  LREI+LVDD S       L   ++  I+ + +       V++ R+ KR G ++++L GAK A G V++FLDSH E   GWLEP+L R+  N    V P +  ID+ TF + + H  +  G F W + F W  +P++ ++ R++ SDPI++ T+  G+FA ++  F+ +GS+DTE+ ++G EN+E+SFR+WMCGG LEI+PCS +GH+  +R S   K  +     N+ R+ +VW+DDYK++FY  RP+L+  + G++S R  LR  L CKSF W++ NV+ E  IPD   +G G ++N  +N CLD L +NE        G+Y C  
Sbjct:   15 FNELASSKVALDRSIPDNRPQSCLSLSYPTKLPTASVIIIFHNEAWSTLLRTVHSVLARSPPYLLREIVLVDDHSRLDTYGHLGSKLESYISQFTK-------VQLIRAPKREGLIRARLIGAKQAKGEVLVFLDSHCEANLGWLEPLLARIGENRSIVVTPDIEVIDLRTFGYTHEHGANNRGIFNWELTFKWRGIPEYERRRRKSDSDPIRSPTMAGGLFAIDKSYFYEIGSYDTEMSFWGGENVEISFRIWMCGGSLEIIPCSKVGHV--FRESQPYKIGEGAIDRNNMRLAEVWMDDYKKIFYAMRPQLKGKDYGDVSGRKALRERLMCKSFKWYLDNVISELAIPDLYPIGRGEIRNLGTNTCLDTLAKNE---AGGEPGMYMCHG 393          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV7])

HSP 1 Score: 340.887 bits (873), Expect = 4.436e-110
Identity = 184/491 (37.47%), Postives = 283/491 (57.64%), Query Frame = 3
Query:  330 VSKRISLHRSLPDFRSDECKSKN--YPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGL--NSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNN--DIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            +S +ISL R+L D RS+ CK+K+  YP  LPT SVII F+ E    LLRT+HSV+NR+PP+ L E+I+VDDFS    +   + +++        VKV R +KR G ++++L GA  A G+V+ FLDSH E T GW EP+L R++ + ++ V P +  I+ +TFA++     D+ G F W++ F W  +P   QK R   SDPI+T T+  G+F+ +R  FF++GS+D E+  +G ENLELSFRVWMCGG LEI+ CS +GH+    +S  +  +     L  N  R+ +VW+D+YK L+Y  +P+ + ++ G+IS R++LR  L+CKSF W++ N+ P+  +P+ +    G V+N  SN CLD L        N   G+Y+C +G    Q+    P +    + N  D+   +P                  V+ + C   +   Q W +++E G+LM+   +QCLD  +  +   V + PC+     Q W
Sbjct:   38 LSDKISLDRTLDDVRSERCKAKHNTYPAKLPTTSVIICFHKERLSVLLRTVHSVINRTPPELLAEVIVVDDFSQDAKLGKPLDDHVAQF---TKVKVLRMKKREGLVRARLQGANTAKGDVLTFLDSHCEATPGWAEPLLARIAADRRNVVCPAIEVINADTFAYQGSTNADQRGGFSWDLFFKWKGIPPEEQKLRNDDSDPIRTPTMAGGLFSIHRQYFFDIGSYDEEMDIWGGENLELSFRVWMCGGRLEIVTCSRVGHVFRKYTSPYKFPDGVERTLTKNFNRLAEVWMDEYKDLYYNKKPQAKNSDYGDISKRLELRKRLKCKSFKWYINNIYPDVQMPELDPPARGEVRNPSSNQCLDSLGAKP--EHNARVGIYTC-HGQGGNQVSKYMPRELIFEEENCFDVSKTHP---------------GAPVELMKC-HGMRGNQEWKHDREKGTLMHFTTQQCLDRGSPSDQYAV-MNPCDGRE-SQRW 504          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO43861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXK4])

HSP 1 Score: 320.472 bits (820), Expect = 1.751e-103
Identity = 162/419 (38.66%), Postives = 258/419 (61.58%), Query Frame = 3
Query:  252 GQAVNLT--YKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYR---SSIVRKS-NKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQI 1490
            G+AV++    KEK     E+    ++   S  +SL+R LPD+R+D CK+K YP +LP +S+II F+NE W TLLRT+HSV+NR+PP+ L EI+L+DD S ++ ++  +  Y+       +V++ R  KR G ++++L GA  A G+++ FLD+H E +KGWLEP+  +++ N  + V+PV+ EI   TF +    +    G F W ++FGW  +P++  + R+  +D I+T  +  G+F+ ++  F  +G++DT +  +G ENLE+SFR+WMCGG +E+LPCS +GH+   R   S   R   N D    N  R+ DVW+D+YK+ FY  R +L+     ++S R+ LR  L+CK+F W++ NV PE  +PD N    G V+N  S++CLD L + +    +   G+Y C +G    Q+
Sbjct:    4 GEAVSVPKRLKEKEEEGYELH--SFNLVASDMMSLYRRLPDYRNDACKAKKYPLHLPKSSIIICFHNEAWSTLLRTVHSVINRTPPRLLEEILLIDDASNRDELKEKLEEYVAKL---KVVRIIRLSKRQGLIRARLKGAAAAKGSILTFLDAHCECSKGWLEPLAAKIAENSSNVVMPVIDEISDTTFYYHAVPEPFHRGVFRWRLEFGWKPVPQYEMERRKDEADGIRTPVMAGGLFSIDKNYFEKIGTYDTGMDIWGGENLEISFRIWMCGGAIEMLPCSRVGHVFRPRFPYSFPARPGHNTDVVSNNLMRVADVWMDEYKKHFYNIRFDLKRKQHDDVSQRLALREKLKCKNFKWYLDNVYPELEVPDTNFAASGQVRNPSSDMCLDTLGKKD----DTPLGLYQC-HGQGGNQV 412          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO37266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG81])

HSP 1 Score: 315.849 bits (808), Expect = 1.153e-100
Identity = 185/525 (35.24%), Postives = 299/525 (56.95%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKN--YPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVR--KSNKDYHGLNSKRMVDVWLDDYKRLFYLYRP-ELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKF--IPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNN--GKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G G+ G+A  L  + K +         ++  +S RISL R L D R  +CK K+  YP+ LPT SVII F+NE    LLRT+HSV+N SPP+ + +IILVDD+S  + ++  + ++I        VK+ R   R G + ++L GA+ A G V+ FLDSH E T GWLEP+L R++ + ++ V PV+  I+ + F ++    +   G F W++ F W  +P+  +K R+  +D I++ T+  G+FA ++  F+++GS+D+++  +G ENLE+SFR+WMCGG LEI+PCS +GH+    +S  +  K        N  R+ +VW+D+YK  +Y  +  E R  + G+IS R+ LR  L CKSF W++ N+ P+    +P ++ L    ++N +S+LCLD L +    R     G+Y+C +G    Q F+L       + +N+I  N+         CL +   +    V+ ITC   L   Q W +NK  G+++++  + CLD S  ++   + + PC+ S+  Q W
Sbjct:    1 GLGDLGEAATLPTRFKEHAAHAFDNHSFNVMLSDRISLDRRLKDVRGPKCKRKHKLYPRALPTTSVIICFHNEALSVLLRTVHSVLNESPPRLIADIILVDDYSEYDDLKQPLIDHISML---NKVKLIRMPSRQGLVPARLRGAEEARGEVLTFLDSHCEATPGWLEPLLVRIAEDRRNVVCPVIEVINADDFRYQASDVIHERGGFTWDLFFTWKAIPEAEKKRRKDETDYIRSPTMAGGLFAIHKKYFYDLGSYDSKMEIWGGENLEMSFRIWMCGGQLEIVPCSRVGHVFRKYTSPYKFPKGTTTTLARNFNRLAEVWMDEYKDHYYRKKTEEERNVDIGDISDRVALRKRLGCKSFKWYLDNIYPDMTNKLPPKSYLYSHQIRNKESSLCLDTLGEKNIKR----VGLYTC-HGMGGNQFFTL-------TKSNEILFNDD-------KCLDSPNGDPGSYVEMITC-HGLKGNQEWKHNKRMGTIVHVWTENCLDIS--QDGQFIIVNPCDGSST-QRW 499          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO31035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ28])

HSP 1 Score: 302.368 bits (773), Expect = 4.457e-96
Identity = 155/412 (37.62%), Postives = 245/412 (59.47%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNK-DYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQN 1469
            G GENG+ V    +++        + G++  VS +ISL R++ D R   CK ++YP NLP ASV+I F+NE W TL+RT+H+V+ RSPP  L+EI++VDDFS ++ ++  + +Y +     G +K+ R+++R G +K+++ GA  A+G V+IFLD+H E  KGWL P+L+R++ N ++ V P +  ID +TF +K      R G+F W  D+    +      +RR  +  +K+  +  G+FA NR  F  +G +D  +  +G E  E+SF++W CGG LE +PCS +GH+  YR  +     K D   +N +R+ +VW+D+YK   Y  RPE++  + G+IS RI LR  L+CKSF W+++NV  +       +     V+N   N+CLD +      R + H G+ SC N
Sbjct:    1 GPGENGEPVETKAEDESKKDAAYSEFGFNQFVSDQISLERTISDTRHQACKQRSYPINLPKASVVIVFHNEGWSTLMRTVHTVLLRSPPHMLQEIVMVDDFSNKDFLKQKLDDYTKKL---GKIKIVRTKERVGLIKARVIGANNAVGEVVIFLDAHCECNKGWLPPLLERIALNRRTAVCPTIDFIDHKTFQYKPMDPYIR-GTFNWRFDYKERAVRPEEMAKRRDPTQEVKSPVMAGGLFAINREFFSELGQYDPGMFIWGGEQYEISFKLWQCGGQLENIPCSRVGHV--YRHHVPYTYPKHDATLVNFRRVAEVWMDEYKDWLYDKRPEIKSVDYGDISDRIALRKRLKCKSFKWYLENVANDTV--KTKLCACFQVRNQGKNMCLDSM-----GRKDGHVGLASCHN 399          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 335.495 bits (859), Expect = 5.002e-107
Identity = 187/528 (35.42%), Postives = 304/528 (57.58%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTS-SDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            +SL   R G GE G+ V +  + +  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LP  SV+I F+NE W TLLRT+HSV++RSP   L EI+LVDD S ++ ++  +  Y++  E P   V+V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+   + P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R  LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L+++   QCLD ++ ++    +++ C      Q+W
Sbjct:   47 DSLSRPRDGPGEGGKPVVIPKENQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRRLEVP---VRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWEYDPVKLTLVHVNSNQCLDKASEEDSQVPSVRDCTHVRS-QQW 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 335.495 bits (859), Expect = 5.002e-107
Identity = 187/528 (35.42%), Postives = 304/528 (57.58%), Query Frame = 3
Query:  213 ESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTS-SDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIV-RKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            +SL   R G GE G+ V +  + +  MK E+ KI   N   S+ I+L+RSLPD R + CK+K YP +LP  SV+I F+NE W TLLRT+HSV++RSP   L EI+LVDD S ++ ++  +  Y++  E P   V+V R E+R+G ++++L GA ++ G VI FLD+H E T GWLEP+L R+  + ++ V P++  I  +TF +     +  +G F W ++F W  +P+     R+   + P++T T+  G+F+ +R  F  +G++D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+    +              N++R+ +VW+D++K  FY+  P + + + G+IS+R  LR  LQCK F W+++N+ P+  IP R+    G ++N ++N CLD + + E    N   G+++C +G    Q+FS +  K               +IR +  CL  +K NG V  + C   L   QLW Y+    +L+++   QCLD ++ ++    +++ C      Q+W
Sbjct:   47 DSLSRPRDGPGEGGKPVVIPKENQEKMK-EMFKINQFNLMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRRLEVP---VRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIP-RHYYSLGEIRNVETNQCLDNMARKE----NEKVGIFNC-HGMGGNQVFSYTANK---------------EIRTDDLCLDVSKLNGPVMMLKC-HHLKGNQLWEYDPVKLTLVHVNSNQCLDKASEEDSQVPSVRDCTHVRS-QQW 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 331.257 bits (848), Expect = 1.751e-105
Identity = 185/522 (35.44%), Postives = 300/522 (57.47%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSI---VRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+AVN+   ++  MK E+ KI   N   S  I+L+RSLPD R D CK+K Y  +LPT S++I F+NE W TLLRT+HSV++RSP   L EI+LVDD S ++ ++  +  Y++  E P   VK+ R E+R+G ++++L GA    G VI FLD+H E T+GWLEP+L R+  +  + V P++  I  ETF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +++ F  +GS+D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+  +R +               N++R+ +VW+D++K  FY+  P +   + G++SSR  LR +L+CK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   56 GPGEMGKAVNIAKDDQEKMK-ELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVP---VKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHV--FRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 331.257 bits (848), Expect = 1.751e-105
Identity = 185/522 (35.44%), Postives = 300/522 (57.47%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSI---VRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+AVN+   ++  MK E+ KI   N   S  I+L+RSLPD R D CK+K Y  +LPT S++I F+NE W TLLRT+HSV++RSP   L EI+LVDD S ++ ++  +  Y++  E P   VK+ R E+R+G ++++L GA    G VI FLD+H E T+GWLEP+L R+  +  + V P++  I  ETF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +++ F  +GS+D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+  +R +               N++R+ +VW+D++K  FY+  P +   + G++SSR  LR +L+CK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   56 GPGEMGKAVNIAKDDQEKMK-ELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVP---VKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHV--FRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 331.257 bits (848), Expect = 1.751e-105
Identity = 185/522 (35.44%), Postives = 300/522 (57.47%), Query Frame = 3
Query:  237 GAGENGQAVNLTYKEKMNMKIEILKIGYHN-SVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQN-EWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSD-PIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSI---VRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEW 1784
            G GE G+AVN+   ++  MK E+ KI   N   S  I+L+RSLPD R D CK+K Y  +LPT S++I F+NE W TLLRT+HSV++RSP   L EI+LVDD S ++ ++  +  Y++  E P   VK+ R E+R+G ++++L GA    G VI FLD+H E T+GWLEP+L R+  +  + V P++  I  ETF +     +  +G F W ++F W  +P+     R+     P++T T+  G+F+ +++ F  +GS+D  +  +G ENLE+SFR+W CGG LEI+ CS +GH+  +R +               N++R+ +VW+D++K  FY+  P +   + G++SSR  LR +L+CK F W+++N+ P+  IP R     G ++N ++N C+D + + E    N   G ++C +G    Q+FS +  K               +IR +  CL  ++ NG V  + C   +   Q++ Y+ E  +L+++   QCLD  + ++    T++ C  S   Q+W
Sbjct:   56 GPGEMGKAVNIAKDDQEKMK-ELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVP---VKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMT-YGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHV--FRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIP-RRYYSLGEIRNVETNQCVDNMGRKE----NEKVGFFNC-HGMGGNQVFSYTADK---------------EIRTDDLCLDVSRLNGPVVMLKC-HHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRS-QQW 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000011837.1 (SMESG000011837.1)

HSP 1 Score: 798.119 bits (2060), Expect = 0.000e+0
Identity = 383/598 (64.05%), Postives = 460/598 (76.92%), Query Frame = 3
Query:   36 MKIYVKHKNLIFCIGIFCGFLGIFEFIYKQYVNKTN--------LMLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWESQFGPQ 1805
            M+I+ K+K ++ CI I  G   I    +K   +K N          L  L IN+ST++YR  RY  Y + +  ++G GENG+ V+LT +E  N+   + K  ++   S RISL RSLPDFR+ ECK+  Y ++LPT SVII F+NE W  LLRT HSVVNRSPP+ L+E+IL DD S +  +   +  Y++ +WPD +V++ RS+ R G ++++L GAK A G V++FLDSH EVT GWLEPIL R+    ++ ++P++  ID + F++     + + G+FWW+M F W ++P+HF+KE +  +D +K+ T+  G+FA++R  FF +GS+D  +  +G ENLE+SFR WMCGG LE  PCS +GHI           NKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWESQFGPQ
Sbjct:    1 MRIHFKNKKILICITILFGIFLITHNKFKISDSKLNNDLNVKDTSFLLALGINISTYNYRANRYHIYNTNQYYQKGPGENGELVSLTDEENKNLDDVMKKEAFNRPTSDRISLQRSLPDFRNSECKAFIYSESLPTTSVIIIFHNEAWSALLRTAHSVVNRSPPRFLKEVILFDDSSYKVGLGTELEAYVKTQWPDNVVRIVRSKIRLGLIRARLEGAKAAFGEVLVFLDSHCEVTTGWLEPILFRIHQKRETMIVPIIESIDAKHFSYYGSTDVGQVGTFWWSMHFTWQDIPEHFKKEIKLKTDTVKSATMAGGLFASDRQYFFEIGSYDEGMEIWGGENLEISFRTWMCGGTLETHPCSHVGHIFRATHPYTFPGNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWESQFGPQ 598          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000011839.1 (SMESG000011839.1)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 332/332 (100.00%), Postives = 332/332 (100.00%), Query Frame = 3
Query:  147 MLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKS 1142
            MLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKS
Sbjct:    1 MLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKS 332          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000011839.1 (SMESG000011839.1)

HSP 1 Score: 356.681 bits (914), Expect = 1.183e-120
Identity = 171/172 (99.42%), Postives = 172/172 (100.00%), Query Frame = 3
Query:   36 MKIYVKHKNLIFCIGIFCGFLGIFEFIYKQYVNKTNLMLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQE 551
            MKIYVKHKNLIFCIGIFCGFLGIFEFIYKQYVNKTNLMLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQ+
Sbjct:    1 MKIYVKHKNLIFCIGIFCGFLGIFEFIYKQYVNKTNLMLQKLKINLSTFDYRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQD 172          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000081451.1 (SMESG000081451.1)

HSP 1 Score: 310.071 bits (793), Expect = 4.900e-97
Identity = 180/521 (34.55%), Postives = 284/521 (54.51%), Query Frame = 3
Query:  222 EMNRRGAGENGQAV-----NLTYKEKMNMKIEILKIGYHNSVSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAF-KNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNNDIKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLMNLKFKQCLDASNLKNMDRVTIQPCESS 1766
            ++ R   GE+G+ V     NLT +EK    +      ++   S  IS+HR LPD R +ECK+  Y   LP  SVI+ F+NE W  LLR++HS++NRSP   L+E+ILVDDFS  E ++  +  YI       IVK+ R+ KR G ++++L GA  A G V+ FLDSH+E T+GWLEP+LD ++ ++++  +PV+  I  +T  +  +  K  + G F WN+ F W  +P    K  R  +DP+ T T+  G+F+ ++  F ++G +D     +G ENLELSF++WMCGG++ I+PCS +GHI   RS    K   +   +N  R+ +VWLD+YK  +Y+ R      + GNIS R+ LR +LQCK F W++ N+ P+ F+P  + L  G ++N    +C+D  +        + +  Y C N   + Q + LS                  +IRR+  CL    +  ++    C   L   Q W Y  E+  +  +    C++ +  +  D++ + PC +S
Sbjct:   81 DLKRILPGEDGKPVVIDVKNLTKEEKEKFDLGWKNNAFNEYASNLISIHRHLPDMRDEECKNYKYATKLPETSVILCFHNEAWSVLLRSVHSIINRSPKHLLKEVILVDDFSSMEHLKSPLEEYISQL---KIVKIVRATKREGLIRARLLGASAASGEVLTFLDSHIECTEGWLEPLLDPIAQSWKNVTVPVIDVISDDTLQYMHSSAKQVQVGGFSWNLIFNWHVIPDR-DKIGRKPTDPVNTPTMAGGLFSISKKYFDHLGGYDPGFDIWGGENLELSFKIWMCGGIMRIIPCSSVGHIFRKRSPYSWKPKVNVLKVNLVRLAEVWLDEYKEFYYM-RINHDLGDYGNISERVALRKNLQCKPFKWYLDNIYPDLFVPS-DALNSGEIRNMVKPMCVDGNIDGHDQTVPIIS--YPCHNQGGN-QFWMLSKTG---------------EIRRDLSCLDF--DGKQLTGYPCHGAL-GNQFWKY-MESKQIRQMNHNLCIELA--EKDDKLIMAPCSNS 571          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000081429.1 (SMESG000081429.1)

HSP 1 Score: 302.368 bits (773), Expect = 4.539e-94
Identity = 154/400 (38.50%), Postives = 240/400 (60.00%), Query Frame = 3
Query:  225 MNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNS-----VSKRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSVVNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRNGALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPVVMEIDVETFAFKNRH-KLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIKTGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEILPCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPELREANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNSKSNLCLD 1406
            +N +  GENG A  +         +     G+ N      +S +IS+ R+LPDFR  +C S  Y  NLP  SVII F+NE W  LLR++HS+++RSP   L+EIILVDDFS  + ++  +  Y+       IVK+ R+ +R G +++++ G++ A G ++ FLDSH+E T GWLEP+LD ++ N+ +  IPV+  ID  TF F ++  +  + G F W++ F W  +P    K  R  +DP+ + T+  G+F+ ++  F  +G +D     +G ENLE+SF++WMCGG L I+PCS +GHI   +S     S KD+   N  R+ +VWLDDYK+ FY  R +   +  G++S RI LR +L C +F W++ N+ P+ FIP  + +  G +KN  +N+C++
Sbjct:   95 INNKMLGENGIAEYVNETNISPSDLSRYNEGWKNYCFNEFLSNKISITRNLPDFREKQCFSYKYSDNLPQTSVIICFHNEAWSVLLRSVHSIISRSPKNLLKEIILVDDFSHLDHLKSQLEEYMAQL---KIVKIVRTTQREGLIRARMIGSRTATGEILTFLDSHIECTPGWLEPLLDPIAQNWSNVTIPVIDNIDKSTFEFAHQSSEYIQVGGFTWDLVFTWHYIPTR-DKVGRLPTDPVNSPTMAGGLFSISKKYFEYLGEYDPGFDIWGGENLEISFKIWMCGGTLRIVPCSVVGHIFRMKSPYSSTSKKDFLKNNLVRLAEVWLDDYKQ-FYYSRIKFNRSEIGDLSDRINLRKNLNCHNFKWYIDNIYPDMFIP-SDAVNKGEIKNLATNICIE 488          
The following BLAST results are available for this feature:
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT16.047e-11035.98polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
GALNT131.580e-10635.95polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNT136.019e-10135.11polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNT35.072e-10035.58polypeptide N-acetylgalactosaminyltransferase 3 [S... [more]
GALNT62.447e-9535.34polypeptide N-acetylgalactosaminyltransferase 6 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-92.799e-12339.12Probable N-acetylgalactosaminyltransferase 9 [Sou... [more]
gly-53.060e-10336.07Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-53.060e-10336.07Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-53.060e-10336.07Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-55.429e-10335.63Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgant11.784e-10834.13gene:FBgn0034025 transcript:FBtr0087331[more]
Pgant11.784e-10834.13gene:FBgn0034025 transcript:FBtr0087332[more]
Pgant58.878e-10335.50gene:FBgn0031681 transcript:FBtr0111024[more]
Pgant55.623e-9934.51gene:FBgn0031681 transcript:FBtr0079026[more]
Pgant92.458e-9435.38gene:FBgn0050463 transcript:FBtr0087113[more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt14.405e-10735.77UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt14.405e-10735.77UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt131.462e-10535.63UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
GALNT32.125e-10135.93UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt131.241e-10036.83UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt18.854e-11136.93polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt13.956e-11036.95polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt14.635e-11037.12polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt15.806e-11037.12polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt16.715e-11035.74polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galnt16.933e-11035.98polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt16.933e-11035.98polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt16.933e-11035.98polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt135.983e-10535.56polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
Galnt135.983e-10535.56polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U2C4|GALT9_CAEEL3.561e-12239.12Probable N-acetylgalactosaminyltransferase 9 OS=Ca... [more]
sp|Q10472|GALT1_HUMAN2.904e-10935.98Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q07537|GALT1_BOVIN4.358e-10935.98Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|O08912|GALT1_MOUSE4.849e-10935.98Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q29121|GALT1_PIG7.356e-10935.98Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ENR02.680e-16142.47Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A267ENX55.600e-16142.47Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A1I8GE261.128e-15042.34Ricin B-type lectin domain-containing protein OS=M... [more]
A0A1I8GCD21.497e-14643.82Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A2C9JSS32.788e-14641.99Polypeptide N-acetylgalactosaminyltransferase OS=B... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt12.653e-10735.77polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt132.866e-10535.51polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt131.858e-10435.25polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
poc1bl3.370e-9933.75polypeptide N-acetylgalactosaminyltransferase 4 [S... [more]
GALNT36.690e-9837.60polypeptide N-acetylgalactosaminyltransferase 3 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt125.234e-9935.48UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt111.282e-9334.60UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
ENSPMAT00000008097.13.163e-9334.60pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1... [more]
poc1bl2.381e-9233.46POC1 centriolar protein homolog B (Chlamydomonas),... [more]
ENSPMAT00000000477.13.108e-9134.18pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 ... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458301.844e-11242.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458294.436e-11037.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438611.751e-10338.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372661.153e-10035.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310354.457e-9637.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt15.002e-10735.42polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt15.002e-10735.42polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt131.751e-10535.44polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt131.751e-10535.44polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt131.751e-10535.44polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011837.10.000e+064.05SMESG000011837.1[more]
SMESG000011839.10.000e+0100.00SMESG000011839.1[more]
SMESG000011839.11.183e-12099.42SMESG000011839.1[more]
SMESG000081451.14.900e-9734.55SMESG000081451.1[more]
SMESG000081429.14.539e-9438.50SMESG000081429.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029643 ID=SMED30029643|Name=Polypeptide N-acetylgalactosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1938bp
GTTTAAATCTATGAAATAAATTGACTGAATTTCCAATGAAAATTTATGTC
AAACACAAAAATTTGATATTTTGCATTGGAATATTTTGTGGATTTTTGGG
AATTTTTGAGTTCATTTATAAGCAATATGTAAATAAAACGAATTTGATGT
TACAAAAATTGAAGATCAATTTATCAACATTTGATTATCGGTTGTTGAGA
TATCAACAGTATGAATCTTTGGAAATGAATCGACGAGGAGCCGGTGAAAA
TGGACAAGCAGTCAATTTAACCTATAAAGAAAAGATGAATATGAAAATTG
AGATCTTAAAAATCGGATATCATAATTCTGTTAGTAAACGAATATCATTG
CACAGATCTCTTCCGGATTTTAGAAGCGACGAATGCAAATCAAAAAACTA
TCCTCAGAATTTACCGACTGCAAGTGTTATTATAACATTTTATAATGAGT
TATGGCCAACTTTGTTGCGCACAATCCATTCGGTGGTCAATCGTTCTCCG
CCGCAACATTTGCGTGAAATCATTCTGGTTGATGATTTCAGTTTGCAGGA
GGTAATGCAGGTAAATATAACTAATTATATTCAAAATGAGTGGCCCGATG
GTATTGTAAAAGTTTTCCGATCTGAAAAACGAAACGGAGCGCTTAAGTCA
AAATTAACGGGAGCAAAATTGGCTATTGGGAATGTGATTATATTTCTTGA
CAGTCATGTAGAAGTGACCAAAGGATGGCTAGAACCGATATTGGACCGGT
TAAGCCATAACTACCAGTCATTCGTAATTCCAGTGGTCATGGAGATCGAC
GTTGAAACCTTTGCATTTAAAAATCGCCATAAACTTGATAGATTTGGCTC
ATTTTGGTGGAACATGGACTTTGGGTGGGATGAAATGCCAAAACATTTTC
AAAAAGAAAGAAGAACAAGTAGCGATCCCATTAAAACTGGAACGCTTCCC
ATTGGGATCTTTGCTGCTAATAGAATCAATTTCTTTAATATGGGATCTTT
CGACACTGAATTGATTTGGTATGGCTCGGAGAATCTGGAACTTTCATTTA
GGGTATGGATGTGTGGTGGAATGCTGGAGATACTTCCATGCTCTTGTATT
GGACACATTGCTCACTATCGCTCCTCTATTGTGAGGAAAAGTAATAAAGA
TTATCACGGATTAAATTCCAAACGAATGGTGGATGTTTGGCTGGATGATT
ACAAAAGGTTATTCTATTTATATCGGCCTGAATTACGTGAAGCTAATGCA
GGCAATATATCGAGTCGAATAAAATTGCGCAACAGTCTCCAATGTAAATC
ATTCGATTGGTTTGTAAAGAATGTTGTGCCTGAAAAATTTATTCCTGACA
GAAATATCCTGGGATATGGTTATGTAAAAAATTCGAAATCTAATCTATGT
TTGGATTTGTTGGTACAAAATGAATTCGATCGAGGTAACTTGCACACGGG
GGTTTATTCCTGTCAGAATGGTGCTAGTTCTGCACAGATATTTTCACTTT
CCCCCGTTAAATATTCAATAAGTGACAACAATGACATCAAAGCAAATAAT
CCCTGTCAAATACGTAGGGAATGGGGTTGTCTAACAGCTACCAAAAATAA
TGGAAAAGTGGATTTCATTACTTGTGTGACAGAATTAATAGAAACGCAAT
TATGGATTTATAATAAAGAAAATGGCAGCCTTATGAATCTGAAGTTTAAG
CAATGTTTAGATGCAAGTAATTTGAAAAATATGGACAGGGTTACCATTCA
GCCATGTGAATCAAGCAATCCTTATCAGGAATGGGAATCTCAATTCGGGC
CACAATGAGGAATAGCACTCTATTTATTCTTTCATTTCTAGTTGTTTCTG
GTGCTACGAAGAATTAGTTAAATATTATCAAATTATGTAATATTTTTATA
TTTAGAATTAAATATTTTGAAATTTTGTTTGTATTTTG
back to top

protein sequence of SMED30029643-orf-1

>SMED30029643-orf-1 ID=SMED30029643-orf-1|Name=SMED30029643-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=591bp
MKIYVKHKNLIFCIGIFCGFLGIFEFIYKQYVNKTNLMLQKLKINLSTFD
YRLLRYQQYESLEMNRRGAGENGQAVNLTYKEKMNMKIEILKIGYHNSVS
KRISLHRSLPDFRSDECKSKNYPQNLPTASVIITFYNELWPTLLRTIHSV
VNRSPPQHLREIILVDDFSLQEVMQVNITNYIQNEWPDGIVKVFRSEKRN
GALKSKLTGAKLAIGNVIIFLDSHVEVTKGWLEPILDRLSHNYQSFVIPV
VMEIDVETFAFKNRHKLDRFGSFWWNMDFGWDEMPKHFQKERRTSSDPIK
TGTLPIGIFAANRINFFNMGSFDTELIWYGSENLELSFRVWMCGGMLEIL
PCSCIGHIAHYRSSIVRKSNKDYHGLNSKRMVDVWLDDYKRLFYLYRPEL
REANAGNISSRIKLRNSLQCKSFDWFVKNVVPEKFIPDRNILGYGYVKNS
KSNLCLDLLVQNEFDRGNLHTGVYSCQNGASSAQIFSLSPVKYSISDNND
IKANNPCQIRREWGCLTATKNNGKVDFITCVTELIETQLWIYNKENGSLM
NLKFKQCLDASNLKNMDRVTIQPCESSNPYQEWESQFGPQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000772Ricin_B_lectin
IPR029044Nucleotide-diphossugar_trans
IPR001173Glyco_trans_2-like
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001173Glycosyltransferase 2-likePFAMPF00535Glycos_transf_2coord: 130..293
e-value: 7.8E-27
score: 94.1
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 52..366
e-value: 2.6E-104
score: 351.0
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 89..364
NoneNo IPR availablePANTHERPTHR11675N-ACETYLGALACTOSAMINYLTRANSFERASEcoord: 61..359
NoneNo IPR availablePANTHERPTHR11675:SF43POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 1coord: 61..359
NoneNo IPR availableTMHMMTMhelixcoord: 9..28