Neurensin-1

Overview
NameNeurensin-1
Smed IDSMED30029642
Length (bp)820
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neurensin-1 (SMED30029642) t-SNE clustered cells

Violin plots show distribution of expression levels for Neurensin-1 (SMED30029642) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neurensin-1 (SMED30029642) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neurensin-1 (SMED30029642) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029642

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029642SMESG000011024.1 SmedASXL_005795SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30029642SMESG000011024.1 dd_Smed_v4_4743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029642SMESG000011024.1 dd_Smed_v4_4743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029642SMESG000011024.1 dd_Smed_v4_4743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30029642SMESG000011024.1 Contig38021newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029642SMESG000011024.1 Contig38021uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029642SMESG000011024.1 Contig30181newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029642SMESG000011024.1 Contig30181uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30029642SMESG000011024.1 dd_Smed_v6_4743_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029642SMESG000011024.1 OX_Smed_1.0.10016ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neurensin-1 vs. TrEMBL
Match: R7UUQ6 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183585 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 6.018e-20
Identity = 77/212 (36.32%), Postives = 119/212 (56.13%), Query Frame = 3
Query:  153 TSLD--TDKIKPEENRKKCAP-FGVKSYLHNFYGPISSNKGGTIFEDPA-----EECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPKKPDYVLGEKNQL-VTNHEAKVFNNNLEIVKXXXXXXXXXXXXXXXXXXXXXXXXWKHCFDADRISEPTDFQSTEDKPIATKIAVSNFPECISTKLDKVQPERKENESVAA 761
            +SLD   + ++ E++ ++C   FGV+SYLH+FY          +++DPA     ++  YLL  +    + C  I WK  +WIG NFLIFG++G+LV Y VP++P +     N L + +++A  FN NL++ KLVGL+ FCIGG      LL P+ L+ +C D DR  +       E  P+ + + +   P C  + + +VQP RK  ESV  
Sbjct:   70 SSLDKVDEDLEKEKSEQRCTDYFGVRSYLHDFYDT-------HVYKDPAVYEEEDDFRYLLNPRLGRGRRCTSIWWKVFVWIGANFLIFGIIGVLVGYLVPQRPIFAGAYDNNLEILDNQAIAFNFNLDVCKLVGLILFCIGGLTLAAALLFPSFLYHYCED-DRKEDSIRIHVGEKDPLKSPVEMV-VPTC--STVTEVQPVRKNLESVVT 270          
BLAST of Neurensin-1 vs. TrEMBL
Match: V3ZSQ9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_203912 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.973e-16
Identity = 72/194 (37.11%), Postives = 113/194 (58.25%), Query Frame = 3
Query:  183 EENRKKCA-PFGVKSYLHNFYGPISSNKGGTIFEDPAEECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPKKPDYV--LGEKNQLV-TNHEAKVFNNNLEIVKXXXXXXXXXXXXXXXXXXXXXXXXWKHCFDADRISEPTDFQSTEDKPIATKIAVSNFPECISTKLDKVQPERKENES 752
            +++++KC   FGVKSYLHNFY    + K   ++E+  ++  YLL    + R+ C PI WK  +W+G+N L+FGV+GILV Y VP K D++  + E N +   +  A+ +N  L++ KL+GL+ FC+GG    + LL P+ L  +C +  R           +KP  + I + N P C  +KL  VQP+RK  ++
Sbjct:   47 DKHKRKCPLNFGVKSYLHNFYE-THAFKDPQVYEEDDDDFRYLLNH--NPRRRCPPIWWKIFLWLGVNLLLFGVIGILVGYLVPPK-DHLEKVDEDNAIAYVDRNAEAYNTTLDMCKLIGLILFCVGGMTLALSLLFPSFLSHYCEEDPRDEAIKVPLRGNEKPPLSPIEM-NIPAC--SKLKGVQPDRKSPQA 233          
BLAST of Neurensin-1 vs. TrEMBL
Match: A0A3S1BNP1 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_007200 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 4.122e-15
Identity = 76/221 (34.39%), Postives = 111/221 (50.23%), Query Frame = 3
Query:  192 RKKCAP--FGVKSYLHNFYGPISSNKGGTIFEDPAEECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPKKPDYVL------------GEKNQLVT---NHEAKVFNNNLEIVKXXXXXXXXXXXXXXXXXXXXXXXXWKHCFDADRISEPTDFQST-----------EDKPIATKIAV---SNFPECISTKLDKVQPERKENESVAA 761
            RK+  P  FGVKSYLH+FY   +S K   ++ED  ++  YLL+  +  R+ C PI WK  +W+G+ FL+FGV+GILV Y V   P +VL             EK    T   +  A+ +N  L++ KLVGL+ F +GG    + LL P  L  HC D D      D +             + KP   + A+   S  P   S+K+ +VQP +  ++ + A
Sbjct:    3 RKRSCPVYFGVKSYLHHFYDDGNSYKDPALYED--DDHRYLLQPDQRRRR-CAPIWWKIFMWLGVTFLLFGVIGILVGYLV--SPRHVLITHSSSSSSSSQSEKEGAGTAYIDERAQAYNVTLDMSKLVGLILFTLGGVTLAMALLFPAFLTHHCLDEDLYDHEPDLREVPGGYSKHHHHRQGKPGGAEGALLEQSTIPA--SSKVKEVQPTKNPDQQMLA 216          
BLAST of Neurensin-1 vs. TrEMBL
Match: A0A1S3K458 (LOW QUALITY PROTEIN: neurensin-1-like OS=Lingula unguis OX=7574 GN=LOC106178426 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.980e-14
Identity = 45/114 (39.47%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  183 EENRKKCAP-FGVKSYLHNFYGPISSNKGGTIFEDPAEECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPKKPDYVLGEKNQLVTNHEAKVFNNNLEIVK 521
            E+ R  C+  FGVKSYLH FY   S  K   ++E+  ++ +YLL+   + RK+CR + WK   WIG++ L+ G+VGILV Y  PKK   +  +    V + +A  +N N + VK
Sbjct:   70 EDKRTGCSDYFGVKSYLHYFYE--SGFKDPKVYEE--DDSAYLLRPN-NRRKWCRSVWWKVFSWIGVSLLVIGLVGILVGYVTPKKAHIIEKDGETAVIDKDAIYYNYNFDAVK 178          
BLAST of Neurensin-1 vs. TrEMBL
Match: A0A0B7A7T6 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF98107 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.182e-14
Identity = 49/134 (36.57%), Postives = 78/134 (58.21%), Query Frame = 3
Query:  135 MAGLEATSLDTDKIKPEENRKKCAPFGVKSYLHNFYGPISSNKGGTIFEDPAEECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPKKPDYVLGEK-----NQLVTNHEAKVFNNNLEIVK 521
            + G +  S D++  KP+  R     FGVKSYLH FY    + K  +++ED  ++  +LL+S +  +K C PI WK  +WIG+  L+FGV+GIL+ Y VP  P +VL E       ++  + +A+ +N  L++ K
Sbjct:   27 VGGSKRGSKDSE-TKPKRKRSCPMYFGVKSYLHQFYED-HTYKDPSVYED--DDHQFLLQSHRRRQK-CTPIWWKLFMWIGVILLLFGVMGILIGYLVP--PRHVLIESADDVNGEVYIDEKAQEYNTTLDMCK 153          
BLAST of Neurensin-1 vs. Planmine SMEST
Match: SMESG000011024.1 (SMESG000011024.1)

HSP 1 Score: 389.423 bits (999), Expect = 1.537e-138
Identity = 217/217 (100.00%), Postives = 217/217 (100.00%), Query Frame = 3
Query:  135 MAGLEATSLDTDKIKPEENRKKCAPFGVKSYLHNFYGPISSNKGGTIFEDPAEECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPKKPDYVLGEKNQLVTNHEAKVFNNNLEIVKXXXXXXXXXXXXXXXXXXXXXXXXWKHCFDADRISEPTDFQSTEDKPIATKIAVSNFPECISTKLDKVQPERKENESVAADGELQSVN 785
            MAGLEATSLDTDKIKPEENRKKCAPFGVKSYLHNFYGPISSNKGGTIFEDPAEECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPKKPDYVLGEKNQLVTNHEAKVFNNNLEIVKLVGLLFFCIGGGLTIIGLLIPTLLWKHCFDADRISEPTDFQSTEDKPIATKIAVSNFPECISTKLDKVQPERKENESVAADGELQSVN
Sbjct:    1 MAGLEATSLDTDKIKPEENRKKCAPFGVKSYLHNFYGPISSNKGGTIFEDPAEECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPKKPDYVLGEKNQLVTNHEAKVFNNNLEIVKLVGLLFFCIGGGLTIIGLLIPTLLWKHCFDADRISEPTDFQSTEDKPIATKIAVSNFPECISTKLDKVQPERKENESVAADGELQSVN 217          
The following BLAST results are available for this feature:
BLAST of Neurensin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UUQ66.018e-2036.32Uncharacterized protein OS=Capitella teleta OX=283... [more]
V3ZSQ98.973e-1637.11Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A3S1BNP14.122e-1534.39Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A1S3K4582.980e-1439.47LOW QUALITY PROTEIN: neurensin-1-like OS=Lingula u... [more]
A0A0B7A7T64.182e-1436.57Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
back to top
BLAST of Neurensin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurensin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000011024.11.537e-138100.00SMESG000011024.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029642 ID=SMED30029642|Name=Neurensin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=820bp
TTTCATTGGTCCATCAGTAGTGTGTGCGTGCAAGTGTGTAACGAGTAAAT
GCGTGTGTATTTAGTATTTGCTCATAACAGCTGACTTCTTTCGGATTTAC
GAAGCGATTCTGGGATCGATATTAGATTAATATAATGGCTGGTTTAGAGG
CCACGTCTCTTGATACAGATAAAATCAAACCGGAAGAAAATCGAAAAAAA
TGTGCTCCGTTTGGTGTGAAATCTTATTTGCATAATTTCTATGGACCAAT
ATCCTCCAACAAAGGAGGAACGATATTTGAAGACCCAGCAGAAGAGTGTT
CTTACTTGTTGAAATCGAAAAAATCTAATCGGAAATACTGCCGCCCAATT
CTCTGGAAAGCCGCCATTTGGATTGGAATTAATTTCCTCATTTTCGGTGT
CGTTGGAATATTAGTTGCATATTTCGTTCCGAAAAAGCCTGACTACGTTC
TCGGTGAGAAAAACCAACTGGTCACGAATCACGAAGCGAAGGTGTTTAAT
AACAATCTGGAAATCGTCAAATTGGTTGGACTGCTTTTCTTTTGCATCGG
TGGTGGTTTGACAATTATTGGATTGTTGATTCCAACTTTGCTTTGGAAGC
ACTGTTTTGATGCCGACCGGATTTCCGAGCCGACGGATTTTCAGTCAACA
GAAGACAAGCCGATCGCAACGAAAATTGCTGTCAGTAATTTTCCTGAATG
CATCTCAACCAAACTGGATAAAGTCCAGCCGGAAAGAAAAGAGAATGAGT
CGGTTGCGGCAGACGGAGAATTACAATCTGTTAATTGATAATAAAAGTCT
CTTTGCATGTTAAACAAAAA
back to top

protein sequence of SMED30029642-orf-1

>SMED30029642-orf-1 ID=SMED30029642-orf-1|Name=SMED30029642-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=218bp
MAGLEATSLDTDKIKPEENRKKCAPFGVKSYLHNFYGPISSNKGGTIFED
PAEECSYLLKSKKSNRKYCRPILWKAAIWIGINFLIFGVVGILVAYFVPK
KPDYVLGEKNQLVTNHEAKVFNNNLEIVKLVGLLFFCIGGGLTIIGLLIP
TLLWKHCFDADRISEPTDFQSTEDKPIATKIAVSNFPECISTKLDKVQPE
RKENESVAADGELQSVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR024883Neurensin
IPR006667SLC41_membr_dom
Vocabulary: molecular function
TermDefinition
GO:0008324cation transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0006812cation transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030133transport vesicle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF14927Neurensincoord: 26..153
e-value: 2.3E-24
score: 85.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 197..217
NoneNo IPR availablePANTHERPTHR14796:SF3NEURENSIN 1-RELATEDcoord: 17..204
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 131..153
IPR024883NeurensinPANTHERPTHR14796FAMILY NOT NAMEDcoord: 17..204