slc39a-1

Overview
Nameslc39a-1 (AKN21666.1)
Smed IDSMED30029625
Length (bp)1745
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc39a-1 (SMED30029625) t-SNE clustered cells

Violin plots show distribution of expression levels for slc39a-1 (SMED30029625) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc39a-1 (SMED30029625) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc39a-1 (SMED30029625) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029625

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30029625SMESG000016191.1 SmedASXL_003002SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30029625SMESG000016191.1 SmedASXL_003002SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30029625SMESG000016191.1 dd_Smed_v4_1731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029625SMESG000016191.1 dd_Smed_v4_1731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30029625SMESG000016191.1 dd_Smed_v6_1731_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc39a-1 vs. Ensembl Human
Match: SLC39A14 (solute carrier family 39 member 14 [Source:HGNC Symbol;Acc:HGNC:20858])

HSP 1 Score: 231.491 bits (589), Expect = 1.419e-68
Identity = 144/398 (36.18%), Postives = 217/398 (54.52%), Query Frame = 2
Query:  473 LKTFNNYILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKD----QEKGNDCDVKNSKAKE--------IIHLDKTK------KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            L+ F   IL +L +  C +     E        + S +++W YGLL VTV ++ ++LG   +P MKK  Y  ++ + ++LAIG L   ++  LIP++   + +       ++ Y  K+  V  G YLFF TE++LK L  QK   H   H            S+ + S+   E  ++++++  D D    Q   ++ D K     E        +  L  ++      KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYISL DM   MN + +  D+   S     + F +QNLGL TG+  ++VL++YS +I+
Sbjct:  114 LQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPL-------EDYYVSKSAVVFGGFYLFFFTEKILKILLKQKN-EHHHGHSHYA--------SESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYISLADMFPEMNEVCQE-DERKGSI---LIPFIIQNLGLLTGFTIMVVLTMYSGQIQ 490          
BLAST of slc39a-1 vs. Ensembl Human
Match: SLC39A14 (solute carrier family 39 member 14 [Source:HGNC Symbol;Acc:HGNC:20858])

HSP 1 Score: 231.491 bits (589), Expect = 1.419e-68
Identity = 144/398 (36.18%), Postives = 217/398 (54.52%), Query Frame = 2
Query:  473 LKTFNNYILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKD----QEKGNDCDVKNSKAKE--------IIHLDKTK------KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            L+ F   IL +L +  C +     E        + S +++W YGLL VTV ++ ++LG   +P MKK  Y  ++ + ++LAIG L   ++  LIP++   + +       ++ Y  K+  V  G YLFF TE++LK L  QK   H   H            S+ + S+   E  ++++++  D D    Q   ++ D K     E        +  L  ++      KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYISL DM   MN + +  D+   S     + F +QNLGL TG+  ++VL++YS +I+
Sbjct:  114 LQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPL-------EDYYVSKSAVVFGGFYLFFFTEKILKILLKQKN-EHHHGHSHYA--------SESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYISLADMFPEMNEVCQE-DERKGSI---LIPFIIQNLGLLTGFTIMVVLTMYSGQIQ 490          
BLAST of slc39a-1 vs. Ensembl Human
Match: SLC39A14 (solute carrier family 39 member 14 [Source:HGNC Symbol;Acc:HGNC:20858])

HSP 1 Score: 227.639 bits (579), Expect = 4.370e-67
Identity = 139/398 (34.92%), Postives = 219/398 (55.03%), Query Frame = 2
Query:  473 LKTFNNYILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKD----QEKGNDCDVKNSKAKE--------IIHLDKTK------KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            L+ F   IL +L +  C +     E        + S +++W +G L+V++ N+ ++LG+  +P  +K  ++ V+T+ ++L+IG L   ++  LIP++   + +       ++ Y  K+  V  G YLFF TE++LK L  QK   H   H            S+ + S+   E  ++++++  D D    Q   ++ D K     E        +  L  ++      KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYISL DM   MN + +  D+   S     + F +QNLGL TG+  ++VL++YS +I+
Sbjct:  114 LQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGFGFLSVSLINLASLLGVLVLPCTEKAFFSRVLTYFIALSIGTLLSNALFQLIPEAFGFNPL-------EDYYVSKSAVVFGGFYLFFFTEKILKILLKQKN-EHHHGHSHYA--------SESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYISLADMFPEMNEVCQE-DERKGSI---LIPFIIQNLGLLTGFTIMVVLTMYSGQIQ 490          
BLAST of slc39a-1 vs. Ensembl Human
Match: SLC39A14 (solute carrier family 39 member 14 [Source:HGNC Symbol;Acc:HGNC:20858])

HSP 1 Score: 213.001 bits (541), Expect = 1.173e-61
Identity = 139/392 (35.46%), Postives = 206/392 (52.55%), Query Frame = 2
Query:  473 LKTFNNYILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKD----QEKGNDCDVKNSKAKE--------IIHLDKTK------KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSD 1561
            L+ F   IL +L +  C +     E        + S +++W YGLL VTV ++ ++LG   +P MKK  Y  ++ + ++LAIG L   ++  LIP++   + +       ++ Y  K+  V  G YLFF TE++LK L  QK   H   H            S+ + S+   E  ++++++  D D    Q   ++ D K     E        +  L  ++      KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYISL DMM     ++      W H +   +LQ L L  G   +  LSL S+
Sbjct:  114 LQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPL-------EDYYVSKSAVVFGGFYLFFFTEKILKILLKQKN-EHHHGHSHYA--------SESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYISLADMME--FCSVAQAGVQWCHLS---SLQPLPL--GLKRLSCLSLPSN 481          
BLAST of slc39a-1 vs. Ensembl Human
Match: SLC39A8 (solute carrier family 39 member 8 [Source:HGNC Symbol;Acc:HGNC:20862])

HSP 1 Score: 208.764 bits (530), Expect = 2.201e-60
Identity = 135/401 (33.67%), Postives = 208/401 (51.87%), Query Frame = 2
Query:  425 LNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTN-----------------QKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFD 1576
            L+ FSN+  +I + K        +L +L  +PC      K   + S  ++W YG L+VT+ N+ ++LG+   PL+KK  +  ++TF V LAIG L   +I  LIP++          K D   Y  KA  V  G YL F  ER+LK L                   Q+      A P +   +    N    ++        +  + L D  +E  +   +K  K  EI            +AWM+   D+LHN +DG++IGA  + S++ G+S S+A+LCEE PHELGDF +LL AGMS +QA+ +N +SA +CY+G   G++VG+  + ++ IFA AGGMFLYISL DM   + + + + +   K     F +QN G+ TG+  IL+++LY+ +I  +
Sbjct:   83 LHGFSNAT-QITSSK-FSVICPAVLQQLNFHPCE--DRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAF-----GFDPKVD--SYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAIN-GVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI----------GTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNI-IFALAGGMFLYISLADMFPEMNDMLREKVTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE 460          
BLAST of slc39a-1 vs. Ensembl Celegans
Match: zipt-15 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:U4PS08])

HSP 1 Score: 214.542 bits (545), Expect = 2.156e-63
Identity = 130/367 (35.42%), Postives = 199/367 (54.22%), Query Frame = 2
Query:  551 QKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKN-----DYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFE--IMKLENSDR--IQSRTQTENSLL-----------------QQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDI-TSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMI-ASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            ++   + +W  GLL VT+ N+ A++GI  +  + K  YN ++T  V L +G+L+G+S   L+P +      +L  + D+N      Y   A   + G+Y FF  ++L+K +   +  +    H  +  E   M  E SD   +      E  LL                 + M L DK  +   D           I        IA VAWM+VFGD LHN +DG+SIGA F++S+  G+SISLAVLCEE PHELGD A+L+ +GM++KQA+ +NL+SA+TCY+GF IGV +G++    S + F  AGGMFLYISL  MM  + + +++ +  S +H      LQ++GLF+G   + +++ Y + I
Sbjct:   49 ERPPAVIVWGVGLLFVTLINMCAVVGIGVMRYLTKNTYNQIITLFVGLGVGSLSGSSFYHLLPQAHP----SLMDEVDENGVPTHSYLHMAHISILGVYAFFFCDKLIKIILEIRKKNQHIHHRRLSIENPGMTTERSDSTFVTDAGDREEELLRSVLKKGVMSKADIDETEMMTLEDKSGKSMGDQAHGICVHDHSIEFRAGDSAIAAVAWMIVFGDGLHNFIDGISIGAAFAESLHSGLSISLAVLCEEFPHELGDVAILVASGMTLKQALIYNLLSAITCYVGFFIGVGIGELGPDTSKYAFGLAGGMFLYISLACMMPEMKKAMEEALNVSLRHGIYVLFLQSVGLFSGLTLMYIMARYGESI 411          
BLAST of slc39a-1 vs. Ensembl Celegans
Match: zipt-15 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:U4PS08])

HSP 1 Score: 179.489 bits (454), Expect = 1.060e-51
Identity = 103/273 (37.73%), Postives = 151/273 (55.31%), Query Frame = 2
Query:  818 VAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFE--IMKLENSDR--IQSRTQTENSLL-----------------QQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDI-TSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMI-ASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            + G+Y FF  ++L+K +   +  +    H  +  E   M  E SD   +      E  LL                 + M L DK  +   D           I        IA VAWM+VFGD LHN +DG+SIGA F++S+  G+SISLAVLCEE PHELGD A+L+ +GM++KQA+ +NL+SA+TCY+GF IGV +G++    S + F  AGGMFLYISL  MM  + + +++ +  S +H      LQ++GLF+G   + +++ Y + I
Sbjct:   22 ILGVYAFFFCDKLIKIILEIRKKNQHIHHRRLSIENPGMTTERSDSTFVTDAGDREEELLRSVLKKGVMSKADIDETEMMTLEDKSGKSMGDQAHGICVHDHSIEFRAGDSAIAAVAWMIVFGDGLHNFIDGISIGAAFAESLHSGLSISLAVLCEEFPHELGDVAILVASGMTLKQALIYNLLSAITCYVGFFIGVGIGELGPDTSKYAFGLAGGMFLYISLACMMPEMKKAMEEALNVSLRHGIYVLFLQSVGLFSGLTLMYIMARYGESI 294          
BLAST of slc39a-1 vs. Ensembl Celegans
Match: zipt-17 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q9XVR4])

HSP 1 Score: 134.035 bits (336), Expect = 3.138e-34
Identity = 108/376 (28.72%), Postives = 191/376 (50.80%), Query Frame = 2
Query:  578 IYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDK------NDYK-------------------W-----------KATGVVAGLYLFFLTERLL-KSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKD---QEKGNDCDVKNSKAK---EIIHL------DKTK-KGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLY 1555
            +YG+++VTV ++L++ G    PLM K   +  + F +++A+  L+  +IL +IP  + + +      H         D +                   W           + + +V  +Y+ +  E  +    T+   CS +T  PV+   +    +SD I+S + + +S+    + N+ D   +E+ N  +++  + +   E+I L      D T+  G+ P A +++FGD +HNLVDG+++GA F  SV LG   ++AV+C ELPHE+GD AVL+ +G+S+  A+  NL+SA+T Y G  I +++G        + A   GMFLY++ VDM++++    D ++A   H  +T  LQ  G   G+A I  L  +
Sbjct:   13 LYGVISVTVVSLLSLGGACIGPLMTKDAKHRWLHFFLAMAVSTLSSDAILHIIPQVVGVHDHGHNHGHSHEHHHEHTDLENGTSGHGHSHHHDDSDRIMWYTVTPARKNLLRLSVIVLSIYILYFVEFFMFYRKTHLHYCSPSTKSPVITSSVST--HSD-IKS-SASNHSITGSEEDNNNDSSKKERRNSVELEKRREQGGHELISLREDGDDDGTEICGLKPRALIILFGDGVHNLVDGLAMGASFMISVKLGFITTIAVICHELPHEIGDLAVLIDSGLSMCTALILNLLSALTAYAGLFIAIVLGRDEEIETILLAITAGMFLYVAWVDMLSHLKH--DSLMA--DHWMVTSILQLSGFTLGFALIFGLGWF 380          
BLAST of slc39a-1 vs. Ensembl Celegans
Match: zipt-7.1 (Zinc transporter zipt-7.1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUC4])

HSP 1 Score: 107.842 bits (268), Expect = 4.084e-25
Identity = 81/327 (24.77%), Postives = 148/327 (45.26%), Query Frame = 2
Query:  533 TTSKESQ--KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKA------------KHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITS-----ASVWIFAFAGGMFLYISLVDMMNNIIETID 1456
            T+ +E Q  + S L++W++ L  V   ++     +FFIP   +      +  +++   G L G ++L +IP S+   + +                HD ++     T V+AG+ +F + E+L++ +      SH   H V                         +   LN+ D E   +      K +++    +  K +   A++ +  D +HN+ DG++IGA FS    LG   +L VL  ELPHE+GDFA+L+ +G S  QA+    ++A+    G +  ++V +  S      +  I  F  G F+YI+ V ++  ++E+ D
Sbjct:   68 TSHREIQHSRLSTLKVWVFSLSAVVGISLAPCTLLFFIP--AQHANGPFLKILLAFGAGGLLGDALLHIIPHSLSPHDHSHDHHDHNHSHKEHDHSHDHSNQLRVGTFVIAGILVFMMVEQLVRIIKGGHCHSHENGHIVAD-----------------------EHRHLNEHDHEHSEE------KKQQV----EGLKDVKASAYLNLVADFVHNVTDGLAIGASFSAGNTLGWITTLTVLLHELPHEVGDFAILVQSGFSKYQAIRLQAVTALGAITGCVFSLLVSNPGSLNNDADTSAIMPFTAGGFIYIATVSVVPELLESGD 359          
BLAST of slc39a-1 vs. Ensembl Celegans
Match: zipt-16 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q8I4G0])

HSP 1 Score: 108.997 bits (271), Expect = 5.717e-25
Identity = 59/182 (32.42%), Postives = 107/182 (58.79%), Query Frame = 2
Query:  986 QQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDI-TSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMI-ASWKHKALTFALQNLGLFTG 1525
            ++  LN +D        ++  + K I   +     +A VA+M++FG S +N VDGMS+GA FS +++ G+SI +AV+ ++ P ELG  A+L+ +G+ +K+ + +N++  +  +LGF IGV++  +  S   +IFA + GM++YI L  ++  I E+ +++I  +     L   LQ  G+  G
Sbjct:  319 EKPGLNHQDNSDSMSVSIRVVEKKVI---EPAAMEVASVAYMIIFGSSANNFVDGMSMGAAFSDNLLRGLSIGIAVISQQFPQELGTLAILVKSGLGLKKTLLFNMVPIVLSFLGFSIGVMLDSVDDSYDEYIFAISSGMYMYIFLGTLIPEIRESTNELIKENLAESILVSILQACGILFG 497          

HSP 2 Score: 65.4698 bits (158), Expect = 5.895e-11
Identity = 31/98 (31.63%), Postives = 56/98 (57.14%), Query Frame = 2
Query:  569 QIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLK 862
            Q W  G   V+  +  A LGI  +P + K +Y  +MTF+V++ IGAL+G++I I++P +  ++        +  +Y  K+  ++  LY FF  +R+L+
Sbjct:   48 QTWGIGFAIVSGCSFSAPLGILLLPCLSKSLYERIMTFLVAVGIGALSGSTIFIMLPQAFHLTSF------EHFEYHTKSLIILCALYAFFTVDRMLQ 139          
BLAST of slc39a-1 vs. Ensembl Fly
Match: Zip71B (gene:FBgn0036461 transcript:FBtr0113171)

HSP 1 Score: 157.147 bits (396), Expect = 4.999e-41
Identity = 96/304 (31.58%), Postives = 164/304 (53.95%), Query Frame = 2
Query:  575 WIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSM--------QISEI-ALKAKHDKNDYKWKATGV--VAGLYLFFLTERLLKSL-----TNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTE-NSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSA-SVWIFAFAGGMFLYISLVDMM 1432
            WIY  +T+ + +   +LGI  +PLMK   Y  ++ F+VS+A+G LAG +++ L+P ++        +++ I  L++ H  ++      G   +A L+++ L E L+  L      +  +  H  +H      + K    D I      E N +LQ+ KL++K  ++                       + PVA+MV+ GD LHNL DG++IGA F+   + G + + AVLC ELPHELGDFA+LL  G+S+++AV+ N++S++  ++G  +G+ +  I    + WI+A   G FLYI+  D++
Sbjct:  243 WIYASITMLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHALFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYML-ENLIPLLKGGKPGHGHSHGHGHSHGRSHGHMEKPAAKDAIDLPPPRELNVMLQEAKLDEKTPDRP----------------------LTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFAVLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGIGDGMTQWIYAATAGSFLYIAFADLV 523          
BLAST of slc39a-1 vs. Ensembl Fly
Match: Zip71B (gene:FBgn0036461 transcript:FBtr0347146)

HSP 1 Score: 157.147 bits (396), Expect = 4.999e-41
Identity = 96/304 (31.58%), Postives = 164/304 (53.95%), Query Frame = 2
Query:  575 WIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSM--------QISEI-ALKAKHDKNDYKWKATGV--VAGLYLFFLTERLLKSL-----TNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTE-NSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSA-SVWIFAFAGGMFLYISLVDMM 1432
            WIY  +T+ + +   +LGI  +PLMK   Y  ++ F+VS+A+G LAG +++ L+P ++        +++ I  L++ H  ++      G   +A L+++ L E L+  L      +  +  H  +H      + K    D I      E N +LQ+ KL++K  ++                       + PVA+MV+ GD LHNL DG++IGA F+   + G + + AVLC ELPHELGDFA+LL  G+S+++AV+ N++S++  ++G  +G+ +  I    + WI+A   G FLYI+  D++
Sbjct:  243 WIYASITMLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHALFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYML-ENLIPLLKGGKPGHGHSHGHGHSHGRSHGHMEKPAAKDAIDLPPPRELNVMLQEAKLDEKTPDRP----------------------LTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFAVLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGIGDGMTQWIYAATAGSFLYIAFADLV 523          
BLAST of slc39a-1 vs. Ensembl Fly
Match: foi (gene:FBgn0024236 transcript:FBtr0331418)

HSP 1 Score: 157.147 bits (396), Expect = 2.199e-40
Identity = 75/156 (48.08%), Postives = 106/156 (67.95%), Query Frame = 2
Query: 1091 IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKAL-TFALQNLGLFTGYATILVLSLY 1555
            ++ VAWM++ GD LHN  DGM+IGA F++++  G S SLAV C ELPHELGDFA+L+ AGMSVK AV++NL++ +  ++G I G+  G     + W+FA A G+F+YI+LVDMM  I         S  HK+L  F LQ LG+ +G   +L+++LY
Sbjct:  540 LSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEI---------SASHKSLGQFLLQILGMLSGVGIMLLIALY 686          

HSP 2 Score: 60.8474 bits (146), Expect = 2.132e-9
Identity = 27/99 (27.27%), Postives = 52/99 (52.53%), Query Frame = 2
Query:  563 VLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLL 859
            +  +WIY  ++V    +L ++G+  IP M  + Y  ++ ++V+LA+G + G ++L L+P S+        A  D+     K  G + G+  F++ E  L
Sbjct:  257 IFYVWIYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSL--------AGQDERGMIMKGLGCLGGIIFFYVMEHAL 347          
BLAST of slc39a-1 vs. Ensembl Fly
Match: foi (gene:FBgn0024236 transcript:FBtr0345601)

HSP 1 Score: 157.147 bits (396), Expect = 2.199e-40
Identity = 75/156 (48.08%), Postives = 106/156 (67.95%), Query Frame = 2
Query: 1091 IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKAL-TFALQNLGLFTGYATILVLSLY 1555
            ++ VAWM++ GD LHN  DGM+IGA F++++  G S SLAV C ELPHELGDFA+L+ AGMSVK AV++NL++ +  ++G I G+  G     + W+FA A G+F+YI+LVDMM  I         S  HK+L  F LQ LG+ +G   +L+++LY
Sbjct:  540 LSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEI---------SASHKSLGQFLLQILGMLSGVGIMLLIALY 686          

HSP 2 Score: 60.8474 bits (146), Expect = 2.132e-9
Identity = 27/99 (27.27%), Postives = 52/99 (52.53%), Query Frame = 2
Query:  563 VLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLL 859
            +  +WIY  ++V    +L ++G+  IP M  + Y  ++ ++V+LA+G + G ++L L+P S+        A  D+     K  G + G+  F++ E  L
Sbjct:  257 IFYVWIYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSL--------AGQDERGMIMKGLGCLGGIIFFYVMEHAL 347          
BLAST of slc39a-1 vs. Ensembl Fly
Match: foi (gene:FBgn0024236 transcript:FBtr0331417)

HSP 1 Score: 157.147 bits (396), Expect = 2.199e-40
Identity = 75/156 (48.08%), Postives = 106/156 (67.95%), Query Frame = 2
Query: 1091 IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKAL-TFALQNLGLFTGYATILVLSLY 1555
            ++ VAWM++ GD LHN  DGM+IGA F++++  G S SLAV C ELPHELGDFA+L+ AGMSVK AV++NL++ +  ++G I G+  G     + W+FA A G+F+YI+LVDMM  I         S  HK+L  F LQ LG+ +G   +L+++LY
Sbjct:  540 LSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEI---------SASHKSLGQFLLQILGMLSGVGIMLLIALY 686          

HSP 2 Score: 60.8474 bits (146), Expect = 2.132e-9
Identity = 27/99 (27.27%), Postives = 52/99 (52.53%), Query Frame = 2
Query:  563 VLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLL 859
            +  +WIY  ++V    +L ++G+  IP M  + Y  ++ ++V+LA+G + G ++L L+P S+        A  D+     K  G + G+  F++ E  L
Sbjct:  257 IFYVWIYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSL--------AGQDERGMIMKGLGCLGGIIFFYVMEHAL 347          
BLAST of slc39a-1 vs. Ensembl Zebrafish
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:799782])

HSP 1 Score: 232.261 bits (591), Expect = 5.617e-69
Identity = 134/393 (34.10%), Postives = 213/393 (54.20%), Query Frame = 2
Query:  461 NEKGLKTFNNYILSRLLNNPCGALTT--SKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAH----PVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTK----------KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRF 1573
            +E+GL+     ++ +L +  C       S+ S + +  ++W Y +L+VT+ +  A+ G+F +PLM+ +    V+ + ++L+IG L  T+IL L+P++     +       ++ Y  K+  V  G YLFF TE++LK +   K            P  ++     +  D +  + Q   +    +   + D     + D   S  + +     +           KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G+  S + WIFA AGGMFLYI+L DM   + E + ++  A      LTFALQN GL TG+A +LVL++YS +I+ 
Sbjct:  109 DERGLQQICPTMIQQLDSQACKTQPNQESESSPRPTEAEVWGYSILSVTLVSAFALTGVFVVPLMRTRFMRRVLVYFIALSIGTLLSTAILQLLPEAFGFDPM-------EDYYVPKSAVVFGGFYLFFFTEKILKMILKPKDTGGHGHGHSHFPAERYANSNGDLEDGVMEKLQNGEAGGAALPRAEADGRGVGEDDKMLSTGQTVQDTQSSGGGGTGGCYWLKGRAYSDIGTLAWMITLSDGLHNFIDGLAIGASFTASVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGMGFGILAGNNFSPN-WIFALAGGMFLYIALADMFPEMNEVSREEEEAGGSGFLLTFALQNAGLLTGFAIMLVLTIYSGQIQL 493          
BLAST of slc39a-1 vs. Ensembl Zebrafish
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:799782])

HSP 1 Score: 229.18 bits (583), Expect = 6.760e-68
Identity = 137/392 (34.95%), Postives = 215/392 (54.85%), Query Frame = 2
Query:  461 NEKGLKTFNNYILSRLLNNPCGALTT--SKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTC-------------SHATAHPVMKFEIM-KLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            +E+GL+     ++ +L +  C       S+ S + +  ++W YGLL VTV ++ +++G   +P M+K  Y  ++ + ++LAIG L   ++  LIP++     +       ++ Y  K+  V  G YLFF TE++LK +   K                +A ++  ++  +M KL+N +   +      +  + +  +DK    G       S            KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G+  S + WIFA AGGMFLYI+L DM   + E + ++  A      LTFALQN GL TG+A +LVL++YS +I+
Sbjct:  109 DERGLQQICPTMIQQLDSQACKTQPNQESESSPRPTEAEVWGYGLLCVTVISLCSLVGASVVPFMRKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFDPM-------EDYYVPKSAVVFGGFYLFFFTEKILKMILKPKDTGGHGHGHSHFPAERYANSNGDLEDGVMEKLQNGEAGGAALPRAEADGRGVGEDDKMLSTGQTVQDTQSSGGGGTGGCYWLKGRAYSDIGTLAWMITLSDGLHNFIDGLAIGASFTASVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGMGFGILAGNNFSPN-WIFALAGGMFLYIALADMFPEMNEVSREEEEAGGSGFLLTFALQNAGLLTGFAIMLVLTIYSGQIQ 492          
BLAST of slc39a-1 vs. Ensembl Zebrafish
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:799782])

HSP 1 Score: 229.18 bits (583), Expect = 6.760e-68
Identity = 137/392 (34.95%), Postives = 215/392 (54.85%), Query Frame = 2
Query:  461 NEKGLKTFNNYILSRLLNNPCGALTT--SKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTC-------------SHATAHPVMKFEIM-KLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            +E+GL+     ++ +L +  C       S+ S + +  ++W YGLL VTV ++ +++G   +P M+K  Y  ++ + ++LAIG L   ++  LIP++     +       ++ Y  K+  V  G YLFF TE++LK +   K                +A ++  ++  +M KL+N +   +      +  + +  +DK    G       S            KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G+  S + WIFA AGGMFLYI+L DM   + E + ++  A      LTFALQN GL TG+A +LVL++YS +I+
Sbjct:  109 DERGLQQICPTMIQQLDSQACKTQPNQESESSPRPTEAEVWGYGLLCVTVISLCSLVGASVVPFMRKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFDPM-------EDYYVPKSAVVFGGFYLFFFTEKILKMILKPKDTGGHGHGHSHFPAERYANSNGDLEDGVMEKLQNGEAGGAALPRAEADGRGVGEDDKMLSTGQTVQDTQSSGGGGTGGCYWLKGRAYSDIGTLAWMITLSDGLHNFIDGLAIGASFTASVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGMGFGILAGNNFSPN-WIFALAGGMFLYIALADMFPEMNEVSREEEEAGGSGFLLTFALQNAGLLTGFAIMLVLTIYSGQIQ 492          
BLAST of slc39a-1 vs. Ensembl Zebrafish
Match: slc39a6 (solute carrier family 39 member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-3023])

HSP 1 Score: 203.756 bits (517), Expect = 1.445e-56
Identity = 130/408 (31.86%), Postives = 208/408 (50.98%), Query Frame = 2
Query:  533 TTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIP----DSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLL--------KSLTNQKTCSHATA------HPVMKFEIMKLENSDRIQSR--TQTENSLLQQMKLNDKDQEKGNDCD------VKNSKAKEII--------------------------------HLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDIT-SASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 1579
            T  +  +   V   W+ G L++T+ ++LA++G+  IPLM +  +N +++F+V+LA+G L+G ++L LIP                + D     W     ++G+Y+ FL E  L        K+   QK     T        P ++   +K+E ++    R   + E  +L     ND D E  N C       V  S  +                                   H ++   G+A +AWMV+ GD LHN  DG++IGA F++ +  G+S S+AV C ELPHELGDFAVLL AGMSV+QA+ +NL+SA+  YLG IIG+++G    + + WIFA   G+F+Y++LVDM+  ++   D   A + H    F LQN G+  G+  +L+++++ D+I+ D+
Sbjct:  339 TNGRGQRNTPVYIAWLGGFLSITLISLLALVGVVLIPLMNRVCFNFLLSFLVALAVGTLSGDALLHLIPHSQGHHHHGHSEEHAEEEDSLRPVWTGLTALSGVYIMFLIEHFLTLGKMYKDKNQKVQKRVDLTTEVLESEKLPSLEENDVKIEAAETNGGRALAEEEEVMLGAELYNDMDCE--NKCHSHFHDTVGQSDEQHHHHHDYHHILHHHHSQNHHPHTHTHRHTHSYSQQHFEQA--GVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMSVRQAMLYNLLSALMGYLGMIIGILIGHYAENVATWIFALTAGLFMYVALVDMVPEMLHN-DASEAGFSHYGF-FLLQNAGILLGFGIMLIIAVFEDRIQLDL 740          
BLAST of slc39a-1 vs. Ensembl Zebrafish
Match: LO018202.1 (pep chromosome:GRCz11:14:50034196:50059783:1 gene:ENSDARG00000113547.1 transcript:ENSDART00000190301.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LO018202.1)

HSP 1 Score: 171.014 bits (432), Expect = 4.602e-47
Identity = 106/332 (31.93%), Postives = 168/332 (50.60%), Query Frame = 2
Query:  461 NEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKK--------GIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMM 1432
            NE+ L      +L++ +  PC   T      + S L +W Y  L VT+ N+ ++LG+  +P+ KK  +  V+T+ + L +G L     L LIP++      A       + +  ++ GV  G Y  ++ E++LK                    ++K E     Q   Q ++S   Q      D E       K S A E      + K         +  VAWM+   D+++N +DG++IGA FS S++ G S S+A   EELPHELGDF +LL AG+SV QA F+NL+S+ +CY G ++G+++G+  S  + IFA + GMF YI+L D++
Sbjct:   90 NEEHLSIVCPALLNKAVLPPCP--TDPPTHTEDSDLHVWGYAFLAVTIINLASLLGMTLVPITKKPFFPKVLTYFLGLGVGTLFSNGALQLIPEAFGFDPKA-------DGFVLQSVGVFGGFYALYIVEKILKI-------------------VLKPEYE---QGHNQCQSSECGQQNPGFTDSEINLAISDKISIASEPASERGSCKWLRGRNLSNVKTVAWMISLSDAINNFIDGITIGASFSVSLVNGFSTSIACASEELPHELGDFIILLNAGLSVPQAAFFNLLSSCSCYFGLVVGILLGNTFSPGL-IFALSSGMFFYIALADLV 389          
BLAST of slc39a-1 vs. Ensembl Xenopus
Match: SLC39A8 (solute carrier family 39 (zinc transporter), member 8 [Source:NCBI gene;Acc:100487145])

HSP 1 Score: 243.047 bits (619), Expect = 2.150e-73
Identity = 141/395 (35.70%), Postives = 222/395 (56.20%), Query Frame = 2
Query:  443 SVVEINNEK----GLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTN---QKTCSHATAHPVMKFEIM------KLENSDRIQSRTQTEN----SLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFD 1576
            S+  I N++      +TF   IL ++  +PC   +  + +Q+ S  Q+W +  L+VT+ N+ ++LG+F  PL+KK  +  ++T+ V LAIG L   +I  LIP++          K D  +Y  KA  +  G Y+    ERLLK + N   +   +H     V   E+       K+ N + I S          + L  +K++ KD  +   C  K  K + +       K I  +AWM+   D+LHN +DG++IGA F+ SV+ G+S S+A+LCEE PHE GDFA+L+ AGMS+ QA+ +N +SA +CY+G + G++VG+    S+ IFA AGGMFLYI L DM   + E + D I   +   + F++QN GL +G+A IL+++LYS +I+ +
Sbjct:   81 SIYNIKNDQITNVTFETFCPAILHQIFFHPCTFESQDESTQRPSPAQVWGFSFLSVTIINLTSLLGLFITPLIKKPYFPKILTYFVGLAIGTLFSNAIFQLIPEAF-----GFDPKVD--NYVPKAVAIFGGFYILLFVERLLKLILNIYGEGVHTHLEIDHVPHQELHIESPANKIPNGNIIYSNPAVAEINGVNHLDNIKVSSKDAVEEVYC-CKVLKWRPL-------KSIGTLAWMITLSDALHNFIDGLAIGASFTLSVLQGLSTSIAILCEEFPHEFGDFAILINAGMSIPQALTFNFLSACSCYIGLVFGILVGNNFEPSI-IFAIAGGMFLYIGLADMFPELNEMLKDKIKGRRSDLIYFSIQNAGLLSGFAIILLITLYSKEIKLN 459          
BLAST of slc39a-1 vs. Ensembl Xenopus
Match: slc8a2 (solute carrier family 8 member A2 [Source:Xenbase;Acc:XB-GENE-992835])

HSP 1 Score: 237.269 bits (604), Expect = 4.555e-71
Identity = 147/440 (33.41%), Postives = 236/440 (53.64%), Query Frame = 2
Query:  302 QRFNLSNVDFLFDNFKIKTDYWKASFGKRNITE--KCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGA------LTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTK---KGI-----APVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            +  ++  +  L +N ++     K    +RN+++      + +  N  S SVV   + +G ++F   IL +L    C         TT     + S  ++W YGLL VTV ++ ++LG+FF P +K+  +  ++T+ ++L+IG L   ++L LIP++   + +       ++ Y + ++ +  G YLFF TE++LK +  QK   H   H     +  K +  + +  + Q  N  L  M       E     D K  + +++     +    KGI       +AWM+   D LHN +DG++IGA F+ SV  GVS S+A+LCEE PHELGDF +LL AGMS+ QA+F+N +SA  CYLG   G++ G   S++ WIFA AGGMFLYI+L DM   + E + +D        A  F +QN GL TG+A +L+L+ +S +I+
Sbjct:   51 ESLSMPQLQSLLENLEVG----KGGGNQRNMSQCLSSSTLFAAHNLTSGSVV---DAEGFQSFCPTILQQLETRACQESPAFQNETTPGAEGRPSPGEVWGYGLLAVTVISLASLLGVFFAPCVKRPFFRRLLTYFIALSIGTLLSNALLQLIPEAFGFNPL-------EDSYVFTSSVIFGGFYLFFFTEKVLKMMLKQK---HEHGHSHYSADTSKRDAEEGVTEKLQ--NGDLDHMIPPPHGSESDLRGDEKAVQQQDLPGQQSSCYWLKGIRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGVSTSIAILCEEFPHELGDFVILLNAGMSIPQALFFNFLSACCCYLGLAFGILAGSHFSSN-WIFALAGGMFLYIALSDMFPEMNEVSKEDEEGGRAFSA--FMIQNAGLLTGFAIMLLLTTFSGQIQ 468          
BLAST of slc39a-1 vs. Ensembl Xenopus
Match: slc8a2 (solute carrier family 8 member A2 [Source:Xenbase;Acc:XB-GENE-992835])

HSP 1 Score: 230.335 bits (586), Expect = 1.998e-68
Identity = 146/440 (33.18%), Postives = 230/440 (52.27%), Query Frame = 2
Query:  302 QRFNLSNVDFLFDNFKIKTDYWKASFGKRNITE--KCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGA------LTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTK---KGI-----APVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            +  ++  +  L +N ++     K    +RN+++      + +  N  S SVV   + +G ++F   IL +L    C         TT     + S  ++W YG L VTV ++ ++ G   +P MKK  Y  ++ F ++LAIG L   ++  LIP++   + +       ++ Y + ++ +  G YLFF TE++LK +  QK   H   H     +  K +  + +  + Q  N  L  M       E     D K  + +++     +    KGI       +AWM+   D LHN +DG++IGA F+ SV  GVS S+A+LCEE PHELGDF +LL AGMS+ QA+F+N +SA  CYLG   G++ G   S++ WIFA AGGMFLYI+L DM   + E + +D        A  F +QN GL TG+A +L+L+ +S +I+
Sbjct:   51 ESLSMPQLQSLLENLEVG----KGGGNQRNMSQCLSSSTLFAAHNLTSGSVV---DAEGFQSFCPTILQQLETRACQESPAFQNETTPGAEGRPSPGEVWGYGFLCVTVISLCSLFGAGVVPFMKKACYKRLLLFCIALAIGTLFSNALFQLIPEAFGFNPL-------EDSYVFTSSVIFGGFYLFFFTEKVLKMMLKQK---HEHGHSHYSADTSKRDAEEGVTEKLQ--NGDLDHMIPPPHGSESDLRGDEKAVQQQDLPGQQSSCYWLKGIRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGVSTSIAILCEEFPHELGDFVILLNAGMSIPQALFFNFLSACCCYLGLAFGILAGSHFSSN-WIFALAGGMFLYIALSDMFPEMNEVSKEDEEGGRAFSA--FMIQNAGLLTGFAIMLLLTTFSGQIQ 468          
BLAST of slc39a-1 vs. Ensembl Xenopus
Match: tmem135 (transmembrane protein 135 [Source:Xenbase;Acc:XB-GENE-954105])

HSP 1 Score: 189.504 bits (480), Expect = 3.244e-52
Identity = 122/390 (31.28%), Postives = 203/390 (52.05%), Query Frame = 2
Query:  494 ILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATG---------VVAGLYLFFLTERLLKSLTNQKTC-------------SHATA-----HPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSA-SVWIFAFAGGMFLYISLVDMMNNII--ETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRF 1573
            I SR+  +    LT SK   K ++LQ+  +G L VTV +  ++L + F+PL+++ ++  ++ F+V+LA+G L G ++L L+P + +         H  N +  K            V+ GLYL FL E L+  L  ++               S+ TA      PV + E  ++  +  I  R   E      +++  +D++   D    +S +    ++    KGI  + WMV+ GD +HN  DG++IGA FS     G+S ++AV C ELPHELGDFAVLL +G+ V++ +F++L+SA   + G IIG +    ++  + WIFA   G+FLY++LVDM+  ++  ET D        +     + +LG   G A +  ++LY D++ F
Sbjct:  211 IDSRVCIHHSDELTNSKPDSKQALLQVLGWGALAVTVISAPSLLAVAFVPLLRRPLFRYLLRFLVALAVGTLCGDALLHLMPHAQE--------DHTGNQHGGKTHAIEPVLKGLSVLGGLYLLFLIENLMGLLKQRQQLKRLSKPEVPAGDESYTTALWDLGSPV-ESEFCEVSRAAEILQRGNEE------VEIRRRDEK---DAPAPHSHSGHSHNM--ASKGITEIVWMVLLGDGIHNFTDGLAIGAAFSSGFSGGLSTTVAVFCHELPHELGDFAVLLQSGVPVRKVLFFSLVSAFLSFFGMIIGAVASQNSAQITPWIFAATAGIFLYVALVDMLPQMLHRETADPC------QGKDCVIHSLGFLLGCAIMFCIALYQDQMVF 574          
BLAST of slc39a-1 vs. Ensembl Xenopus
Match: tmem135 (transmembrane protein 135 [Source:Xenbase;Acc:XB-GENE-954105])

HSP 1 Score: 189.119 bits (479), Expect = 9.021e-52
Identity = 122/385 (31.69%), Postives = 203/385 (52.73%), Query Frame = 2
Query:  494 ILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYK----WKATGVVAGLYLFFLTERLLKSLTNQKTC-------------SHATA-----HPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSA-SVWIFAFAGGMFLYISLVDMMNNII--ETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRF 1573
            I SR+  +    LT SK   K ++LQ+  +G L VTV +  ++L + F+PL+++ ++  ++ F+V+LA+G L G ++L L+P +    E     +H    +      K   V+ GLYL FL E L+  L  ++               S+ TA      PV + E  ++  +  I  R   E      +++  +D++   D    +S +    ++    KGI  + WMV+ GD +HN  DG++IGA FS     G+S ++AV C ELPHELGDFAVLL +G+ V++ +F++L+SA   + G IIG +    ++  + WIFA   G+FLY++LVDM+  ++  ET D        +     + +LG   G A +  ++LY D++ F
Sbjct:  252 IDSRVCIHHSDELTNSKPDSKQALLQVLGWGALAVTVISAPSLLAVAFVPLLRRPLFRYLLRFLVALAVGTLCGDALLHLMPHA---QEDHTGNQHGGKTHAIEPVLKGLSVLGGLYLLFLIENLMGLLKQRQQLKRLSKPEVPAGDESYTTALWDLGSPV-ESEFCEVSRAAEILQRGNEE------VEIRRRDEK---DAPAPHSHSGHSHNM--ASKGITEIVWMVLLGDGIHNFTDGLAIGAAFSSGFSGGLSTTVAVFCHELPHELGDFAVLLQSGVPVRKVLFFSLVSAFLSFFGMIIGAVASQNSAQITPWIFAATAGIFLYVALVDMLPQMLHRETADPC------QGKDCVIHSLGFLLGCAIMFCIALYQDQMVF 615          
BLAST of slc39a-1 vs. Ensembl Mouse
Match: Slc39a14 (solute carrier family 39 (zinc transporter), member 14 [Source:MGI Symbol;Acc:MGI:2384851])

HSP 1 Score: 237.269 bits (604), Expect = 5.343e-71
Identity = 152/437 (34.78%), Postives = 232/437 (53.09%), Query Frame = 2
Query:  359 DYWKASFGKRNITE-KCGP-----VISYLNKFSNSVVEINNEKGLKTFNNY---ILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIM------------KLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKE--IIHLDKTK-KGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            D+     G+ N+++ K GP       S  + F+   +   ++ G   F  +   IL +L +  C +     E        K S +++W YG L VTV ++ +++G   +P MKK  Y  ++ + ++LAIG L   ++  LIP++   +         +++Y  K+  V  G YLFF TE++LK L  QK   H   H     E +            KL+N D      Q  NS L        ++   N   V++ +A +     L   +   I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYI+L DM   MN + +  D+   S+    + F +QNLGL TG++ +LVL++YS +I+
Sbjct:   65 DHLHVGVGRDNVSQPKEGPRNLSTCFSSGDLFAAHNLSERSQIGASEFQEFCPTILQQLDSQACTSENQKSEENEQTEEGKPSAIEVWGYGFLCVTVISLCSLMGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNP--------QDNYVSKSAVVFGGFYLFFFTEKILKMLLKQKN-EHHHGHNHFTSETLPSKKDQEEGVTEKLQNGDLDHMIPQHCNSELDGKAPGTDEKVIVNSMSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYIALADMFPEMNEVCQE-DEKNDSF---LVPFVIQNLGLLTGFSIMLVLTMYSGQIQ 487          
BLAST of slc39a-1 vs. Ensembl Mouse
Match: Slc39a14 (solute carrier family 39 (zinc transporter), member 14 [Source:MGI Symbol;Acc:MGI:2384851])

HSP 1 Score: 235.728 bits (600), Expect = 2.110e-70
Identity = 147/445 (33.03%), Postives = 239/445 (53.71%), Query Frame = 2
Query:  359 DYWKASFGKRNITE-KCGP-----VISYLNKFSNSVVEINNEKGLKTFNNY---ILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCD--------------VKNSKAKEIIHLDKTK----KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            D+     G+ N+++ K GP       S  + F+   +   ++ G   F  +   IL +L +  C +     E        K S +++W +G L+V++ N+ ++LG+  +P  +K  ++ V+T+ ++L+IG L   ++  LIP++   +         +++Y  K+  V  G YLFF TE++LK L  QK   H   H    F       S+ + S+   E  + ++++  D D      C+              + NS + + +   ++     KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYI+L DM   MN + +  D+   S+    + F +QNLGL TG++ +LVL++YS +I+
Sbjct:   65 DHLHVGVGRDNVSQPKEGPRNLSTCFSSGDLFAAHNLSERSQIGASEFQEFCPTILQQLDSQACTSENQKSEENEQTEEGKPSAIEVWGFGFLSVSLINLASLLGVLVLPCTEKAFFSRVLTYFIALSIGTLLSNALFQLIPEAFGFNP--------QDNYVSKSAVVFGGFYLFFFTEKILKMLLKQKNEHH---HGHNHF------TSETLPSKKDQEEGVTEKLQNGDLDHMIPQHCNSELDGKAPGTDEKVIVNSMSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYIALADMFPEMNEVCQE-DEKNDSF---LVPFVIQNLGLLTGFSIMLVLTMYSGQIQ 487          
BLAST of slc39a-1 vs. Ensembl Mouse
Match: Slc39a14 (solute carrier family 39 (zinc transporter), member 14 [Source:MGI Symbol;Acc:MGI:2384851])

HSP 1 Score: 235.728 bits (600), Expect = 2.110e-70
Identity = 147/445 (33.03%), Postives = 239/445 (53.71%), Query Frame = 2
Query:  359 DYWKASFGKRNITE-KCGP-----VISYLNKFSNSVVEINNEKGLKTFNNY---ILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCD--------------VKNSKAKEIIHLDKTK----KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            D+     G+ N+++ K GP       S  + F+   +   ++ G   F  +   IL +L +  C +     E        K S +++W +G L+V++ N+ ++LG+  +P  +K  ++ V+T+ ++L+IG L   ++  LIP++   +         +++Y  K+  V  G YLFF TE++LK L  QK   H   H    F       S+ + S+   E  + ++++  D D      C+              + NS + + +   ++     KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYI+L DM   MN + +  D+   S+    + F +QNLGL TG++ +LVL++YS +I+
Sbjct:   65 DHLHVGVGRDNVSQPKEGPRNLSTCFSSGDLFAAHNLSERSQIGASEFQEFCPTILQQLDSQACTSENQKSEENEQTEEGKPSAIEVWGFGFLSVSLINLASLLGVLVLPCTEKAFFSRVLTYFIALSIGTLLSNALFQLIPEAFGFNP--------QDNYVSKSAVVFGGFYLFFFTEKILKMLLKQKNEHH---HGHNHF------TSETLPSKKDQEEGVTEKLQNGDLDHMIPQHCNSELDGKAPGTDEKVIVNSMSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYIALADMFPEMNEVCQE-DEKNDSF---LVPFVIQNLGLLTGFSIMLVLTMYSGQIQ 487          
BLAST of slc39a-1 vs. Ensembl Mouse
Match: Slc39a8 (solute carrier family 39 (metal ion transporter), member 8 [Source:MGI Symbol;Acc:MGI:1914797])

HSP 1 Score: 218.394 bits (555), Expect = 3.943e-64
Identity = 136/400 (34.00%), Postives = 207/400 (51.75%), Query Frame = 2
Query:  425 LNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSL------------TNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENS------LLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            L+ FSN V +I +          IL +L  +PC  L   K + K S+ ++W YG L+VT+ N+ ++LG+   PL+KK  +  ++T+ V LAIG L   +I  LIP++          K D  +Y  KA  V  G Y+ F  ER LK L             N    S    H      +  +       +   TE +       +  + L D   E  +   +K  K  EI            +AWM+   D+LHN +DG++IGA  + S++ G+S S+A+LCEE PHELGDF +LL AGMS +QA+ +N +SA +CY+G   G++VG+  + ++ IFA AGGMFLYISL DM   + + + + +   +     F +QN G+ TG+  IL+++LY+  I 
Sbjct:   83 LHGFSN-VTQITSSN-FSAICPAILQQLNFHPCEDL--RKHNAKPSLSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTYFVGLAIGTLFSNAIFQLIPEAF-----GFNPKID--NYVEKAVAVFGGFYMLFFVERTLKMLLKTYGQNDHTHFRNDDFGSKEKTHQPKTLPLPAVNGVTCYANPAVTEPNGHIHFDTVSVVSLQDGKTEPSSCTCLKGPKLSEI----------GTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNI-IFALAGGMFLYISLADMFPEMNDMLREKVTGRQTDFTFFMIQNAGMLTGFTAILLITLYAGDIE 460          
BLAST of slc39a-1 vs. Ensembl Mouse
Match: Slc39a8 (solute carrier family 39 (metal ion transporter), member 8 [Source:MGI Symbol;Acc:MGI:1914797])

HSP 1 Score: 218.394 bits (555), Expect = 3.943e-64
Identity = 136/400 (34.00%), Postives = 207/400 (51.75%), Query Frame = 2
Query:  425 LNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSL------------TNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENS------LLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            L+ FSN V +I +          IL +L  +PC  L   K + K S+ ++W YG L+VT+ N+ ++LG+   PL+KK  +  ++T+ V LAIG L   +I  LIP++          K D  +Y  KA  V  G Y+ F  ER LK L             N    S    H      +  +       +   TE +       +  + L D   E  +   +K  K  EI            +AWM+   D+LHN +DG++IGA  + S++ G+S S+A+LCEE PHELGDF +LL AGMS +QA+ +N +SA +CY+G   G++VG+  + ++ IFA AGGMFLYISL DM   + + + + +   +     F +QN G+ TG+  IL+++LY+  I 
Sbjct:   83 LHGFSN-VTQITSSN-FSAICPAILQQLNFHPCEDL--RKHNAKPSLSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTYFVGLAIGTLFSNAIFQLIPEAF-----GFNPKID--NYVEKAVAVFGGFYMLFFVERTLKMLLKTYGQNDHTHFRNDDFGSKEKTHQPKTLPLPAVNGVTCYANPAVTEPNGHIHFDTVSVVSLQDGKTEPSSCTCLKGPKLSEI----------GTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNI-IFALAGGMFLYISLADMFPEMNDMLREKVTGRQTDFTFFMIQNAGMLTGFTAILLITLYAGDIE 460          
BLAST of slc39a-1 vs. UniProt/SwissProt
Match: sp|Q75N73|S39AE_MOUSE (Metal cation symporter ZIP14 OS=Mus musculus OX=10090 GN=Slc39a14 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 3.737e-70
Identity = 152/437 (34.78%), Postives = 232/437 (53.09%), Query Frame = 2
Query:  359 DYWKASFGKRNITE-KCGP-----VISYLNKFSNSVVEINNEKGLKTFNNY---ILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIM------------KLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKE--IIHLDKTK-KGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            D+     G+ N+++ K GP       S  + F+   +   ++ G   F  +   IL +L +  C +     E        K S +++W YG L VTV ++ +++G   +P MKK  Y  ++ + ++LAIG L   ++  LIP++   +         +++Y  K+  V  G YLFF TE++LK L  QK   H   H     E +            KL+N D      Q  NS L        ++   N   V++ +A +     L   +   I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYI+L DM   MN + +  D+   S+    + F +QNLGL TG++ +LVL++YS +I+
Sbjct:   65 DHLHVGVGRDNVSQPKEGPRNLSTCFSSGDLFAAHNLSERSQIGASEFQEFCPTILQQLDSQACTSENQKSEENEQTEEGKPSAIEVWGYGFLCVTVISLCSLMGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNP--------QDNYVSKSAVVFGGFYLFFFTEKILKMLLKQKN-EHHHGHNHFTSETLPSKKDQEEGVTEKLQNGDLDHMIPQHCNSELDGKAPGTDEKVIVNSMSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYIALADMFPEMNEVCQE-DEKNDSF---LVPFVIQNLGLLTGFSIMLVLTMYSGQIQ 487          
BLAST of slc39a-1 vs. UniProt/SwissProt
Match: sp|Q5RAB7|S39AE_PONAB (Metal cation symporter ZIP14 OS=Pongo abelii OX=9601 GN=SLC39A14 PE=2 SV=2)

HSP 1 Score: 231.876 bits (590), Expect = 4.500e-68
Identity = 136/363 (37.47%), Postives = 205/363 (56.47%), Query Frame = 2
Query:  560 SVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVK-NSKAK-----------EIIHLDKTK------KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            S +++W YGLL VTV ++ ++LG   +P MKK  Y  ++ + ++LAIG L   ++  LIP++   + +       ++ Y  K+  V  G YLFF TE++LK L  QK   H   H            S+ + S+   E  ++++++  D D      C+ + + KA             +  L  ++      KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYISL DM   MN + +  D+   S     + F +QNLGL TG+  ++VL++YS +I+
Sbjct:  147 SAVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPL-------EDYYVSKSAVVFGGFYLFFFTEKILKILLKQKN-EHHHGHSHYA--------SETLPSKKDQEEGVMEKLQNGDLDHMIPQHCNSELDGKAPVVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYISLADMFPEMNEVCQE-DERKGS---ILIPFVIQNLGLLTGFTIMVVLTMYSGQIQ 488          
BLAST of slc39a-1 vs. UniProt/SwissProt
Match: sp|A4IGY6|S39AE_XENTR (Metal cation symporter ZIP14 OS=Xenopus tropicalis OX=8364 GN=slc39a14 PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 6.251e-68
Identity = 146/440 (33.18%), Postives = 230/440 (52.27%), Query Frame = 2
Query:  302 QRFNLSNVDFLFDNFKIKTDYWKASFGKRNITE--KCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGA------LTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTK---KGI-----APVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            +  ++  +  L +N ++     K    +RN+++      + +  N  S SVV   + +G ++F   IL +L    C         TT     + S  ++W YG L VTV ++ ++ G   +P MKK  Y  ++ F ++LAIG L   ++  LIP++   + +       ++ Y + ++ +  G YLFF TE++LK +  QK   H   H     +  K +  + +  + Q  N  L  M       E     D K  + +++     +    KGI       +AWM+   D LHN +DG++IGA F+ SV  GVS S+A+LCEE PHELGDF +LL AGMS+ QA+F+N +SA  CYLG   G++ G   S++ WIFA AGGMFLYI+L DM   + E + +D        A  F +QN GL TG+A +L+L+ +S +I+
Sbjct:   43 ESLSMPQLQSLLENLEVG----KGGGNQRNMSQCLSSSTLFAAHNLTSGSVV---DAEGFQSFCPTILQQLETRACQESPAFQNETTPGAEGRPSPGEVWGYGFLCVTVISLCSLFGAGVVPFMKKACYKRLLLFCIALAIGTLFSNALFQLIPEAFGFNPL-------EDSYVFTSSVIFGGFYLFFFTEKVLKMMLKQK---HEHGHSHYSADTSKRDAEEGVTEKLQ--NGDLDHMIPPPHGSESDLRGDEKAVQQQDLPGQQSSCYWLKGIRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGVSTSIAILCEEFPHELGDFVILLNAGMSIPQALFFNFLSACCCYLGLAFGILAGSHFSSN-WIFALAGGMFLYIALSDMFPEMNEVSKEDEEGGRAFSA--FMIQNAGLLTGFAIMLLLTTFSGQIQ 460          
BLAST of slc39a-1 vs. UniProt/SwissProt
Match: sp|Q15043|S39AE_HUMAN (Metal cation symporter ZIP14 OS=Homo sapiens OX=9606 GN=SLC39A14 PE=1 SV=3)

HSP 1 Score: 231.491 bits (589), Expect = 6.814e-68
Identity = 144/398 (36.18%), Postives = 217/398 (54.52%), Query Frame = 2
Query:  473 LKTFNNYILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKD----QEKGNDCDVKNSKAKE--------IIHLDKTK------KG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            L+ F   IL +L +  C +     E        + S +++W YGLL VTV ++ ++LG   +P MKK  Y  ++ + ++LAIG L   ++  LIP++   + +       ++ Y  K+  V  G YLFF TE++LK L  QK   H   H            S+ + S+   E  ++++++  D D    Q   ++ D K     E        +  L  ++      KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G   SA+ WIFA AGGMFLYISL DM   MN + +  D+   S     + F +QNLGL TG+  ++VL++YS +I+
Sbjct:  114 LQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPL-------EDYYVSKSAVVFGGFYLFFFTEKILKILLKQKN-EHHHGHSHYA--------SESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSAN-WIFALAGGMFLYISLADMFPEMNEVCQE-DERKGSI---LIPFIIQNLGLLTGFTIMVVLTMYSGQIQ 490          
BLAST of slc39a-1 vs. UniProt/SwissProt
Match: sp|A5D7L5|S39AE_BOVIN (Metal cation symporter ZIP14 OS=Bos taurus OX=9913 GN=SLC39A14 PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.530e-67
Identity = 141/392 (35.97%), Postives = 206/392 (52.55%), Query Frame = 2
Query:  461 NEKGLKTFNNYILSRLLNNPCGALTTSKESQ------KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSK-------------AKEIIHLDKTKK--GIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKAL-TFALQNLGLFTGYATILVLSLYSDKIR 1570
             E+  + F   IL +L +  C +     E        + S +++W YGLL VTV ++ ++LG   +P MKK  Y  ++ + ++LAIG L   ++  LIP++   + +       ++ Y  K+  V  G YLFF TE++LK L  QK   H   H     E +  +         + +N  L  M       E      V + K             ++   H  K  +   I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CY+G   G++ G   SA+ WIFA AGGMFLYISL DM   + E   +     K  AL  F +QNLGL TG+  +LVL++YS  I+
Sbjct:  108 GEREFQEFCPTILQQLDSRACSSENQENEENEQTEEGRPSSVEVWGYGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPM-------EDYYVSKSAVVFGGFYLFFFTEKILKMLLKQKN-EHHHGHSHYTSETLPSQKDQEEGVTEKLQNGDLDHMIPQHCSGELDGKTPVVDEKVIVGSLSVQDLQASQSACHWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSLQQALFFNFLSACCCYVGLGFGILAGSHFSAN-WIFALAGGMFLYISLADMFPEMNEVSQE--DERKGSALIPFVIQNLGLLTGFGIMLVLTMYSGHIQ 488          
BLAST of slc39a-1 vs. TrEMBL
Match: A0A0H3YJE9 (Slc39a-1 OS=Schmidtea mediterranea OX=79327 GN=slc39a-1 PE=2 SV=1)

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 460/460 (100.00%), Postives = 460/460 (100.00%), Query Frame = 2
Query:  200 MGSMKRVASVXXXXXXXXXXXXXHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 1579
            MGSMKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI
Sbjct:    1 MGSMKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 460          
BLAST of slc39a-1 vs. TrEMBL
Match: A0A0H3YFM2 (Slc39a-12 OS=Schmidtea mediterranea OX=79327 GN=slc39a-12 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 7.637e-87
Identity = 157/382 (41.10%), Postives = 233/382 (60.99%), Query Frame = 2
Query:  332 LFDNFKIKT--DYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNE--KGLKTFNNYILSRLLNNPCGALTTSKESQK---FSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQK--------TCSHATAH----PVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISL 1420
            LF NF ++   D  K    K N + +C        +F NS  E+     +GL      I+ +++   C  +  +  S      S L++W+YG ++VT+ N  A LGI FIPLM KK Y  +MTFM+SLA+G+L G+++LILIPD+MQ++E+       +  YK+KAT V  G+Y+FFL ER LK + N++        + SH + +    P  K EI ++ + + +    + + +L         + E     ++  +           KK +APVAWM++FGD+LHN +DG+SIGA FS + + G+S+S+AV+CEELPHELGDFA+LL AGM++KQA+ WN++SA TCY+GFIIGVI+G+ TS S W+FA AGGMFLYI++
Sbjct:   46 LFLNFSLQNAGDLMKNKLSKANFSTEC-----LARRFVNSTPELQKSTFEGLIAM---IVDKVIIPHCNIIKLNSPSHSKCNLSSLKMWVYGFISVTIINACAGLGILFIPLMNKKFYKVLMTFMISLAVGSLTGSALLILIPDAMQLAELQHGYPGYQVSYKYKATVVFGGVYMFFLLERFLKWIINKEVRTFNRANSLSHGSLNISRTPKPKLEIDQINSDNHLIVAPEMKTTLNNHCNNKPNNNEV---IELNLNSTDIPKIKYIKKKPVAPVAWMIIFGDALHNFIDGLSIGAAFSHNTMTGISLSIAVICEELPHELGDFAILLNAGMNIKQALMWNMLSAATCYIGFIIGVILGETTSGSTWVFAVAGGMFLYINV 416          
BLAST of slc39a-1 vs. TrEMBL
Match: A0A1S3GZ26 (zinc transporter ZIP14 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106150642 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 6.447e-82
Identity = 148/387 (38.24%), Postives = 216/387 (55.81%), Query Frame = 2
Query:  569 QIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLK--------------------SLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNS--------------------------KAKEIIHLDKTKKG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFD 1576
            ++W YG+L VT+ N+ A+LG+  +P M K  Y  ++ FMV+LA+G LAG+++  LIPDS  ++E       ++  Y WK   V+ G+YLFF+ E  +K                    +L + +T +H    P +K      E + +       E+S      L+D  +E+G + D  N                                I    +K G     IAPVAWM++FGD++HN +DG+SIGA F++S+ LG+S+S+AV+CEELPHELGDFA+LL AGMS  QAV +N +SA  CYLG I+G++V + T+A+ W+FA AGGMFLYISL DMM  +    +D     + K   F +QNLGL TG+  +L+L+LY   I F+
Sbjct:  123 EVWGYGILFVTITNICALLGVLLVPFMNKFFYKKLLIFMVALAVGTLAGSALFFLIPDSFGLAEY-----DEEGAYIWKGLTVLGGIYLFFILEYTMKAIMYRKEKKKERRRTYEEIATLASVQTHTHVEVDPELKVPPEMKEGAAKYGIMQGNESS---ADLLDDNGREEGEENDACNDLMNGAMADQSDTNNQGNQGNHGHSHYPISNAIKRQSSKSGVKKPKIAPVAWMIIFGDAVHNFIDGLSIGAAFTESIYLGISVSVAVICEELPHELGDFAILLNAGMSRWQAVGYNFLSACACYLGLILGILVSEATAANEWVFALAGGMFLYISLADMMPEVNHATEDEQNVGQGKTKIFIIQNLGLLTGFGVMLLLALYGGNINFE 501          
BLAST of slc39a-1 vs. TrEMBL
Match: A0A1S3GZA7 (zinc transporter ZIP14 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106150642 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 2.939e-79
Identity = 151/414 (36.47%), Postives = 220/414 (53.14%), Query Frame = 2
Query:  569 QIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLK--------------------SLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKN----SKA------KEIIHLDKT------------------------------------------------KKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFD 1576
            ++W YG+L VT+ N+ A+LG+  +P M K  Y  ++ FMV+LA+G LAG+++  LIPDS  ++E       ++  Y WK   V+ G+YLFF+ E  +K                    +L + +T +H    P +K      E + +       E+S      L+D  +E+G + D  N    SKA      +E +  D                                                  K  IAPVAWM++FGD++HN +DG+SIGA F++S+ LG+S+S+AV+CEELPHELGDFA+LL AGMS  QAV +N +SA  CYLG I+G++V + T+A+ W+FA AGGMFLYISL DMM  +    +D     + K   F +QNLGL TG+  +L+L+LY   I F+
Sbjct:  123 EVWGYGILFVTITNICALLGVLLVPFMNKFFYKKLLIFMVALAVGTLAGSALFFLIPDSFGLAEY-----DEEGAYIWKGLTVLGGIYLFFILEYTMKAIMYRKEKKKERRRTYEEIATLASVQTHTHVEVDPELKVPPEMKEGAAKYGIMQGNESS---ADLLDDNGREEGEENDACNFDAVSKASPSAQKRETVKCDGVELRVQDLMNGAMADQSDTNNQGNQGNHGHSHYPISNAIKRQSSKSGVKKPKIAPVAWMIIFGDAVHNFIDGLSIGAAFTESIYLGISVSVAVICEELPHELGDFAILLNAGMSRWQAVGYNFLSACACYLGLILGILVSEATAANEWVFALAGGMFLYISLADMMPEVNHATEDEQNVGQGKTKIFIIQNLGLLTGFGVMLLLALYGGNINFE 528          
BLAST of slc39a-1 vs. TrEMBL
Match: V3ZVH3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_160668 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 4.329e-79
Identity = 146/360 (40.56%), Postives = 210/360 (58.33%), Query Frame = 2
Query:  560 SVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSR-------TQTENSLLQQMKLNDKDQE--------KGNDCDVK------NSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFD 1576
            S+  +W YG+L V+V N+ +++GI  +P MK   Y  ++ FMV+LA+G L G+ +L LIP+       A    HD N Y   A+ V+ G+YLF+LTER++K LT  +            +  ++     + +S         Q+ +S      LND++ +             D        N K+    H     K IA VAWM++FGD LHN +DG+SIGA F+ S++ GVS+SLA +CEELPHELGDFA+LL +GMS+K+A+ +N +SA  CYLG I+G+++G+ TSA  WIFA AGGMFLYI+LVDMM  +    +   A        F LQN GLFTG+A +L+++LY   I F+
Sbjct:   59 SISAVWGYGILFVSVINLCSLVGIIVLPFMKMVFYRLLLIFMVALAVGTLTGSGLLFLIPE-------AFGLDHD-NGYILTASTVIGGIYLFYLTERIMKMLTIWRQTKKHEGRDKDIYCSIRQRTPKKSESEFKDPSTIPQSSSSCTTVTLLNDENSDASVVNESLPNGQLDTPAPKIEVNGKSVNGHHHGGEGKEIATVAWMIIFGDGLHNFIDGLSIGAAFTNSILSGVSVSLACICEELPHELGDFAILLNSGMSLKKALMYNFLSACMCYLGLIVGILLGESTSAHQWIFAIAGGMFLYIALVDMMPEMNAAAESEEAKKYGNIKIFLLQNCGLFTGFAIMLIMALYGGDISFE 410          
BLAST of slc39a-1 vs. Ensembl Cavefish
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:799782])

HSP 1 Score: 224.557 bits (571), Expect = 3.513e-67
Identity = 131/390 (33.59%), Postives = 212/390 (54.36%), Query Frame = 2
Query:  467 KGLKTFNNYILSRLLNNPCGALTTSKE--SQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKT-CSHATAH-PVMKFEIMKLENS--DRIQS----------RTQTE-NSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHL----DKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            +GL+ F   +L +L    C A    +   S + +  ++W YG L VTV ++ +++G   +P M+K  Y  ++ + ++LAIG L   ++  LIP++     +       +  Y  K+  V  G YLFF TE++LK +   K    H  +H P  ++    +E+   +++Q+          R   E   + ++ K+    Q+   D                   ++   I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G+  S + WIFA AGGMFLYI+L DM   + E + ++  A      +TF +QN GL TG++ +L+L++YS +I+
Sbjct:   27 RGLQEFCPTMLQQLDTRACRAQQDQEPDSSPRPTYAEVWGYGFLCVTVISLCSLVGASVVPFMRKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFDPL-------EAYYVSKSAVVFGGFYLFFFTEKVLKMILKPKNKGGHGHSHFPAEQYSNGDVEDGVMEKLQNGEAGGGVSLPRVDGEIRGVAEEDKMLSTPQQTVQDSQSAGGGGGGTGGCYWLKGRSYSDIGTLAWMITLSDGLHNFIDGLAIGASFTASVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGMAFGILAGNQFSPN-WIFALAGGMFLYIALADMFPEMNEVSREEEEAGGSGSFVTFIIQNAGLLTGFSIMLLLTVYSGQIQ 408          
BLAST of slc39a-1 vs. Ensembl Cavefish
Match: ENSAMXT00000003334.2 (zinc transporter ZIP8-like [Source:NCBI gene;Acc:103022239])

HSP 1 Score: 219.55 bits (558), Expect = 6.220e-65
Identity = 131/370 (35.41%), Postives = 205/370 (55.41%), Query Frame = 2
Query:  461 NEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEI-IHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            N+  L+T    +L++ L   C  L  + + Q      +W YG L VT+ N+ ++LG+  IPL KK  +  V+T+ + LAIG L   + L LIP+       AL      ++Y  KA G+  G YL F TE++LK +   +   H   H       +  +N   I + T   N   ++  +     E     D + S  + +  HL   +     VAWM+   D+LHN +DG++IGA F+ S++ G S S+A++CEE PHELGDF +LL AGM+V QA+F+NL+SAM+CY+G ++G+++G  T A   IFA AGGMFLYI+L DM   +     +     + + + F +QN GL +G+A I ++++++  I
Sbjct:   84 NQDNLRTICPALLNQALLPTCTPL--AAQPQALVQDHVWGYGFLAVTIINLFSLLGLLLIPLTKKPYFPKVLTYFIGLAIGTLFSNAALQLIPE-------ALGFDPKADNYILKAVGIFGGFYLLFFTEKVLKMVLKTE---HEHGHSHFSPPEVPRQNGGTIIAVTSFSNPSSEKTSIASDPPEDQLTADPQVSCMRRVGQHLASVRT----VAWMITLSDALHNFIDGLAIGASFTVSILTGFSTSIAIVCEEFPHELGDFVILLNAGMTVPQAIFFNLLSAMSCYIGLVLGILLGS-TFAPNIIFAIAGGMFLYIALADMFPEMNAIAKEASTRTRTQLVFFIIQNAGLLSGFAIIFLITMFAGDI 436          
BLAST of slc39a-1 vs. Ensembl Cavefish
Match: slc39a10 (solute carrier family 39 member 10 [Source:NCBI gene;Acc:103023420])

HSP 1 Score: 211.46 bits (537), Expect = 8.864e-59
Identity = 134/405 (33.09%), Postives = 217/405 (53.58%), Query Frame = 2
Query:  542 KESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKN-------DYKWKATGVVAGLYLFFLTERLLKSLTNQKT-----CSHAT-------AHPVMKFEIMKLENSDRIQSRTQTENS-----LLQQMKLNDKDQEKGNDCDVKNSKAKEI-----------------------------IHLDKTKK--GIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDIT-SASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKAL---TFALQNLGLFTGYATILVLSLYSDKIRFDI 1579
            +E+Q  SV  IW++G +++TV ++L++LG+  +P++ +  +  ++TF+V+LA+G L+G ++L L+P S    + +   ++ +        D  WK    +AG+YL F+ E  +  + + K      C              +   ++ +  +++ +  R  TE S     L +   L+  ++    + D +NS  +E                               H DK  K  GIA +AWMV+ GD +HN  DG++IGA FS ++  G+S S+AV C ELPHELGDFAVLL AGMSVKQA+ +NL+SA+  Y G +IG  VG  T + + WIFA   GMFLY++LVDM+  ++        S +HK      F LQNLG+ TG+  +L+++++ D I  D+
Sbjct:  475 EETQPHSVW-IWVWGFVSITVISLLSLLGVVLVPILNQSCFKYLLTFLVALAVGTLSGDALLHLLPHSQGGHDHSHGEENAEEMDLLTEFDGVWKGLTALAGIYLLFIIEHCISMVKHYKDQGGSFCRRKKRGEEGKIGRKLSDHKLNRRSDAEWMHLRPLTEGSHNDAQLNELQPLDSANKPPLTNTDSQNSSQQETAISATENGRKAKTKKHGHGHSHGHSHHGHCHTDKEMKDAGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYFGMVIGTAVGQYTHNVTSWIFAVTAGMFLYVALVDMLPEMLHG-----DSEEHKRCHLGHFVLQNLGMLTGFGIMLLIAIFEDHIVLDL 873          
BLAST of slc39a-1 vs. Ensembl Cavefish
Match: slc39a8 (zinc transporter ZIP8 [Source:NCBI gene;Acc:103035991])

HSP 1 Score: 194.897 bits (494), Expect = 1.226e-55
Identity = 130/356 (36.52%), Postives = 190/356 (53.37%), Query Frame = 2
Query:  569 QIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSL--TNQKTC-SHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGND-----------------CDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            Q+W Y  L VT+ N+ ++LG+  +P  KK  +  V+T+ + +AIG L   ++L LIP+       AL      +DY   A G+  G YL F TE++LK     +   C SH  +            N   I + +   N  +    + +  +EK ++                 C V + +     H+   K     VAWM+   D+LHN +DG++IGA F+ S+I G   S+A+ CEE PHE+GDF +LL++GMSV QA F+NLMSAM CYLG  +G+++G    A   IFA AGGMFLYISL DM   MNNI     +   S   K + F LQN G+ TG+A IL++++++  I
Sbjct:  104 QVWGYSFLAVTIINLASLLGLLLVPFTKKPYFPKVLTYFIGVAIGTLFSNAVLQLIPE-------ALGFDPKADDYVLNAVGIFGGFYLLFFTEKVLKMALKADSADCHSHFPSSQTTDENATHFSNDLVISNISNNVNPNINHEIIPNGPREKPSNLSPVVNPVVSPVNEQDACVVLSCRWLRGEHVSNIKT----VAWMITLSDALHNFIDGLAIGASFTLSLIAGFGTSIAIFCEEFPHEIGDFVILLSSGMSVPQAAFFNLMSAMCCYLGLALGILLGS-NFAPNAIFAIAGGMFLYISLADMFPEMNNITM---EHAKSSTDKVIFFLLQNGGMLTGFAIILLITMFAGDI 444          
BLAST of slc39a-1 vs. Ensembl Cavefish
Match: ENSAMXT00000045640.1 (zinc transporter ZIP4 [Source:NCBI gene;Acc:103045007])

HSP 1 Score: 172.555 bits (436), Expect = 2.387e-46
Identity = 119/378 (31.48%), Postives = 186/378 (49.21%), Query Frame = 2
Query:  461 NEKGLKTFNNYILSRLLNNPCGALT--TSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMK-KKIYNSVMTFMVSLAIGALAGTSILILIPD--SMQISEIALKAKHDKND----YKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            N       +  ++ +LL+  C   +  T+    K S  + ++Y  L  TV  ++A+ GI  +        +   + F +SLA+G+L G ++L L+P    + +        H  ++    Y +K   VV G+Y F+L E +   +T + +                 E  D           + Q+ K N     +    D +N+  K I       +    + +M+   D +HN  DG++IGA FS S   G++ SLAVLC ELPHELGDFAVLL  G+SVK+A+  N+ SA+T ++G  I + V   ++A  WI A   G+FLY+ L DM+ ++I       A  K   L FALQNLGL+TG+  +L+LS + DKI
Sbjct:  213 NRDQFTQLSPALIQQLLSKACTETSPITNPTGDKLSTTERYLYATLANTVICLMAMFGIVMLLCTSCSGFFQLSIQFCISLAVGSLTGDALLHLLPTFLGLHVHGEGQSDGHGHSEENSTYIFKLLVVVGGIYYFYLMETIFSIITRKNS-------DHHHHHHHHGEEGDPHHCDHGKVLQMYQREKKNKLSTSQAELVDGENN-IKSIPEPAPRTREQKLLPYMITISDGIHNFADGLAIGAAFSLSWRSGLATSLAVLCHELPHELGDFAVLLHCGVSVKKALLLNVGSALTSFIGLYIALSVSTDSTAKEWIAAVTTGLFLYVGLADMLPSMIH------AEHKRPWLMFALQNLGLWTGWGILLLLSFFEDKI 576          
BLAST of slc39a-1 vs. Ensembl Sea Lamprey
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:799782])

HSP 1 Score: 228.409 bits (581), Expect = 4.736e-70
Identity = 130/355 (36.62%), Postives = 197/355 (55.49%), Query Frame = 2
Query:  563 VLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVK---------------NSKAKEIIHLDKTKKG-----IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            +  +W YG L VT+ ++ +++G   +P M+KK Y  ++ + ++LAIG L   ++  LIP++  +  +       K+ Y +K+  V AG YLFF  E++LK +  QK        P  + E       D     T+T    L+ ++   + Q  GN   +                N +A+    +    KG     I  +AWM+   D LHN +DG++IGA F+ SV  G+S S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA +CYLG + G++ G    A  WIFA AGGMFLYISL DM   + E +       K+  +TF +QNLGL TG++ +L+L++YS  I
Sbjct:   13 LCSVWGYGFLCVTIISLCSLVGASVVPFMRKKFYRRLLMYFIALAIGTLYSNALFQLIPEAFGLDPV-------KDGYVYKSAVVFAGFYLFFFAEKILKMVLKQKD-----ERPPNRAECYS-SQPDLEDGATET----LKAIEDGTEHQSNGNPPHLAGGGHGHHTHVTHEHANEEAQVSEGMCYWLKGTRYSRIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSIAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACSCYLGLVCGIVAGS-HFAHNWIFALAGGMFLYISLADMFPEMNE-VSKEDGEEKNNLVTFGIQNLGLLTGFSIMLLLTIYSGNI 348          
BLAST of slc39a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000371.1 (pep scaffold:Pmarinus_7.0:GL476519:142118:151022:-1 gene:ENSPMAG00000000332.1 transcript:ENSPMAT00000000371.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.866 bits (442), Expect = 9.628e-47
Identity = 85/171 (49.71%), Postives = 116/171 (67.84%), Query Frame = 2
Query: 1073 DKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDIT-SASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKAL-TFALQNLGLFTGYATILVLSLYSDKIRFDI 1579
            D    G++ +AWMV+ GD +HN  DG++IGA FS S  +G+S S+AV C ELPHELGDFAVLL AGMSVKQA+ +NL+SA+  YLG +IG  VG  T S + WIFA   G+FLY++LVDM+  ++      + S  +  L  F LQNLGL  G+  +LV++ Y + I+ D+
Sbjct:  730 DVRDAGVSSIAWMVILGDGVHNFSDGLAIGAAFSDSTSVGLSTSIAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALLGYLGLVIGTAVGQYTHSVTTWIFAATAGIFLYVALVDMLPEMLHC---EVDSHSYGRLGCFLLQNLGLLMGFGIMLVIARYEEHIKIDL 897          

HSP 2 Score: 68.1662 bits (165), Expect = 2.964e-12
Identity = 34/110 (30.91%), Postives = 62/110 (56.36%), Query Frame = 2
Query:  560 SVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDY----------KWKATGVVAGLYLFFLTERLL 859
            S +  W +G L++T+ ++L++LG+  +P+M +  +  ++TF+V+LA+G L+G ++L L+P S           HD +D+           WK    + G+YL F+ E LL
Sbjct:  481 SNMPAWGWGFLSITIISMLSLLGVAIVPMMNQVFFKYLLTFLVALAVGTLSGDALLHLLPHSQNSHS---HNGHDDHDHILDSDEHLDGIWKGLTGLGGIYLMFIVEHLL 587          
BLAST of slc39a-1 vs. Ensembl Sea Lamprey
Match: SLC39A12 (solute carrier family 39 member 12 [Source:HGNC Symbol;Acc:HGNC:20860])

HSP 1 Score: 164.466 bits (415), Expect = 1.365e-45
Identity = 115/396 (29.04%), Postives = 206/396 (52.02%), Query Frame = 2
Query:  431 KFSNSVVEINNEKGLKTFNNYILSRLLNNPC---GALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMK-KKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKH------DKNDYKWKATGVVAGLYLFFLTER----LLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHEL---GDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            +F++S V   N   L      I+ +LL+  C   G    +      + ++ + YG L V V ++ +++G+  I +   ++ Y  ++   ++LA+G L+G + L LIP  + + + +    H      +KN + WK   ++ G+Y+FFL E+    L+ S   ++       H     + + L +S R     +   S     +L+ +++ +     V   K +       T KG++ +A M++ GDS+HN  DG+++GA FS S   G++ SLA+   E+PHE+   GDFA LL +GM V  A+  N +S++T + G  +G+ + + T    WIF+   GMF YISLVD+M  +      M  + K   + FALQN+GL  G++ +++L+++ D+I
Sbjct:   12 EFNSSGVARRNFSALAV---AIVQQLLSGACWVHGDEEATAPGAAPTTVEKYGYGTLAVLVVSLSSLMGVAVILVTSCQETYRVILQTFIALAVGTLSGDATLHLIPTMLVLHDHSDGHNHAEEDFVEKNSHVWKLMALLGGIYMFFLVEKIFHLLIASSQGEREQQQQQNHCGHSHD-LALRDSFRAGKAGRGTAS---TTRLDTEEEAEVTPTLVALPKHR------GTFKGMSSLAIMILVGDSIHNFADGLAMGAAFSASNRAGLTTSLAIFFHEVPHEIERSGDFAALLNSGMRVCPALVLNFISSLTAFTGLYVGLSLSNDTIVQQWIFSVTAGMFYYISLVDLMPEL------MKVTGKFPWVVFALQNVGLLAGWSIMVLLAVFEDQI 388          
BLAST of slc39a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009266.1 (pep scaffold:Pmarinus_7.0:GL483721:1641:4019:1 gene:ENSPMAG00000008381.1 transcript:ENSPMAT00000009266.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 1.694e-28
Identity = 64/155 (41.29%), Postives = 94/155 (60.65%), Query Frame = 2
Query: 1109 MVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRF 1573
            MV+ GD LHN  DG+++GA FS S+  G++  LAV   ELPHE+  F++LL  G+S++ A+  NL+SA+T  +GF IG  V +  +A  WI AFA GMFLY+S+ +M++ +     D    W    L           G+A +L+L+LY DK+ F
Sbjct:    1 MVLIGDGLHNFADGLALGAAFSLSLSDGLATMLAVALHELPHEIDIFSILLNTGLSIQAALGLNLLSALTALIGFYIGASVSENETAMQWIIAFATGMFLYLSINNMISEMKRFHVD--RPWLLLLLQNLGLF----LGWAFMLLLALYEDKLHF 149          
BLAST of slc39a-1 vs. Ensembl Yeast
Match: YKE4 (Zinc transporter; localizes to the ER; null mutant is sensitive to calcofluor white, leads to zinc accumulation in cytosol; ortholog of the mouse KE4 and member of the ZIP (ZRT, IRT-like Protein) family [Source:SGD;Acc:S000001285])

HSP 1 Score: 71.633 bits (174), Expect = 5.915e-14
Identity = 70/335 (20.90%), Postives = 146/335 (43.58%), Query Frame = 2
Query:  587 LLTVTVNNVLAILGIFFIPLMKKKIYNSV-MTFMVSLAIGALAGTSILILIPDSMQ-ISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDI-----------TSASVWIFAFAGGMFLYISLVDMMNNIIET--IDDMIASWKHKALTFALQNLGLFTGYATILVL 1546
            ++ + +  ++  L + F+P ++K    S+ ++ +VS ++G L G  +L +IP+S+  ++++ +               V   ++L F++                          + L+ + RI S T  ++  +     +   Q+                   + K G    A++ V     H++ DG+++   F  S  +G+  S+AV   E+PHELGDFA+LL++G +  QA+    ++A    +G  IG  + +I            +AS  +  F  G  +YI+   ++  I+ +   D  +  +K     +ALQ + +F G+A + ++
Sbjct:   70 IVAILIIQLMPCLFVLFVPGLRKNDRASLTLSLLVSFSLGTLLGDILLHVIPESLSGVTDVTM---------------VGGAIFLGFIS-------------------------FLTLDKTMRILSGTSNDDGSIHSHSHSHTPQQTA-----------------EKKAGFNMSAYLNVISGIAHHITDGIALATSFYSSTQVGIMTSIAVTFHEIPHELGDFAILLSSGFTFPQAIRAQAVTAFGAVVGTSIGCWMNEIGNNSHKATSSSANASELMLPFTAGGLIYIATTSVVPQILHSSAPDSKLREFK----KWALQLVFIFVGFAVMALM 343          
BLAST of slc39a-1 vs. Ensembl Nematostella
Match: EDO47900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLB0])

HSP 1 Score: 170.244 bits (430), Expect = 3.709e-50
Identity = 84/161 (52.17%), Postives = 120/161 (74.53%), Query Frame = 2
Query: 1091 IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            +APV WM+V GD+LHN +DG++IGAG+S S++ G S +LA+ CEELPHELGDFAVLL  GM+ KQA+F+N +SA TC+LG ++G+++G  T A  WI+A A GMF+YISLV+M+    E ++ +   S K    TFALQN+G+  G+A + +L++Y  +IR
Sbjct:    1 MAPVCWMIVLGDALHNFIDGLAIGAGYSSSILEGASTALAIFCEELPHELGDFAVLLNGGMTYKQAMFFNFISACTCFLGLVMGLLLGYATPAVKWIYALAAGMFIYISLVNMLQEATEMSVKEGEGSIKKNLKTFALQNVGMIIGFAVMFILAIYGPEIR 161          
BLAST of slc39a-1 vs. Ensembl Nematostella
Match: EDO29311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T403])

HSP 1 Score: 158.688 bits (400), Expect = 6.711e-46
Identity = 76/161 (47.20%), Postives = 115/161 (71.43%), Query Frame = 2
Query: 1091 IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMN--NIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            + P+AW +V GD +HN +DG++IGA FS SV+ G+S +LA++ EE+PHELGDFAVLL++GM  + AV +NL+S + CY G ++G+++   T++  WI+A A GMFLYISLVDM+   N +   +   + W +   TFALQN G+  G++ +LVL++Y+  I
Sbjct:    2 VKPIAWTIVIGDCVHNFIDGVAIGAAFSSSVVEGISTALAIIGEEVPHELGDFAVLLSSGMKYRHAVLFNLLSGVICYTGLVLGLLLAYATASVQWIYAIAAGMFLYISLVDMLPEANEMSCKEGEHSVWSNLK-TFALQNSGMLVGFSIMLVLAIYAHDI 161          
BLAST of slc39a-1 vs. Ensembl Nematostella
Match: EDO47899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLA9])

HSP 1 Score: 162.155 bits (409), Expect = 1.076e-45
Identity = 77/163 (47.24%), Postives = 115/163 (70.55%), Query Frame = 2
Query: 1091 IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMN--NIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRF 1573
            + P+AW +V GD +HN +DG++IGA FS SV+ G+S +LA+L EE+PHELGDFAVLL++GM  + AV +NL+S + CY G ++G+++   T++  WI+A A GMFLYISLVDM+   N +   +   + W +   TFALQN G+  G++ +LVL++Y+  I  
Sbjct:  116 VKPIAWTIVIGDCVHNFIDGVAIGAAFSSSVVEGISTALAILGEEVPHELGDFAVLLSSGMKYRHAVLFNLLSGVICYTGLVLGLLLAYATASVQWIYAIAAGMFLYISLVDMLPEANEMSCKEGKHSVWSNLK-TFALQNSGMLVGFSIMLVLAIYAHDIEL 277          

HSP 2 Score: 59.6918 bits (143), Expect = 7.034e-10
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 2
Query:  461 NEKGLKTFNNYILSRLLNNPCGALTTSKESQ---KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIP 739
            NE         ++ ++ N  C  +   K      K   L+ W YG L  T+ N+  ++G+  +P M   +Y +V+ FMVSLA+G L G S+  LIP
Sbjct:   19 NETTFARVCPAVVQQVSNQACRRVAGEKRDDHVFKEPELKAWGYGFLATTIVNIAPLIGVTVVPFMSVAVYKTVLLFMVSLAVGVLCGGSVFHLIP 114          
BLAST of slc39a-1 vs. Ensembl Nematostella
Match: EDO49001 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM0])

HSP 1 Score: 155.992 bits (393), Expect = 6.536e-45
Identity = 76/157 (48.41%), Postives = 113/157 (71.97%), Query Frame = 2
Query: 1109 MVVFGDSLHNLVDGMSIGAGFSQSVILGVSISL----AVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            M++ GD++HN+ DG++IGA FS+    G+S  +    AV C ELPHELGDFAVLLTAGMSVK A+  NL+SA +CYLG IIG+++G      +WIFA AGGMF+Y++LVDM+ +++ +      +WK    TF LQN+G+ TG+A +L+++++ + +
Sbjct:    1 MIIIGDTIHNISDGLAIGAAFSEGGSSGISGGISTSIAVFCHELPHELGDFAVLLTAGMSVKMALLANLLSACSCYLGLIIGIVIGQQMEVRLWIFAVAGGMFIYVALVDMLPDLMHSESLQTDTWK----TFLLQNIGILTGFALMLIIAVFEEDL 153          
BLAST of slc39a-1 vs. Ensembl Nematostella
Match: EDO37361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG18])

HSP 1 Score: 155.606 bits (392), Expect = 6.880e-45
Identity = 74/154 (48.05%), Postives = 110/154 (71.43%), Query Frame = 2
Query: 1109 MVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIE-TIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            MV+ GDS+HN +DG++IGA FS S+I G S SLA+ CEE+PHELGDFAVLL+ GM+V+QA+ +N +SA  C++G  IG+++G  T A  WI+A AGGMF+YI+LV M+  + + ++     S +     FA+QN+G+  G+  + VL++Y  +I
Sbjct:    1 MVLLGDSMHNFLDGLAIGAAFSNSIIEGFSTSLAIFCEEVPHELGDFAVLLSGGMTVRQALGFNFLSACVCFVGMAIGLLLGYTTHAVKWIYALAGGMFVYIALVAMLPEVNQMSMRAGQGSVRKNLKVFAMQNVGMICGFIIMFVLAMYQSQI 154          
BLAST of slc39a-1 vs. Ensembl Medaka
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:101159804])

HSP 1 Score: 237.654 bits (605), Expect = 4.527e-71
Identity = 147/417 (35.25%), Postives = 225/417 (53.96%), Query Frame = 2
Query:  383 KRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGA-----LTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQE-------KGNDCDVKNSKAKEIIH-----LDKTK-KGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
             R  + KC P  + L  +S S     + +GL+     +L +L    C A     L+T   S+     ++W YG+L VT+ ++ +++G   +P M+K  Y  ++ + ++LAIG L   ++  LIP++     +        + Y  K+  V  G YLFF TE++LK L  QK  SHA       +      + D  + +   E   L + K++  + E          D    +++ +   H     L +T    I  +AWM+   D LHN +DG++IGA F+ SV  GVS S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G+  S + WIFA AGGMFLYI+L DM   MN +    +D  A  K   +TFA+QN GL TG++ +L+L++YS  I+
Sbjct:   91 PRTNSSKCLPADT-LALYSISERSRLDGRGLQKLCPTMLQQLSAGSCRAEPEAGLSTDSASRPTDA-EVWGYGILCVTLISLCSLIGASVVPFMRKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFDPLV-------DFYVSKSAVVFGGFYLFFFTEKVLKVLLKQKRGSHAHFSAPDHYSA---PDGDAEKLQQNGEAGALARDKVDSGEGELMLSPPQTLQDPQSPDTRGRSSSHGGCYWLKRTAYSDIGTLAWMITLSDGLHNFIDGLAIGASFTASVFQGVSTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGMGFGILAGNSFSPN-WIFALAGGMFLYIALADMFPEMNEVSREEED--AGGKRFLITFAIQNAGLLTGFSIMLLLTMYSGHIQ 492          
BLAST of slc39a-1 vs. Ensembl Medaka
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:101159804])

HSP 1 Score: 232.646 bits (592), Expect = 2.017e-69
Identity = 149/426 (34.98%), Postives = 225/426 (52.82%), Query Frame = 2
Query:  311 NLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEK--GNDCDVKNSKAKEIIHLDKTK-KGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDM---MNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIR 1570
            +LS + FLF  F I     ++    R + + C P +  L + S        E GL T +        + P  A     E   +  L +W YG+L VT+ ++ +++G   +P M+K  Y  ++ + ++LAIG L   ++  LIP++     +        + Y  K+  V  G YLFF TE++LK L  QK  SHA       +      + D  + +   E   L + K++  + E        ++         L +T    I  +AWM+   D LHN +DG++IGA F+ SV  GVS S+A+LCEE PHELGDF +LL AGMS++QA+F+N +SA  CYLG   G++ G+  S + WIFA AGGMFLYI+L DM   MN +    +D  A  K   +TFA+QN GL TG++ +L+L++YS  I+
Sbjct:   87 HLSTICFLF-QFNISE---RSRLDGRGLQKLC-PTM--LQQLSAGSCRAEPEAGLSTDSA-------SRPTDA---EGEPSMYITLLLWGYGILCVTLISLCSLIGASVVPFMRKTFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFDPLV-------DFYVSKSAVVFGGFYLFFFTEKVLKVLLKQKRGSHAHFSAPDHYSA---PDGDAEKLQQNGEAGALARDKVDSGEGELMLSPPQTLQVCSHGGCYWLKRTAYSDIGTLAWMITLSDGLHNFIDGLAIGASFTASVFQGVSTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGMGFGILAGNSFSPN-WIFALAGGMFLYIALADMFPEMNEVSREEED--AGGKRFLITFAIQNAGLLTGFSIMLLLTMYSGHIQ 482          
BLAST of slc39a-1 vs. Ensembl Medaka
Match: slc39a8 (solute carrier family 39 member 8 [Source:NCBI gene;Acc:101159549])

HSP 1 Score: 210.69 bits (535), Expect = 2.347e-61
Identity = 122/335 (36.42%), Postives = 190/335 (56.72%), Query Frame = 2
Query:  572 IWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLK-SLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKK--GIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            +W YG L VT+ N+ ++LG+  IP  KK  +  V+++ + LAIG L   ++L LIP+       AL    + + Y   +  +  G YL F  E++LK  L       H+ + P        L+N    + +   ++ +L Q+  +    E       +   +  + H  + ++   I  VAWM+  GD+LHN +DG++IGA F+ SV+ G S S A+ CEE PHELGDF +LL +GMSV QAVF+NL+SAM+CY+G + G+++G  + A   IFA AGGMFLYI+L DM    +++I         K + F +QN GL +G+A IL+++L++  I
Sbjct:  130 VWGYGFLAVTIINLASLLGLLLIPFTKKSYFPKVLSYFIGLAIGTLFSNAVLQLIPE-------ALGFNPNADSYVENSVAIFGGFYLLFFVEKVLKMCLGLDGEHGHSHSSPADPPTESYLQNGGVPEKK---DSVVLAQIVTDRNYPEPPQTPTQEVQVSGTMCHWLRGQRITNIKTVAWMITLGDALHNFIDGLAIGASFTVSVLTGFSTSTAIFCEEFPHELGDFVILLNSGMSVPQAVFFNLLSAMSCYIGLVFGILLGS-SFAPNAIFAIAGGMFLYIALADMFPE-MDSIAKGQTQTSSKIIFFLIQNAGLLSGFAIILLITLFAGNI 452          
BLAST of slc39a-1 vs. Ensembl Medaka
Match: ENSORLT00000032294.1 (zinc transporter ZIP10 [Source:NCBI gene;Acc:101174784])

HSP 1 Score: 207.608 bits (527), Expect = 1.340e-57
Identity = 139/401 (34.66%), Postives = 216/401 (53.87%), Query Frame = 2
Query:  545 ESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSM-QISEIALKAKHDKN-----DYKWKATGVVAGLYLFFLTER---LLKSLTNQKTCSHAT--AHPVMKFEIMKLE---------------------------NSDRIQSRTQTENSLLQQMKL----NDKDQEKGNDCDVKNSKAKEIIHL---------DKTKK--GIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDIT-SASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKAL---TFALQNLGLFTGYATILVLSLYSDKIRFD 1576
            E +  + + +W+ G +++TV ++L++LG+  +P++ +  +  ++TF+V+LA+G L+G ++L L+P S  Q       AK   +     D  WK    +AG+YL F+ E    + K   +QK+    +   H   K    KL                            ++D   S  +T +S   +  L      +D +  +  +V+ SK     H          D+  K  GIA +AWMV+ GD +HN  DG++IGA FS ++  G+S S+AV C ELPHELGDFAVLL AGMSVKQA+ +NL+SA+  Y+G IIG  VG  T + + WIFA   GMFLY++LVDM+  ++        S +HK      F LQNLGL TG++ +L+++++ D+I FD
Sbjct:  415 EQKPVNSVWVWVCGFVSITVISLLSLLGVVLVPILNQSCFKFLLTFLVALAVGTLSGDALLHLLPHSQGQHDHSQHGAKEATDLVTDFDGVWKGLTALAGIYLLFIIEHCIAMFKHHKDQKSLGKTSEEGHIGRKLSDHKLNRRSDAEWVHLKPLTEDPDGTAVSCDNGHNDTQLSELRTPDSPTHKTPLASPNPPQDPQSPSKKEVRKSKQHRHGHGHSHGGNCHSDQEMKDAGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYVGMIIGAAVGQYTHNVTNWIFAVTAGMFLYVALVDMLPEMLHG-----DSEEHKRSHLGHFLLQNLGLLTGFSLMLLIAIFEDRIVFD 810          
BLAST of slc39a-1 vs. Ensembl Medaka
Match: ENSORLT00000011005.2 (zinc transporter ZIP10 [Source:NCBI gene;Acc:101174784])

HSP 1 Score: 207.223 bits (526), Expect = 1.681e-57
Identity = 136/401 (33.92%), Postives = 215/401 (53.62%), Query Frame = 2
Query:  545 ESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYK------WKATGVVAGLYLFFLTER---LLKSLTNQKTCSHAT--AHPVMKFEIMKLE---------------------------NSDRIQSRTQTENSLLQQMKL----NDKDQEKGNDCDVKNSKAKEIIHL---------DKTKK--GIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDIT-SASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKAL---TFALQNLGLFTGYATILVLSLYSDKIRFD 1576
            E +  + + +W+ G +++TV ++L++LG+  +P++ +  +  ++TF+V+LA+G L+G ++L L+P S    + +     +  D        WK    +AG+YL F+ E    + K   +QK+    +   H   K    KL                            ++D   S  +T +S   +  L      +D +  +  +V+ SK     H          D+  K  GIA +AWMV+ GD +HN  DG++IGA FS ++  G+S S+AV C ELPHELGDFAVLL AGMSVKQA+ +NL+SA+  Y+G IIG  VG  T + + WIFA   GMFLY++LVDM+  ++        S +HK      F LQNLGL TG++ +L+++++ D+I FD
Sbjct:  424 EQKPVNSVWVWVCGFVSITVISLLSLLGVVLVPILNQSCFKFLLTFLVALAVGTLSGDALLHLLPHSQGQHDHSQHGAKEATDLVTDFDGVWKGLTALAGIYLLFIIEHCIAMFKHHKDQKSLGKTSEEGHIGRKLSDHKLNRRSDAEWVHLKPLTEDPDGTAVSCDNGHNDTQLSELRTPDSPTHKTPLASPNPPQDPQSPSKKEVRKSKQHRHGHGHSHGGNCHSDQEMKDAGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYVGMIIGAAVGQYTHNVTNWIFAVTAGMFLYVALVDMLPEMLHG-----DSEEHKRSHLGHFLLQNLGLLTGFSLMLLIAIFEDRIVFD 819          
BLAST of slc39a-1 vs. Planmine SMEST
Match: SMESG000016191.1 (SMESG000016191.1)

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 460/460 (100.00%), Postives = 460/460 (100.00%), Query Frame = 2
Query:  200 MGSMKRVASVXXXXXXXXXXXXXHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 1579
            MGSMKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI
Sbjct:    1 MGSMKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 460          
BLAST of slc39a-1 vs. Planmine SMEST
Match: SMESG000016191.1 (SMESG000016191.1)

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 457/457 (100.00%), Postives = 457/457 (100.00%), Query Frame = 2
Query:  209 MKRVASVXXXXXXXXXXXXXHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 1579
            MKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI
Sbjct:    1 MKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 457          
BLAST of slc39a-1 vs. Planmine SMEST
Match: SMESG000016191.1 (SMESG000016191.1)

HSP 1 Score: 891.723 bits (2303), Expect = 0.000e+0
Identity = 455/460 (98.91%), Postives = 455/460 (98.91%), Query Frame = 2
Query:  200 MGSMKRVASVXXXXXXXXXXXXXHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 1579
            MGSMKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTE     QMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI
Sbjct:    1 MGSMKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTE-----QMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 455          
BLAST of slc39a-1 vs. Planmine SMEST
Match: SMESG000016191.1 (SMESG000016191.1)

HSP 1 Score: 885.945 bits (2288), Expect = 0.000e+0
Identity = 452/457 (98.91%), Postives = 452/457 (98.91%), Query Frame = 2
Query:  209 MKRVASVXXXXXXXXXXXXXHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 1579
            MKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTE     QMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI
Sbjct:    1 MKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFKIKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYILSRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDRIQSRTQTE-----QMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSDKIRFDI 452          
BLAST of slc39a-1 vs. Planmine SMEST
Match: SMESG000016243.1 (SMESG000016243.1)

HSP 1 Score: 318.931 bits (816), Expect = 7.373e-103
Identity = 179/436 (41.06%), Postives = 267/436 (61.24%), Query Frame = 2
Query:  332 LFDNFKIKT--DYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNE--KGLKTFNNYILSRLLNNPCGALTTSKESQ---KFSVLQIWIYGLLTVTVNNVLAILGIFFIPLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERLLKSLTNQK--------TCSHATAH----PVMKFEIMKLENSDRIQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDD-----MIASWKHKALTFALQNLGLFTGYATILVLSLYSDKI 1567
            LF NF ++   D  K    K N + +C        +F NS  E+     +GL      I+ +++   C  +  +  S      S +++W+YG ++VT+ N  A LGI FIPLM KK Y  +MTFM+SLA+G+L G+++LILIPD+MQ++E+       +  YK+KAT V  G+Y+FFL ER LK + N++        + SH + +    P  K EI ++ + + +    + + +L         + E     ++  +           KK +APVAWM++FGD+LHN +DG+SIGA FS + + G+S+S+AV+CEELPHELGDFA+LL AGM++KQA+ WN++SA TCY+GFIIGVI+G+ TS S W+FA AGGMFLYISLVDMM+ +  T++D     ++     K  TF +QN+GL  GY+ +L+++LY DKI
Sbjct:   29 LFLNFSLQNAGDLMKNKLSKANFSTEC-----LARRFVNSTPELQKSTFEGLIAM---IVDKVIIPHCNIIKLNSPSHSKCNLSSVKMWVYGFISVTIINACAGLGILFIPLMNKKFYKVLMTFMISLAVGSLTGSALLILIPDAMQLAELQHGYPGYQVSYKYKATVVFGGVYMFFLLERFLKWMINKEVRTFNRANSLSHGSLNISRTPKPKLEIDQINSDNHLIVAPEMKTTLNNHCNNKPNNNEV---IELNLNSTDIPKIKYIKKKPVAPVAWMIIFGDALHNFIDGLSIGAAFSHNTMTGISLSIAVICEELPHELGDFAILLNAGMNIKQALMWNMLSAATCYIGFIIGVILGETTSGSTWVFAVAGGMFLYISLVDMMSEMNATLEDKDSVEVVEFGIFK--TFIIQNIGLLMGYSILLLMALYGDKI 451          
The following BLAST results are available for this feature:
BLAST of slc39a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC39A141.419e-6836.18solute carrier family 39 member 14 [Source:HGNC Sy... [more]
SLC39A141.419e-6836.18solute carrier family 39 member 14 [Source:HGNC Sy... [more]
SLC39A144.370e-6734.92solute carrier family 39 member 14 [Source:HGNC Sy... [more]
SLC39A141.173e-6135.46solute carrier family 39 member 14 [Source:HGNC Sy... [more]
SLC39A82.201e-6033.67solute carrier family 39 member 8 [Source:HGNC Sym... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zipt-152.156e-6335.42Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-151.060e-5137.73Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-173.138e-3428.72Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-7.14.084e-2524.77Zinc transporter zipt-7.1 [Source:UniProtKB/Swiss... [more]
zipt-165.717e-2532.42Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zip71B4.999e-4131.58gene:FBgn0036461 transcript:FBtr0113171[more]
Zip71B4.999e-4131.58gene:FBgn0036461 transcript:FBtr0347146[more]
foi2.199e-4048.08gene:FBgn0024236 transcript:FBtr0331418[more]
foi2.199e-4048.08gene:FBgn0024236 transcript:FBtr0345601[more]
foi2.199e-4048.08gene:FBgn0024236 transcript:FBtr0331417[more]
back to top
BLAST of slc39a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc39a145.617e-6934.10solute carrier family 39 member 14 [Source:NCBI ge... [more]
slc39a146.760e-6834.95solute carrier family 39 member 14 [Source:NCBI ge... [more]
slc39a146.760e-6834.95solute carrier family 39 member 14 [Source:NCBI ge... [more]
slc39a61.445e-5631.86solute carrier family 39 member 6 [Source:ZFIN;Acc... [more]
LO018202.14.602e-4731.93pep chromosome:GRCz11:14:50034196:50059783:1 gene:... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC39A82.150e-7335.70solute carrier family 39 (zinc transporter), membe... [more]
slc8a24.555e-7133.41solute carrier family 8 member A2 [Source:Xenbase;... [more]
slc8a21.998e-6833.18solute carrier family 8 member A2 [Source:Xenbase;... [more]
tmem1353.244e-5231.28transmembrane protein 135 [Source:Xenbase;Acc:XB-G... [more]
tmem1359.021e-5231.69transmembrane protein 135 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc39a145.343e-7134.78solute carrier family 39 (zinc transporter), membe... [more]
Slc39a142.110e-7033.03solute carrier family 39 (zinc transporter), membe... [more]
Slc39a142.110e-7033.03solute carrier family 39 (zinc transporter), membe... [more]
Slc39a83.943e-6434.00solute carrier family 39 (metal ion transporter), ... [more]
Slc39a83.943e-6434.00solute carrier family 39 (metal ion transporter), ... [more]
back to top
BLAST of slc39a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q75N73|S39AE_MOUSE3.737e-7034.78Metal cation symporter ZIP14 OS=Mus musculus OX=10... [more]
sp|Q5RAB7|S39AE_PONAB4.500e-6837.47Metal cation symporter ZIP14 OS=Pongo abelii OX=96... [more]
sp|A4IGY6|S39AE_XENTR6.251e-6833.18Metal cation symporter ZIP14 OS=Xenopus tropicalis... [more]
sp|Q15043|S39AE_HUMAN6.814e-6836.18Metal cation symporter ZIP14 OS=Homo sapiens OX=96... [more]
sp|A5D7L5|S39AE_BOVIN1.530e-6735.97Metal cation symporter ZIP14 OS=Bos taurus OX=9913... [more]
back to top
BLAST of slc39a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJE90.000e+0100.00Slc39a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFM27.637e-8741.10Slc39a-12 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A1S3GZ266.447e-8238.24zinc transporter ZIP14 isoform X2 OS=Lingula ungui... [more]
A0A1S3GZA72.939e-7936.47zinc transporter ZIP14 isoform X1 OS=Lingula ungui... [more]
V3ZVH34.329e-7940.56Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc39a143.513e-6733.59solute carrier family 39 member 14 [Source:NCBI ge... [more]
ENSAMXT00000003334.26.220e-6535.41zinc transporter ZIP8-like [Source:NCBI gene;Acc:1... [more]
slc39a108.864e-5933.09solute carrier family 39 member 10 [Source:NCBI ge... [more]
slc39a81.226e-5536.52zinc transporter ZIP8 [Source:NCBI gene;Acc:103035... [more]
ENSAMXT00000045640.12.387e-4631.48zinc transporter ZIP4 [Source:NCBI gene;Acc:103045... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc39a144.736e-7036.62solute carrier family 39 member 14 [Source:NCBI ge... [more]
ENSPMAT00000000371.19.628e-4749.71pep scaffold:Pmarinus_7.0:GL476519:142118:151022:-... [more]
SLC39A121.365e-4529.04solute carrier family 39 member 12 [Source:HGNC Sy... [more]
ENSPMAT00000009266.11.694e-2841.29pep scaffold:Pmarinus_7.0:GL483721:1641:4019:1 gen... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YKE45.915e-1420.90Zinc transporter; localizes to the ER; null mutant... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479003.709e-5052.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293116.711e-4647.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478991.076e-4547.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490016.536e-4548.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373616.880e-4548.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc39a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc39a144.527e-7135.25solute carrier family 39 member 14 [Source:NCBI ge... [more]
slc39a142.017e-6934.98solute carrier family 39 member 14 [Source:NCBI ge... [more]
slc39a82.347e-6136.42solute carrier family 39 member 8 [Source:NCBI gen... [more]
ENSORLT00000032294.11.340e-5734.66zinc transporter ZIP10 [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000011005.21.681e-5733.92zinc transporter ZIP10 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of slc39a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016191.10.000e+0100.00SMESG000016191.1[more]
SMESG000016191.10.000e+0100.00SMESG000016191.1[more]
SMESG000016191.10.000e+098.91SMESG000016191.1[more]
SMESG000016191.10.000e+098.91SMESG000016191.1[more]
SMESG000016243.17.373e-10341.06SMESG000016243.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029625
GenBankAKN21666.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029625 ID=SMED30029625|Name=slc39a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1745bp
ATTCCATCTGAACCCTAGGTTGGTGTATAAGGATAAGGTCTAATTTGAAT
ATTTATATCATTGCATAAATAGATATTGTCGCTTGACGCTCAACTGAGAT
TCACTTGAATTCGTTTCACTTCAACTTTGCCGAGAATTTTCAATTGAAAT
ATTATTATTGTTTTATTTTGTTGCTGAGATTGCGTCACAGTCCAGTCGAA
TGGGTTCAATGAAGCGTGTCGCGTCAGTTCTTCTGTTGTTGAATCTTGGG
ATCTGCTGTGGAAATATTCATCAGTCGTTCTCGGATATTTTATCTCTCGG
CCAGAGATTCAATTTGTCGAATGTTGATTTTTTGTTTGACAATTTTAAAA
TCAAAACCGATTATTGGAAAGCAAGTTTCGGAAAGAGAAATATTACAGAA
AAGTGTGGACCAGTTATATCTTATTTGAACAAATTCTCCAATTCTGTCGT
CGAAATAAATAATGAAAAAGGTTTAAAGACATTCAATAATTACATTCTTT
CTCGGTTACTAAATAATCCATGTGGAGCGTTGACAACTTCAAAGGAATCT
CAGAAATTTTCAGTTTTACAAATATGGATTTACGGCCTCCTCACGGTAAC
TGTGAATAATGTCTTGGCGATCTTGGGAATATTTTTCATACCATTAATGA
AGAAGAAGATTTACAACTCAGTTATGACCTTTATGGTTTCATTGGCAATT
GGAGCATTGGCCGGAACGAGCATTTTGATTCTCATTCCAGACTCTATGCA
AATCTCAGAGATCGCCTTGAAAGCGAAACACGATAAGAACGACTACAAAT
GGAAGGCCACTGGAGTTGTTGCTGGATTGTATTTATTTTTCCTTACTGAA
CGGTTATTGAAGTCATTAACAAATCAGAAAACTTGTTCTCATGCCACTGC
TCACCCAGTAATGAAGTTTGAGATTATGAAGCTGGAAAACTCAGACAGGA
TCCAGTCGAGAACTCAAACCGAAAATTCTCTTTTACAGCAAATGAAATTA
AATGACAAAGATCAAGAAAAGGGAAATGATTGTGATGTTAAAAATAGTAA
AGCCAAAGAAATCATTCATCTAGATAAAACAAAGAAAGGAATAGCTCCAG
TAGCTTGGATGGTAGTCTTTGGAGACTCTTTGCATAATTTGGTAGACGGA
ATGTCTATTGGAGCCGGATTTTCTCAAAGCGTTATACTCGGAGTGAGCAT
ATCTTTGGCGGTTCTATGTGAAGAGTTACCTCATGAATTAGGTGATTTTG
CTGTTCTTCTTACAGCTGGGATGTCTGTGAAGCAGGCAGTATTCTGGAAT
CTAATGTCCGCAATGACCTGCTATCTCGGTTTTATTATTGGTGTTATTGT
TGGGGATATTACGTCTGCTTCGGTTTGGATCTTTGCATTTGCTGGAGGAA
TGTTTCTGTACATTAGTTTAGTTGATATGATGAATAACATCATCGAAACG
ATTGATGACATGATAGCCTCATGGAAGCATAAAGCTCTGACGTTTGCGCT
TCAAAATTTAGGACTTTTCACCGGATACGCTACGATATTGGTTTTGTCAC
TTTACAGTGATAAAATTCGGTTTGATATCTGAGATTCGCTCATTCCAAAT
CCAAAAGAAAAGACCATTCAACCTTTATTTATATAAAAATTAGTTTTTGA
TTTTTAGGCTCATTAGGTTGCGTTATATGTGAGATCGGGGCTCACGTGAA
CCAGTTATAAATAAATTATTATTTAGAAATATATCTTCTGAAATT
back to top

protein sequence of SMED30029625-orf-1

>SMED30029625-orf-1 ID=SMED30029625-orf-1|Name=SMED30029625-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=461bp
MGSMKRVASVLLLLNLGICCGNIHQSFSDILSLGQRFNLSNVDFLFDNFK
IKTDYWKASFGKRNITEKCGPVISYLNKFSNSVVEINNEKGLKTFNNYIL
SRLLNNPCGALTTSKESQKFSVLQIWIYGLLTVTVNNVLAILGIFFIPLM
KKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYK
WKATGVVAGLYLFFLTERLLKSLTNQKTCSHATAHPVMKFEIMKLENSDR
IQSRTQTENSLLQQMKLNDKDQEKGNDCDVKNSKAKEIIHLDKTKKGIAP
VAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDF
AVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGG
MFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLS
LYSDKIRFDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003689ZIP
Vocabulary: biological process
TermDefinition
GO:0030001metal ion transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0046873metal ion transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003689Zinc/iron permeasePFAMPF02535Zipcoord: 124..449
e-value: 2.8E-61
score: 207.6
NoneNo IPR availablePANTHERPTHR12191SOLUTE CARRIER FAMILY 39coord: 85..460
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.715
NoneNo IPR availableTMHMMTMhelixcoord: 429..451
NoneNo IPR availableTMHMMTMhelixcoord: 363..385
NoneNo IPR availableTMHMMTMhelixcoord: 389..408
NoneNo IPR availableTMHMMTMhelixcoord: 157..179
NoneNo IPR availableTMHMMTMhelixcoord: 125..147