Heterogeneous nuclear ribonucleoprotein K

Overview
NameHeterogeneous nuclear ribonucleoprotein K
Smed IDSMED30029624
Length (bp)1775
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein K (SMED30029624) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein K (SMED30029624) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein K (SMED30029624) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein K (SMED30029624) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029624

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029624SMESG000064674.1 SmedASXL_007972SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029624SMESG000064674.1 SmedASXL_007972SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029624 SmedASXL_072299SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30029624SMESG000064674.1 dd_Smed_v4_1998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029624SMESG000064674.1 dd_Smed_v4_1998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029624SMESG000064674.1 dd_Smed_v4_1998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029624SMESG000064674.1 dd_Smed_v4_1998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029624SMESG000064674.1 dd_Smed_v4_1998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029624SMESG000064674.1 dd_Smed_v4_1998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 80.8777 bits (198), Expect = 9.251e-16
Identity = 43/136 (31.62%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E              ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEYQH-----------YKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 209          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 78.9518 bits (193), Expect = 6.959e-15
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          

HSP 2 Score: 56.6102 bits (135), Expect = 7.983e-8
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  386 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 457          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 78.9518 bits (193), Expect = 6.959e-15
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          

HSP 2 Score: 56.6102 bits (135), Expect = 7.983e-8
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  386 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 457          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 78.9518 bits (193), Expect = 6.988e-15
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          

HSP 2 Score: 56.6102 bits (135), Expect = 7.928e-8
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  386 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 457          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 78.9518 bits (193), Expect = 6.988e-15
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          

HSP 2 Score: 56.6102 bits (135), Expect = 7.928e-8
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  386 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 457          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 51.2174 bits (121), Expect = 1.283e-6
Identity = 34/128 (26.56%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENY 730
            RV  + +  +  + I ++ +P L++    N  +R P           ++R LVH S  GA+IG+ G  +K LR +   + +K+F   AP S+DR++   G+   V      +   ++   IKG    Y
Sbjct:   76 RVCTVTADEKTVLNILKDVLPRLED----NFSERDPC----------EVRMLVHQSHAGALIGRNGSKIKELREKCS-ARLKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPY 188          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 51.2174 bits (121), Expect = 1.283e-6
Identity = 34/128 (26.56%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENY 730
            RV  + +  +  + I ++ +P L++    N  +R P           ++R LVH S  GA+IG+ G  +K LR +   + +K+F   AP S+DR++   G+   V      +   ++   IKG    Y
Sbjct:   76 RVCTVTADEKTVLNILKDVLPRLED----NFSERDPC----------EVRMLVHQSHAGALIGRNGSKIKELREKCS-ARLKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPY 188          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 51.2174 bits (121), Expect = 1.351e-6
Identity = 34/128 (26.56%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENY 730
            RV  + +  +  + I ++ +P L++    N  +R P           ++R LVH S  GA+IG+ G  +K LR +   + +K+F   AP S+DR++   G+   V      +   ++   IKG    Y
Sbjct:   93 RVCTVTADEKTVLNILKDVLPRLED----NFSERDPC----------EVRMLVHQSHAGALIGRNGSKIKELREKCS-ARLKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPY 205          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0086219)

HSP 1 Score: 78.9518 bits (193), Expect = 2.223e-15
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  464 FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFD 748
            F + + + D+R L+H S  G +IGKGG  +K +R +     +KVF   AP S+DR+VQ VGK  +V E  R +        IKG + NY+  NFD
Sbjct:    5 FEERDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFD 99          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0086221)

HSP 1 Score: 79.337 bits (194), Expect = 2.473e-15
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  464 FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFD 748
            F + + + D+R L+H S  G +IGKGG  +K +R +     +KVF   AP S+DR+VQ VGK  +V E  R +        IKG + NY+  NFD
Sbjct:   94 FEERDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFD 188          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0301760)

HSP 1 Score: 79.337 bits (194), Expect = 2.508e-15
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  464 FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFD 748
            F + + + D+R L+H S  G +IGKGG  +K +R +     +KVF   AP S+DR+VQ VGK  +V E  R +        IKG + NY+  NFD
Sbjct:   88 FEERDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFD 182          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0086220)

HSP 1 Score: 79.337 bits (194), Expect = 2.842e-15
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  464 FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFD 748
            F + + + D+R L+H S  G +IGKGG  +K +R +     +KVF   AP S+DR+VQ VGK  +V E  R +        IKG + NY+  NFD
Sbjct:   88 FEERDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFD 182          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0336730)

HSP 1 Score: 79.337 bits (194), Expect = 2.842e-15
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  464 FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFD 748
            F + + + D+R L+H S  G +IGKGG  +K +R +     +KVF   AP S+DR+VQ VGK  +V E  R +        IKG + NY+  NFD
Sbjct:   88 FEERDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFD 182          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K, like [Source:ZFIN;Acc:ZDB-GENE-040426-1923])

HSP 1 Score: 72.4034 bits (176), Expect = 5.290e-13
Identity = 40/137 (29.20%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESL 757
            R+  + + ++   +I  + +P L+E              +   + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK ++V EC +VI + I    IKG+ + Y+   +DE+ 
Sbjct:   87 RILSVSADIDTIGEILLKIIPTLEEYQH-----------YSGTDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELIAEAPIKGRAQPYDPNFYDETY 211          

HSP 2 Score: 60.077 bits (144), Expect = 4.335e-9
Identity = 46/135 (34.07%), Postives = 68/135 (50.37%), Query Frame = 2
Query: 1154 NSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            N RRGR     P   YE+ +   GG  DN +    F +   G             S+   P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  313 NDRRGR-----PGDRYESMS---GGGYDNNSSWEPFQSGGRGSY-----------SDIGGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL---EGSEDRIITITGTQDQIQNAQYLLQNSVKQ 425          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K, like [Source:ZFIN;Acc:ZDB-GENE-040426-1923])

HSP 1 Score: 72.4034 bits (176), Expect = 5.290e-13
Identity = 40/137 (29.20%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESL 757
            R+  + + ++   +I  + +P L+E              +   + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK ++V EC +VI + I    IKG+ + Y+   +DE+ 
Sbjct:   87 RILSVSADIDTIGEILLKIIPTLEEYQH-----------YSGTDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELIAEAPIKGRAQPYDPNFYDETY 211          

HSP 2 Score: 60.077 bits (144), Expect = 4.335e-9
Identity = 46/135 (34.07%), Postives = 68/135 (50.37%), Query Frame = 2
Query: 1154 NSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            N RRGR     P   YE+ +   GG  DN +    F +   G             S+   P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  313 NDRRGR-----PGDRYESMS---GGGYDNNSSWEPFQSGGRGSY-----------SDIGGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL---EGSEDRIITITGTQDQIQNAQYLLQNSVKQ 425          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K, like [Source:ZFIN;Acc:ZDB-GENE-040426-1923])

HSP 1 Score: 72.0182 bits (175), Expect = 5.508e-13
Identity = 40/136 (29.41%), Postives = 71/136 (52.21%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + ++   +I  + +P L+E              +   + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK ++V EC +VI + I    IKG+ + Y+   +DE+
Sbjct:   87 RILSVSADIDTIGEILLKIIPTLEEYQH-----------YSGTDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELIAEAPIKGRAQPYDPNFYDET 210          

HSP 2 Score: 56.225 bits (134), Expect = 6.120e-8
Identity = 31/75 (41.33%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  343 PVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL---EGSEDRIITITGTQDQIQNAQYLLQNSVKQ 414          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:ZFIN;Acc:ZDB-GENE-040426-1926])

HSP 1 Score: 69.707 bits (169), Expect = 3.361e-12
Identity = 39/136 (28.68%), Postives = 69/136 (50.74%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +    +I  + +P L+E       Q      F     + ++R L+H S  G+IIG  G  +K LR   Q + IK+F    P S+DR+V + GK ++V +C + + + I    IKG+ + Y+   +DE+
Sbjct:   86 RILSVSADIPTVAEILLKIIPTLEEY------QHHKGVDF-----DCELRLLIHQSLAGSIIGLKGAKIKELRDSTQ-TTIKLFQECCPQSTDRVVLVGGKAERVVQCIKTMLELIVEAPIKGRAQQYDPNFYDET 209          

HSP 2 Score: 53.5286 bits (127), Expect = 4.067e-7
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 2
Query: 1319 SNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQ 1543
            S S  P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E   + I+ +TGT+DQI+ AQYL+Q
Sbjct:  335 SYSDGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSE---DRIITITGTQDQIQNAQYLLQ 406          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:ZFIN;Acc:ZDB-GENE-040426-1926])

HSP 1 Score: 69.707 bits (169), Expect = 3.465e-12
Identity = 39/136 (28.68%), Postives = 69/136 (50.74%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +    +I  + +P L+E       Q      F     + ++R L+H S  G+IIG  G  +K LR   Q + IK+F    P S+DR+V + GK ++V +C + + + I    IKG+ + Y+   +DE+
Sbjct:   86 RILSVSADIPTVAEILLKIIPTLEEY------QHHKGVDF-----DCELRLLIHQSLAGSIIGLKGAKIKELRDSTQ-TTIKLFQECCPQSTDRVVLVGGKAERVVQCIKTMLELIVEAPIKGRAQQYDPNFYDET 209          

HSP 2 Score: 53.9138 bits (128), Expect = 3.149e-7
Identity = 32/77 (41.56%), Postives = 47/77 (61.04%), Query Frame = 2
Query: 1319 SNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIR 1549
            S S  P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E   + I+ +TGT+DQI+ AQYL+Q R
Sbjct:  335 SYSDGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSE---DRIITITGTQDQIQNAQYLLQNR 408          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:394952])

HSP 1 Score: 80.1073 bits (196), Expect = 1.820e-15
Identity = 44/136 (32.35%), Postives = 75/136 (55.15%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E              F+ ++ + ++R L+H S  G IIG  G  +K LR + Q + IK+F    P+S+DR+V I GK D+V EC +VI D I    +KG+ + Y+   +DE+
Sbjct:   83 RILSISADIETIGEILKKIIPTLEEYQH-----------FKGNDFDCELRLLIHQSLAGGIIGVKGAKIKELREKTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKVILDLISESPVKGRSQPYDPNFYDET 206          

HSP 2 Score: 53.5286 bits (127), Expect = 5.451e-7
Identity = 30/75 (40.00%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQ+L+Q  VK+
Sbjct:  319 PVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP---LEGSDDRIITITGTQDQIQNAQFLLQNSVKQ 390          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:394952])

HSP 1 Score: 79.7221 bits (195), Expect = 1.947e-15
Identity = 44/136 (32.35%), Postives = 75/136 (55.15%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E              F+ ++ + ++R L+H S  G IIG  G  +K LR + Q + IK+F    P+S+DR+V I GK D+V EC +VI D I    +KG+ + Y+   +DE+
Sbjct:   64 RILSISADIETIGEILKKIIPTLEEYQH-----------FKGNDFDCELRLLIHQSLAGGIIGVKGAKIKELREKTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKVILDLISESPVKGRSQPYDPNFYDET 187          

HSP 2 Score: 53.5286 bits (127), Expect = 5.355e-7
Identity = 30/75 (40.00%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQ+L+Q  VK+
Sbjct:  300 PVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP---LEGSDDRIITITGTQDQIQNAQFLLQNSVKQ 371          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:394952])

HSP 1 Score: 78.9518 bits (193), Expect = 3.038e-15
Identity = 44/136 (32.35%), Postives = 75/136 (55.15%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E              F+ ++ + ++R L+H S  G IIG  G  +K LR + Q + IK+F    P+S+DR+V I GK D+V EC +VI D I    +KG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEYQH-----------FKGNDFDCELRLLIHQSLAGGIIGVKGAKIKELREKTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKVILDLISESPVKGRSQPYDPNFYDET 209          

HSP 2 Score: 53.5286 bits (127), Expect = 6.157e-7
Identity = 30/75 (40.00%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQ+L+Q  VK+
Sbjct:  291 PVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP---LEGSDDRIITITGTQDQIQNAQFLLQNSVKQ 362          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 81.2629 bits (199), Expect = 2.041e-16
Identity = 43/136 (31.62%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E              ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEYQH-----------YKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 209          

HSP 2 Score: 49.2914 bits (116), Expect = 8.323e-6
Identity = 27/97 (27.84%), Postives = 49/97 (50.52%), Query Frame = 2
Query:  467 RDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESL 757
            R+ +  +++R L+     GA+IGKGG N+K LR  +  S+     VP  +  +R++ I    + + E  + I  T+E      + ++Y   +FD  L
Sbjct:   37 RNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASV----SVPDSSGPERILSISADIETIGEILKKIIPTLE------EYQHYKGSDFDCEL 123          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 79.7221 bits (195), Expect = 4.073e-16
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 80.1073 bits (196), Expect = 1.817e-15
Identity = 43/137 (31.39%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESL 757
            R+  + + +E   +I ++ +P L+E              ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+ 
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEYQH-----------YKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY 210          

HSP 2 Score: 56.6102 bits (135), Expect = 5.127e-8
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  362 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL---EGSEDRIITITGTQDQIQNAQYLLQNSVKQ 433          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 80.1073 bits (196), Expect = 1.910e-15
Identity = 43/137 (31.39%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESL 757
            R+  + + +E   +I ++ +P L+E              ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+ 
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEYQH-----------YKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY 210          

HSP 2 Score: 56.6102 bits (135), Expect = 5.275e-8
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  362 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 433          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 76.2554 bits (186), Expect = 3.657e-15
Identity = 44/142 (30.99%), Postives = 74/142 (52.11%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYN 733
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYD 226          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|O19049|HNRPK_RABIT (Heterogeneous nuclear ribonucleoprotein K OS=Oryctolagus cuniculus OX=9986 GN=HNRNPK PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.627e-14
Identity = 47/149 (31.54%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          F+  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHFKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          

HSP 2 Score: 56.6102 bits (135), Expect = 3.867e-7
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  386 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 457          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|Q5ZIQ3|HNRPK_CHICK (Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus OX=9031 GN=HNRNPK PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.002e-14
Identity = 43/136 (31.62%), Postives = 72/136 (52.94%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + +  E   +I ++ +P L+E              ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   83 RILSISADTETIGEILKKIIPTLEEYQH-----------YKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 206          

HSP 2 Score: 56.6102 bits (135), Expect = 3.645e-7
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  350 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL---EGSEDRIITITGTQDQIQNAQYLLQNSVKQ 421          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P61980|HNRPK_RAT (Heterogeneous nuclear ribonucleoprotein K OS=Rattus norvegicus OX=10116 GN=Hnrnpk PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.342e-14
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          

HSP 2 Score: 56.6102 bits (135), Expect = 3.834e-7
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  386 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 457          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P61979|HNRPK_MOUSE (Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus OX=10090 GN=Hnrnpk PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.342e-14
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          

HSP 2 Score: 56.6102 bits (135), Expect = 3.834e-7
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  386 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 457          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P61978|HNRPK_HUMAN (Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.342e-14
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECM---SANVDQRRPAGS----------FRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I ++ +P L+E +   S     + P  S          ++  + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V I GK D+V EC ++I D I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDET 233          

HSP 2 Score: 56.6102 bits (135), Expect = 3.834e-7
Identity = 32/75 (42.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            PI   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  386 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 457          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A5K3FHU1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.460e-20
Identity = 56/160 (35.00%), Postives = 86/160 (53.75%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANV-DQRRPAGSFR----------------DDNPE-------IDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            RVF +E  + +   +WRE +P+LK+ MSA + D +   G  R                 D PE       ID+R LVH S  G IIGKGG  ++ LR +H++ +IKV+ + AP S+DR+VQ++ + +   +C   I +  E  TI+G  E Y++ N  E+
Sbjct:   68 RVFAIEGALSDICNVWREIMPKLKDVMSARLSDPKVIMGQGRLPRRKRVQDGDGEKNEGDQPEEEEDDKMIDLRLLVHQSIAGCIIGKGGDRIRELRQKHKMRVIKVYQMFAPGSTDRVVQLIAEPENAIQCMEAIVEVAEVTTIRGPTELYDATNCCEA 227          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A0R3TE11 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS5298 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.745e-20
Identity = 52/157 (33.12%), Postives = 86/157 (54.78%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANV-DQRRPAGSFR---------------------DDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDE 751
            RVF +E  ++    +WR+ +P++KE +SA + D +   G  R                      D+  IDIR L+H S  G IIGKGG  +++++ +HQ+ +IKV+ + AP S+DR+VQ++ + +   +C   I +  E   ++G VENY+  NF E
Sbjct:   69 RVFTIEGDLDKICDVWRDILPKVKEIISAKLSDPKVIMGQQRIQRRKWNQGDGDQQDGGNKDDADDKMIDIRVLIHQSIAGFIIGKGGEKIRDMKQKHQMRVIKVYQMLAPGSTDRVVQLIAESENAIQCLYEILNVAEKMQVRGPVENYDPANFSE 225          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A3B3SD77 (Heterogeneous nuclear ribonucleoprotein K, like OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.053e-19
Identity = 108/407 (26.54%), Postives = 166/407 (40.79%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAXXXXXXXXXXXXXXXXXXXXXXXDNRRTGAPLLGANDRNLRFNSRPPPNEQFFPKPEINRNINNNFPAKPPANRFDNTYNDNFIEEPPEDFEMKSDXXXXXXXXXXRLPVFNEPNLPGIRKRNFIDTELDNSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRN---PVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            R+  + + +E   +I  + +P L+E    N             + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK D+V EC +VI + I    IKG+ + Y+   +DE+          +                 R  G P+ G       F   PPP     P P   R+ ++  P + P               PP                    P+ +     G R RN         R G  R   P   YE+ +   GG  DN +    F +   G   +   PV+T               +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:   87 RILSVSADIETVGEILLKIIPTLEEYQHYN-----------GIDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPDRVVECIKVILELISEAPIKGRAQPYDPNFYDETYDYGGFTMFEERA--------------RRPMGFPMRGRGG----FERMPPPGRGGRPLPPSRRDYDDMSPRRGP---------------PP--------------------PLASRGGRGGSRARNLPLPPPPPPRGGD-RRARPVDRYESLS---GGGYDNSSSWEPFQSGGRGSYGDIGGPVIT--------------TQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 407          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A0R3WKH6 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1216 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.389e-19
Identity = 54/141 (38.30%), Postives = 82/141 (58.16%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSA-NVDQRRPAGSFRDDNPEID------IRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFD 748
            RVF +E    N     RE    L + +SA N DQR   G   D+  ++D      +R L+H SQVG++IGK G  +K LR +H++ IIK++   AP S+DR++Q++G+   VF C   I +T+ES   +G   +Y++ NFD
Sbjct:   67 RVFNMEGDRPNICGCLRELTDVLMDVLSAKNADQRLLEGRKDDEGNDLDPAKLLDLRILIHHSQVGSVIGKSGDKIKELREKHRMQIIKIYQEFAPRSTDRVLQLIGEPQNVFACVEDIMETLESAPPRGHRSDYDANNFD 207          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A087VZJ6 (Heterolocus tagous nuclear ribonucleoprotein k OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000156500 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.603e-19
Identity = 54/141 (38.30%), Postives = 82/141 (58.16%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSA-NVDQRRPAGSFRDDNPEID------IRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFD 748
            RVF +E    N     RE    L + +SA N DQR   G   D+  ++D      +R L+H SQVG++IGK G  +K LR +H++ IIK++   AP S+DR++Q++G+   VF C   I +T+ES   +G   +Y++ NFD
Sbjct:   67 RVFNMEGDRPNICGCLRELTDVLMDVLSAKNADQRLLEGRKDDEGNDLDPAKLLDLRILIHHSQVGSVIGKSGDKIKELREKHRMQIIKIYQEFAPRSTDRVLQLIGEPQNVFACVEDIMETLESAPPRGHRSDYDANNFD 207          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 71.2478 bits (173), Expect = 1.012e-12
Identity = 41/136 (30.15%), Postives = 69/136 (50.74%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I  + +P L+E    N             + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK  +V EC +VI +      IKG+ + Y+   +DE+
Sbjct:   87 RILSVSADIETIGEILLKIIPTLEEYQHYN-----------GIDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDET 210          

HSP 2 Score: 58.5362 bits (140), Expect = 1.101e-8
Identity = 45/132 (34.09%), Postives = 66/132 (50.00%), Query Frame = 2
Query: 1154 NSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIR 1549
            N RRGR     P   YE+ +   GG  DN +    F +   G             S+   P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q R
Sbjct:  314 NDRRGR-----PGDRYESMS---GGGYDNNSSWEPFQSGGRGSY-----------SDIGGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP---LEGSEDRIITITGTQDQIQNAQYLLQNR 423          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 70.8626 bits (172), Expect = 1.093e-12
Identity = 41/136 (30.15%), Postives = 69/136 (50.74%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I  + +P L+E    N             + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK  +V EC +VI +      IKG+ + Y+   +DE+
Sbjct:   87 RILSVSADIETIGEILLKIIPTLEEYQHYN-----------GIDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDET 210          

HSP 2 Score: 60.077 bits (144), Expect = 3.588e-9
Identity = 46/135 (34.07%), Postives = 68/135 (50.37%), Query Frame = 2
Query: 1154 NSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            N RRGR     P   YE+ +   GG  DN +    F +   G             S+   P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  314 NDRRGR-----PGDRYESMS---GGGYDNNSSWEPFQSGGRGSY-----------SDIGGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL---EGSEDRIITITGTQDQIQNAQYLLQNSVKQ 426          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:103037234])

HSP 1 Score: 70.4774 bits (171), Expect = 1.472e-12
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = 2
Query:  482 EIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            + ++R L+H S  G+IIG  G  +K LR   Q + IK+F    P S+DR+V + GK +KV EC + + + I    IKG+ + Y+   +DE+
Sbjct:  120 DCELRILIHQSLAGSIIGVKGAKIKELRENTQ-TTIKLFQECCPQSTDRVVLVGGKAEKVVECIKTMLELINEAPIKGRAQQYDPNFYDET 209          

HSP 2 Score: 56.9954 bits (136), Expect = 2.885e-8
Identity = 36/86 (41.86%), Postives = 51/86 (59.30%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSES-ILHLTGTKDQIEGAQYLMQIRVKKSVLNL*CHHF 1588
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E      Q SE  I+ +TGT+DQI+ AQYL+Q     S L+L  HH 
Sbjct:  353 PVVTTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP----LQGSEDRIITITGTQDQIQNAQYLLQ----NSALHLLGHHH 430          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 70.4774 bits (171), Expect = 1.702e-12
Identity = 41/136 (30.15%), Postives = 69/136 (50.74%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I  + +P L+E    N             + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK  +V EC +VI +      IKG+ + Y+   +DE+
Sbjct:   87 RILSVSADIETIGEILLKIIPTLEEYQHYN-----------GIDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDET 210          

HSP 2 Score: 55.8398 bits (133), Expect = 6.401e-8
Identity = 31/75 (41.33%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  VK+
Sbjct:  336 PVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL---EGSEDRIITITGTQDQIQNAQYLLQNSVKQ 407          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: pcbp4 (poly(rC)-binding protein 4-like [Source:NCBI gene;Acc:103041973])

HSP 1 Score: 50.8322 bits (120), Expect = 2.848e-6
Identity = 34/128 (26.56%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENY 730
            R+  +    E   + +     +L+E ++A V     A       P + +R ++  SQ G++IGKGG  +K +R +   + ++V     PNS++R V I G  D + +C ++I   I     KG    Y
Sbjct:   70 RIITITGPTECVFRAFTMITIKLEEDLTALV-----ANGTVTSKPPVTLRLVIPASQCGSLIGKGGSKIKEIR-ESTGAQVQVAGDLLPNSTERGVTISGSQDAIIQCVKLICTVILESPPKGATIPY 191          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005114.1 (pep scaffold:Pmarinus_7.0:GL476545:177182:183416:1 gene:ENSPMAG00000004551.1 transcript:ENSPMAT00000005114.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 3.413e-6
Identity = 33/120 (27.50%), Postives = 59/120 (49.17%), Query Frame = 2
Query:  329 FNDSFC--RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVI 682
             +D+ C  R+  +   ME+    +     +L+E M + +     +G      P + +R +V  SQ G++IGK G  ++ LR +   + ++V     PNS++R V I G  D + +C R I
Sbjct:   51 ISDANCPERIVTVTGPMESIFLAFALITHKLEEDMGSTL-----SGGVMMSRPPVTLRLVVPASQCGSLIGKSGNKIQELR-ESTGAQVQVAGDLLPNSTERAVTISGTPDAIVQCVRQI 164          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005105.1 (pep scaffold:Pmarinus_7.0:GL501087:1205:15413:-1 gene:ENSPMAG00000004637.1 transcript:ENSPMAT00000005105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 5.100e-6
Identity = 24/76 (31.58%), Postives = 42/76 (55.26%), Query Frame = 2
Query:  455 AGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVI 682
            A S     P + +R +V  SQ G++IGKGG  +K +R +   + ++V     PNS++R V + G  + + +C + I
Sbjct:   88 ANSAVTSKPPVTLRLVVPASQCGSLIGKGGSKIKEIR-ESTGAQVQVAGDMLPNSTERAVTVSGAPEAIIQCVKQI 162          

HSP 2 Score: 45.4394 bits (106), Expect = 9.708e-6
Identity = 25/74 (33.78%), Postives = 40/74 (54.05%), Query Frame = 2
Query:  476 NPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIE 697
            N  + IR L+H  +VG+IIGK G  VK +R +    I     +   +  +R+V I G+ D +F+ F +I +  E
Sbjct:   11 NVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARI----NISEGSCPERIVTITGQTDAIFKAFSMITNKFE 80          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO37243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGC0])

HSP 1 Score: 57.3806 bits (137), Expect = 8.138e-9
Identity = 34/125 (27.20%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKV 721
            RV  + +  ++ + I  E VP++ E    +                 +I+ LV  SQVG+IIG+ G  +K +R +   + +KVF    PNS++R+V + G  + + +C   +   I +  +KG+V
Sbjct:   96 RVLTITAPRQSALDILAEVVPKIGEVQYGH-----------------EIQMLVQRSQVGSIIGRAGYKIKEIR-EGSGANVKVFADCLPNSTERVVTMSGSAETIVKCVENVLVAIANAPLKGQV 202          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:101167466])

HSP 1 Score: 72.4034 bits (176), Expect = 4.096e-13
Identity = 40/136 (29.41%), Postives = 71/136 (52.21%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + ++    I  + +P L+E              +   + + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK ++V EC +VI + +   TIKG+ + Y+   +DE+
Sbjct:   89 RILSVSAGIDTIGDILLKIIPTLEEYQH-----------YSGIDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELVSETTIKGRSQPYDPNFYDET 212          

HSP 2 Score: 55.0694 bits (131), Expect = 1.227e-7
Identity = 30/75 (40.00%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  V++
Sbjct:  343 PVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP---LEGSEDRIITITGTQDQIQNAQYLLQNSVRQ 414          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:101167466])

HSP 1 Score: 72.4034 bits (176), Expect = 4.762e-13
Identity = 35/91 (38.46%), Postives = 56/91 (61.54%), Query Frame = 2
Query:  482 EIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK ++V EC +VI + +   TIKG+ + Y+   +DE+
Sbjct:  123 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELVSETTIKGRSQPYDPNFYDET 212          

HSP 2 Score: 54.6842 bits (130), Expect = 1.702e-7
Identity = 30/72 (41.67%), Postives = 46/72 (63.89%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIR 1549
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q R
Sbjct:  343 PVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP---LEGSEDRIITITGTQDQIQNAQYLLQNR 411          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:101167466])

HSP 1 Score: 72.0182 bits (175), Expect = 5.091e-13
Identity = 35/91 (38.46%), Postives = 56/91 (61.54%), Query Frame = 2
Query:  482 EIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            + ++R L+H S  G IIG  G  +K LR   Q + IK+F    P+S+DR+V + GK ++V EC +VI + +   TIKG+ + Y+   +DE+
Sbjct:  119 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELVSETTIKGRSQPYDPNFYDET 208          

HSP 2 Score: 54.6842 bits (130), Expect = 1.491e-7
Identity = 30/75 (40.00%), Postives = 48/75 (64.00%), Query Frame = 2
Query: 1334 PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 1558
            P+   +V++PK L  +I G  G+ + +I +ESGA I I E     E + + I+ +TGT+DQI+ AQYL+Q  V++
Sbjct:  340 PVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP---LEGSEDRIITITGTQDQIQNAQYLLQNSVRQ 411          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:101169861])

HSP 1 Score: 70.4774 bits (171), Expect = 1.395e-12
Identity = 40/136 (29.41%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I  + +P L+E    N             + + ++R L+H S  G+IIG  G  +K LR   + SI K+F    P S+DR+V + GK ++V EC + + + I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETVGEILLKIIPTLEEYQQYN-----------GMDFDCELRLLIHQSLAGSIIGVKGAKIKELRENTKTSI-KLFQECCPQSTDRVVLVGGKSERVVECVKTMLELISEAPIKGRTQPYDPNFYDET 209          

HSP 2 Score: 49.2914 bits (116), Expect = 8.841e-6
Identity = 30/110 (27.27%), Postives = 53/110 (48.18%), Query Frame = 2
Query:  428 SANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESL 757
            + + D+ +     R+ +  +++R L+     GA+IGKGG N+K LR  +  S+     VP  +  +R++ I    + V E    I  T+E      + + YN  +FD  L
Sbjct:   24 AEDADEHKSFKRSRNSDEMVELRILLQSKNAGAVIGKGGKNIKALRSDYNASV----SVPDSSGPERILSISADIETVGEILLKIIPTLE------EYQQYNGMDFDCEL 123          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:101169861])

HSP 1 Score: 70.4774 bits (171), Expect = 1.547e-12
Identity = 40/136 (29.41%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  + + +E   +I  + +P L+E    N             + + ++R L+H S  G+IIG  G  +K LR   + SI K+F    P S+DR+V + GK ++V EC + + + I    IKG+ + Y+   +DE+
Sbjct:   86 RILSISADIETVGEILLKIIPTLEEYQQYN-----------GMDFDCELRLLIHQSLAGSIIGVKGAKIKELRENTKTSI-KLFQECCPQSTDRVVLVGGKSERVVECVKTMLELISEAPIKGRTQPYDPNFYDET 209          

HSP 2 Score: 56.6102 bits (135), Expect = 4.255e-8
Identity = 44/140 (31.43%), Postives = 72/140 (51.43%), Query Frame = 2
Query: 1172 MRMGNPNSSYEARN--ERPG----GALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKKSVLNL 1573
            M MG+P+   + R+  +R G    G  DN +  + + +   G             S+   P+   +V++PK L  +I G  G+ + +I +ESGA I I   D   E + + I+ +TGT+DQI+ AQYL+Q  VK+   +L
Sbjct:  291 MPMGHPHRGGDRRSRPDRYGDNMSGGYDNSSSWDSYQSGGRGSY-----------SDMGGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI---DEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGHL 416          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000064674.1 (SMESG000064674.1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 400/409 (97.80%), Postives = 402/409 (98.29%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAXXXXXXXXXXXXXXXXXXXXXXXDNRRTGAPLLGANDRNLRFNSRPPPNEQFFPKPEINRNINNNFPAKPPANRFDNTYNDNFIEEPPEDFEMKSDXXXXXXXXXXRLPVFNEPNLPGIRKRNFIDTELDNSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKKSVLNL 1573
            RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAQYGGYNSQHGGGGG G  +    DNRRTGAPLLGANDRNLRFNSRPPPNEQFFPKPEINRNINNNFPAKPPANRFDNTY+DNFIEEPPEDFEMKSDNFPPNFNSSSRLPVFNEPNLPGIRKRNFIDTELDNSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKKSVLNL
Sbjct:   71 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAQYGGYNSQHGGGGGPGSNAAG--DNRRTGAPLLGANDRNLRFNSRPPPNEQFFPKPEINRNINNNFPAKPPANRFDNTYSDNFIEEPPEDFEMKSDNFPPNFNSSSRLPVFNEPNLPGIRKRNFIDTELDNSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKKSVLNL 477          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000064674.1 (SMESG000064674.1)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 400/409 (97.80%), Postives = 402/409 (98.29%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAXXXXXXXXXXXXXXXXXXXXXXXDNRRTGAPLLGANDRNLRFNSRPPPNEQFFPKPEINRNINNNFPAKPPANRFDNTYNDNFIEEPPEDFEMKSDXXXXXXXXXXRLPVFNEPNLPGIRKRNFIDTELDNSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKKSVLNL 1573
            RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAQYGGYNSQHGGGGG G  +    DNRRTGAPLLGANDRNLRFNSRPPPNEQFFPKPEINRNINNNFPAKPPANRFDNTY+DNFIEEPPEDFEMKSDNFPPNFNSSSRLPVFNEPNLPGIRKRNFIDTELDNSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKKSVLNL
Sbjct:   67 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAQYGGYNSQHGGGGGPGSNAAG--DNRRTGAPLLGANDRNLRFNSRPPPNEQFFPKPEINRNINNNFPAKPPANRFDNTYSDNFIEEPPEDFEMKSDNFPPNFNSSSRLPVFNEPNLPGIRKRNFIDTELDNSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNRNEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKKSVLNL 473          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000021944.1 (SMESG000021944.1)

HSP 1 Score: 117.087 bits (292), Expect = 2.611e-28
Identity = 51/139 (36.69%), Postives = 93/139 (66.91%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSA-NVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLT 760
            R+ I++ +    + IW + +P +KE M+A + D +  +  + + + EID+R +VH+SQ GA+IGKGG  ++NL   H ++IIK++ +  PNS+DR+V++V K + V  C   +++ +++Q IKG  ++YN +N+DES+ 
Sbjct:   71 RLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIA 209          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000021955.1 (SMESG000021955.1)

HSP 1 Score: 114.775 bits (286), Expect = 1.612e-27
Identity = 48/137 (35.04%), Postives = 93/137 (67.88%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSAN-VDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+ I++++    + IW + +P +KE M+A   D +  +  F +   EID+R +VH+SQ GA+IGKGG  ++NL  +H++++IK++    PNS+DR+V++V + + +  C   +++ +E+Q+IKG+  +YN +++DE+
Sbjct:   71 RLLIIDASPSTILDIWNDILPSIKEYMNAKECDYKGSSSKFIEGENEIDLRLIVHESQAGAVIGKGGERIRNLIDKHRMTMIKLYQTFCPNSTDRIVRMVSRMENLLACLENVFELLENQSIKGEKRDYNPDDYDEA 207          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000029221.1 (SMESG000029221.1)

HSP 1 Score: 88.1965 bits (217), Expect = 9.796e-19
Identity = 42/136 (30.88%), Postives = 78/136 (57.35%), Query Frame = 2
Query:  347 RVFILESTMENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDES 754
            R+  LE+ ++  + I  +C+ +++ C+      R  +G   D+   +D+R LV+ S VGA+IG+GG  + +LR +  L ++KV+    P S+DR+VQ+VG    V +C   I D  +   ++    NY+++N+D +
Sbjct:   64 RILSLEADLDTILGILAQCLEKMEGCIPL---PRAGSGDCNDNASNVDLRMLVNQSLVGALIGRGGGRINDLREKCDLRVLKVYQTVCPESTDRIVQMVGAIPLVIDCIGKIVDMCKETPVREPKVNYDAQNYDHA 196          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPK9.251e-1631.62heterogeneous nuclear ribonucleoprotein K [Source:... [more]
HNRNPK6.959e-1530.87heterogeneous nuclear ribonucleoprotein K [Source:... [more]
HNRNPK6.959e-1530.87heterogeneous nuclear ribonucleoprotein K [Source:... [more]
HNRNPK6.988e-1530.87heterogeneous nuclear ribonucleoprotein K [Source:... [more]
HNRNPK6.988e-1530.87heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hrpk-11.283e-626.56Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
hrpk-11.283e-626.56Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
hrpk-11.351e-626.56Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HnRNP-K2.223e-1540.00gene:FBgn0267791 transcript:FBtr0086219[more]
HnRNP-K2.473e-1540.00gene:FBgn0267791 transcript:FBtr0086221[more]
HnRNP-K2.508e-1540.00gene:FBgn0267791 transcript:FBtr0301760[more]
HnRNP-K2.842e-1540.00gene:FBgn0267791 transcript:FBtr0086220[more]
HnRNP-K2.842e-1540.00gene:FBgn0267791 transcript:FBtr0336730[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrpkl5.290e-1329.20heterogeneous nuclear ribonucleoprotein K, like [S... [more]
hnrpkl5.290e-1329.20heterogeneous nuclear ribonucleoprotein K, like [S... [more]
hnrpkl5.508e-1329.41heterogeneous nuclear ribonucleoprotein K, like [S... [more]
hnrnpk3.361e-1228.68heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrnpk3.465e-1228.68heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hnrnpk1.820e-1532.35heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrnpk1.947e-1532.35heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrnpk3.038e-1532.35heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpk2.041e-1631.62heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk4.073e-1630.87heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk1.817e-1531.39heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk1.910e-1531.39heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk3.657e-1530.99heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O19049|HNRPK_RABIT1.627e-1431.54Heterogeneous nuclear ribonucleoprotein K OS=Oryct... [more]
sp|Q5ZIQ3|HNRPK_CHICK2.002e-1431.62Heterogeneous nuclear ribonucleoprotein K OS=Gallu... [more]
sp|P61980|HNRPK_RAT3.342e-1430.87Heterogeneous nuclear ribonucleoprotein K OS=Rattu... [more]
sp|P61979|HNRPK_MOUSE3.342e-1430.87Heterogeneous nuclear ribonucleoprotein K OS=Mus m... [more]
sp|P61978|HNRPK_HUMAN3.342e-1430.87Heterogeneous nuclear ribonucleoprotein K OS=Homo ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FHU11.460e-2035.00Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TE113.745e-2033.12Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A3B3SD771.053e-1926.54Heterogeneous nuclear ribonucleoprotein K, like OS... [more]
A0A0R3WKH62.389e-1938.30Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A087VZJ62.603e-1938.30Heterolocus tagous nuclear ribonucleoprotein k OS=... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrpkl1.012e-1230.15heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl1.093e-1230.15heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrnpk1.472e-1237.36heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrpkl1.702e-1230.15heterogeneous nuclear ribonucleoprotein K-like [So... [more]
pcbp42.848e-626.56poly(rC)-binding protein 4-like [Source:NCBI gene;... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005114.13.413e-627.50pep scaffold:Pmarinus_7.0:GL476545:177182:183416:1... [more]
ENSPMAT00000005105.15.100e-631.58pep scaffold:Pmarinus_7.0:GL501087:1205:15413:-1 g... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372438.138e-927.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrpkl4.096e-1329.41heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl4.762e-1338.46heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl5.091e-1338.46heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrnpk1.395e-1229.41heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrnpk1.547e-1229.41heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064674.10.000e+097.80SMESG000064674.1[more]
SMESG000064674.10.000e+097.80SMESG000064674.1[more]
SMESG000021944.12.611e-2836.69SMESG000021944.1[more]
SMESG000021955.11.612e-2735.04SMESG000021955.1[more]
SMESG000029221.19.796e-1930.88SMESG000029221.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029624 ID=SMED30029624|Name=Heterogeneous nuclear ribonucleoprotein K|organism=Schmidtea mediterranea sexual|type=transcript|length=1775bp
CTCTAATTGATTTCCTTTAAACAATAAATATAATTGTTTTAATTTTGTCT
ATTGGAATTAATATTTTCCAAGTGTAATCAATAATTTCGATACGAAATGT
ATATGATCAATCTCATCGAACTTTATTGCTGGCGTAATGATTTTATTTGC
GAGTACTCGAGGATCAATGAAAAAAACAATTTCCATAACCCAATAACTTC
TATTCCATAAATTCTTATAACTTGTGTTGAAATCCATATTTCCGCAAACC
TAATAACATTTACTTGAAATGCTAACCAATTAGAAATCATATCTTCAGTT
AAAAATAATGAAACTTTTATAATTCTGATTTAATGATTCGTTTTGTAGAG
TTTTTATTCTTGAAAGTACTATGGAAAATTGCATAAAAATTTGGCGCGAA
TGCGTGCCAGAATTAAAAGAATGTATGTCTGCTAATGTAGACCAACGTAG
ACCTGCGGGATCATTTCGAGATGACAATCCCGAAATCGATATAAGATTTC
TTGTCCATGATAGCCAAGTAGGAGCAATAATAGGAAAGGGGGGAGTTAAT
GTTAAGAATTTACGAATGCAACATCAATTAAGTATTATAAAAGTTTTCCC
AGTACCAGCGCCGAACTCTTCTGATAGATTAGTACAGATAGTTGGGAAAT
TTGACAAAGTTTTCGAATGCTTTCGTGTGATATATGACACCATTGAAAGT
CAAACAATAAAAGGTAAAGTAGAGAATTATAATTCGGAAAATTTTGATGA
GAGTCTTACGGCACAATATGGTGGCTATAATAGTCAGCATGGTGGCGGTG
GCGGTGGTGGTCCTGGTTCTAATGCTGCTGGCGATAACAGAAGAACAGGC
GCTCCGTTACTAGGGGCTAATGATCGTAATCTCAGGTTTAATAGTAGGCC
ACCACCAAATGAGCAATTTTTCCCCAAACCTGAGATAAACCGAAATATTA
ATAATAACTTTCCAGCAAAACCGCCAGCGAATCGATTTGATAATACTTAC
AATGACAATTTCATTGAGGAGCCGCCAGAAGATTTTGAGATGAAATCAGA
TAATTTTCCACCAAATTTCAACAGTAGTAGTAGATTACCCGTTTTTAATG
AACCCAATCTCCCGGGAATTCGTAAGAGGAACTTTATCGACACTGAGCTA
GATAACAGTAGGAGAGGCCGAATGAGAATGGGTAACCCAAACTCCTCCTA
TGAAGCCAGGAATGAACGGCCCGGCGGCGCGTTAGACAATAGAAACAAAC
CAAATTTCTTCGATAACCGGAATGAGGGAATGAATCGCAACCCAGTCGTA
ACAGCCAGTTTGCTACCGTCCAATAGTTTGCCGCCCATTGAAAAAGTCGA
AGTTTCTCTTCCAAAATCGTTGATCCACGCAATCAAAGGTCCAAACGGGG
AGATTCTGTCGAAAATCATCAACGAGTCTGGAGCAGAGATTTCCATTGGC
GAGGAGGATTTTAATGATGAACAAAATTCTGAATCAATTTTGCATTTAAC
TGGAACCAAGGATCAAATAGAAGGTGCACAATATCTGATGCAAATTAGGG
TGAAAAAATCGGTTCTTAACTTGTGATGTCATCATTTTTGTCATGTGTGT
GTGTTTAATATATAATTTGTTGTATCGTTACATAAAGTTATTAGATATGT
TTTCATACAATAACATTCAATAAATTATGATTTTCATTTCGCTTATTGTT
AATTTTAAATATTTATATTTATTAAATGCTAATTGTTTATTTGTACATAT
AATAAATTTGTTTATTAGATTTCAT
back to top

protein sequence of SMED30029624-orf-1

>SMED30029624-orf-1 ID=SMED30029624-orf-1|Name=SMED30029624-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=402bp
MENCIKIWRECVPELKECMSANVDQRRPAGSFRDDNPEIDIRFLVHDSQV
GAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFEC
FRVIYDTIESQTIKGKVENYNSENFDESLTAQYGGYNSQHGGGGGGGPGS
NAAGDNRRTGAPLLGANDRNLRFNSRPPPNEQFFPKPEINRNINNNFPAK
PPANRFDNTYNDNFIEEPPEDFEMKSDNFPPNFNSSSRLPVFNEPNLPGI
RKRNFIDTELDNSRRGRMRMGNPNSSYEARNERPGGALDNRNKPNFFDNR
NEGMNRNPVVTASLLPSNSLPPIEKVEVSLPKSLIHAIKGPNGEILSKII
NESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKKSVLN
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR004087KH_dom
IPR004088KH_dom_type_1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 320..393
e-value: 2.3E-7
score: 40.4
coord: 37..109
e-value: 1.5E-7
score: 41.1
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 321..395
e-value: 7.0E-11
score: 43.5
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 34..110
e-value: 1.9E-16
score: 61.2
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 316..394
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 32..114
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 324..388
e-value: 7.3E-10
score: 38.5
coord: 41..104
e-value: 2.3E-9
score: 36.9
NoneNo IPR availablePANTHERPTHR10288:SF179HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Kcoord: 3..389
NoneNo IPR availablePANTHERPTHR10288KH DOMAIN CONTAINING RNA BINDING PROTEINcoord: 3..389
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 38..104
score: 12.307
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 321..388
score: 12.957
NoneNo IPR availableCDDcd00105KH-Icoord: 324..389
e-value: 4.33054E-9
score: 50.2511
NoneNo IPR availableCDDcd02396PCBP_like_KHcoord: 41..104
e-value: 8.11961E-19
score: 77.9019