EF-hand calcium binding domain 11

Overview
NameEF-hand calcium binding domain 11
Smed IDSMED30029604
Length (bp)510
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand calcium binding domain 11 (SMED30029604) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand calcium binding domain 11 (SMED30029604) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand calcium binding domain 11 (SMED30029604) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand calcium binding domain 11 (SMED30029604) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029604

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029604SMESG000054424.1 Contig1756newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029604SMESG000054424.1 Contig1756uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029604SMESG000022809.1 Contig1756newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029604SMESG000022809.1 Contig1756uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30029604SMESG000054424.1 SmedASXL_004356SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30029604SMESG000054424.1 dd_Smed_v4_12628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029604SMESG000054424.1 dd_Smed_v6_12628_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30029604SMESG000054424.1 OX_Smed_1.0.16803ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30029604SMESG000054424.1 Contig1756newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029604SMESG000054424.1 Contig1756uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029604SMESG000022809.1 Contig1756newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30029604SMESG000022809.1 Contig1756uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Human
Match: EFCAB11 (EF-hand calcium binding domain 11 [Source:HGNC Symbol;Acc:HGNC:20357])

HSP 1 Score: 88.1965 bits (217), Expect = 4.569e-22
Identity = 49/139 (35.25%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK A + LFGYKP+K E+ ++  + +  +      G  L+ F+  + ++K   E     + ++  F + D   + FL L DFK A  ++  KLPE  +  +F+++D D DG +SFRDFEY +
Sbjct:   26 VFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPNTS-----GILLEGFLNIVRKKK---EAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYAL 156          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Human
Match: EFCAB11 (EF-hand calcium binding domain 11 [Source:HGNC Symbol;Acc:HGNC:20357])

HSP 1 Score: 87.4261 bits (215), Expect = 4.907e-22
Identity = 49/139 (35.25%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK A + LFGYKP+K E+ ++  + +  +      G  L+ F+  + ++K   E     + ++  F + D   + FL L DFK A  ++  KLPE  +  +F+++D D DG +SFRDFEY +
Sbjct:    2 VFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPNTS-----GILLEGFLNIVRKKK---EAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYAL 132          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Human
Match: EFCAB11 (EF-hand calcium binding domain 11 [Source:HGNC Symbol;Acc:HGNC:20357])

HSP 1 Score: 69.3218 bits (168), Expect = 2.998e-15
Identity = 38/115 (33.04%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  115 LFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            LFGYKP+K E+ ++  + +  +      G  L+ F+  + ++K   E     + ++  F + D   + FL L DFK A  ++  KLPE  +  +F+++D D DG +SFRDFEY +
Sbjct:    2 LFGYKPSKIEVDSVMSSINPNTS-----GILLEGFLNIVRKKK---EAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYAL 108          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Human
Match: EFCAB11 (EF-hand calcium binding domain 11 [Source:HGNC Symbol;Acc:HGNC:20357])

HSP 1 Score: 61.6178 bits (148), Expect = 3.155e-12
Identity = 39/122 (31.97%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQI 408
            VF   D D K YL++ DFK A + LFGYKP+K E+ ++  + +  +      G  L+ F+  + ++K   E     + ++  F + D   + FL L DFK A  ++  KLPE  +  +F+ I
Sbjct:    1 VFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPNTS-----GILLEGFLNIVRKKK---EAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFRGI 114          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Human
Match: EFCAB11 (EF-hand calcium binding domain 11 [Source:HGNC Symbol;Acc:HGNC:20357])

HSP 1 Score: 61.2326 bits (147), Expect = 3.512e-12
Identity = 39/122 (31.97%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQI 408
            VF   D D K YL++ DFK A + LFGYKP+K E+ ++  + +  +      G  L+ F+  + ++K   E     + ++  F + D   + FL L DFK A  ++  KLPE  +  +F+ I
Sbjct:    2 VFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPNTS-----GILLEGFLNIVRKKK---EAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFRGI 115          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Fly
Match: CG13526 (gene:FBgn0034774 transcript:FBtr0071878)

HSP 1 Score: 64.6994 bits (156), Expect = 1.813e-13
Identity = 41/142 (28.87%), Postives = 81/142 (57.04%), Query Frame = 1
Query:   22 NVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDF 447
            ++ ++++ F KYD+D    L+  + +LA IS+ GY+ T++EL  L  +   ++ R+E+    L +FI+ ++ + +N ++  SL    + F  +D     ++ + D ++ M+ L   + +  I ++ Q +D D DGRIS RDF
Sbjct:   13 HIDELRDAFEKYDLDSNGTLSANEVRLALISV-GYEITEAELYDLIHS---VAVRDEER-LDLKKFIRMMAPRMANVDSDKSLC---RTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGDGRISLRDF 146          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Zebrafish
Match: efcab11 (EF-hand calcium binding domain 11 [Source:NCBI gene;Acc:550510])

HSP 1 Score: 86.2705 bits (212), Expect = 1.794e-21
Identity = 54/139 (38.85%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   34 IKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFE 450
            I+ VF + DVD+K YL++ D K+A + LFGYKP+KSE + L +N  I   +    G  L+ F   +  +K + E  Y  +  +Q F + D   + FL L DFKSA   +  +L E  +   F+  D D DG ISF+DFE
Sbjct:   22 IELVFHQCDVDKKGYLSREDLKIAVVMLFGYKPSKSETNILMENGTIKDCK----GVPLEPFATLM-RRKMSAEDPYEKA--RQIFSAFDVHCRGFLKLDDFKSAFKRVAPRLQERTVLEAFRHADQDSDGHISFKDFE 153          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Zebrafish
Match: efcab11 (EF-hand calcium binding domain 11 [Source:NCBI gene;Acc:550510])

HSP 1 Score: 50.8322 bits (120), Expect = 2.471e-8
Identity = 38/118 (32.20%), Postives = 58/118 (49.15%), Query Frame = 1
Query:   97 KLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFE 450
            ++ F+ +F     KSE + L +N  I     +  G  L+ F   +  +K + E  Y  +  +Q F + D   + FL L DFKSA   +  +L E  +   F+  D D DG ISF+DFE
Sbjct:    3 RMEFVPIFH---QKSETNILMENGTI----KDCKGVPLEPFATLM-RRKMSAEDPYEKA--RQIFSAFDVHCRGFLKLDDFKSAFKRVAPRLQERTVLEAFRHADQDSDGHISFKDFE 110          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Xenopus
Match: efcab11 (EF-hand calcium binding domain 11 [Source:NCBI gene;Acc:100135073])

HSP 1 Score: 72.4034 bits (176), Expect = 4.914e-16
Identity = 47/141 (33.33%), Postives = 76/141 (53.90%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQ--CFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D   K YL++ D K+A + LFGYKP+K E+ ++  +  I        G + D F+K ++ +K+ +     LSF  Q   F   D   + FL L DFK A  ++   L E  +   F+++D D DG +S++DFE+++
Sbjct:   26 VFQLCDEGNKGYLSREDLKVAVVMLFGYKPSKFEVDSMLSSFMI-----NTTGVTSDNFLKMMALKKAAQ-----LSFGNQREIFSVFDVHCRGFLTLEDFKRAFRQVAPHLSERTVVEAFREVDQDSDGLVSYKDFEFVL 156          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Xenopus
Match: efcab11 (EF-hand calcium binding domain 11 [Source:NCBI gene;Acc:100135073])

HSP 1 Score: 49.2914 bits (116), Expect = 2.105e-7
Identity = 39/121 (32.23%), Postives = 59/121 (48.76%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQ--CFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLF 399
            VF   D   K YL++ D K+A + LFGYKP+K E+ ++  +  I        G + D F+K ++ +K+ +     LSF  Q   F   D   + FL L DFK A  ++   L E  +   F
Sbjct:   26 VFQLCDEGNKGYLSREDLKVAVVMLFGYKPSKFEVDSMLSSFMI-----NTTGVTSDNFLKMMALKKAAQ-----LSFGNQREIFSVFDVHCRGFLTLEDFKRAFRQVAPHLSERTVVEAF 136          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Mouse
Match: Efcab11 (EF-hand calcium binding domain 11 [Source:MGI Symbol;Acc:MGI:1926017])

HSP 1 Score: 92.8189 bits (229), Expect = 6.028e-24
Identity = 54/139 (38.85%), Postives = 77/139 (55.40%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK+A + LFGYKP+K E   +  + +  +      G SL+ F+  +  +K  R  LY  + I+Q F + D   + FL L DFK A   +  KLP   +  +F++ D D DG +SFRDFEY M
Sbjct:   26 VFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEADAVMSSVNPNTS-----GVSLEGFLSAVKRKKEAR--LYR-NEIRQIFTAFDVHYRGFLTLEDFKRAFSRVAPKLPARTVLEVFREADQDSDGHVSFRDFEYAM 156          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Mouse
Match: Efcab11 (EF-hand calcium binding domain 11 [Source:MGI Symbol;Acc:MGI:1926017])

HSP 1 Score: 92.8189 bits (229), Expect = 6.028e-24
Identity = 54/139 (38.85%), Postives = 77/139 (55.40%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK+A + LFGYKP+K E   +  + +  +      G SL+ F+  +  +K  R  LY  + I+Q F + D   + FL L DFK A   +  KLP   +  +F++ D D DG +SFRDFEY M
Sbjct:   26 VFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEADAVMSSVNPNTS-----GVSLEGFLSAVKRKKEAR--LYR-NEIRQIFTAFDVHYRGFLTLEDFKRAFSRVAPKLPARTVLEVFREADQDSDGHVSFRDFEYAM 156          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Mouse
Match: Efcab11 (EF-hand calcium binding domain 11 [Source:MGI Symbol;Acc:MGI:1926017])

HSP 1 Score: 64.3142 bits (155), Expect = 5.460e-13
Identity = 42/119 (35.29%), Postives = 62/119 (52.10%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLF 399
            VF   D D K YL++ DFK+A + LFGYKP+K E   +  + +  +      G SL+ F+  +  +K  R  LY  + I+Q F + D   + FL L DFK A   +  KLP   +  +F
Sbjct:   49 VFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEADAVMSSVNPNTS-----GVSLEGFLSAVKRKKEAR--LYR-NEIRQIFTAFDVHYRGFLTLEDFKRAFSRVAPKLPARTVLEVF 159          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Mouse
Match: Calml3 (calmodulin-like 3 [Source:MGI Symbol;Acc:MGI:1917655])

HSP 1 Score: 47.7506 bits (112), Expect = 5.289e-7
Identity = 33/148 (22.30%), Postives = 66/148 (44.59%), Query Frame = 1
Query:   25 VSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMMLLK 468
            +++ K  F  +D D    +   +      SL G  PT++EL  +    D       K G     F +F++      +   S   I++ F+  D     F++  + +  M +L  KL +  +  + Q  D+D DG++++ +F +M++ K
Sbjct:   10 IAEFKEAFSLFDKDGDGSITTQELGTVMRSL-GQNPTEAELQGMVNEID-------KDGNGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGEKLSDEEVDEMIQAADTDGDGQVNYEEFVHMLVSK 149          
BLAST of EF-hand calcium binding domain 11 vs. UniProt/SwissProt
Match: sp|Q9D0E5|EFC11_MOUSE (EF-hand calcium-binding domain-containing protein 11 OS=Mus musculus OX=10090 GN=Efcab11 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.216e-23
Identity = 54/139 (38.85%), Postives = 77/139 (55.40%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK+A + LFGYKP+K E   +  + +  +      G SL+ F+  +  +K  R  LY  + I+Q F + D   + FL L DFK A   +  KLP   +  +F++ D D DG +SFRDFEY M
Sbjct:   26 VFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEADAVMSSVNPNTS-----GVSLEGFLSAVKRKKEAR--LYR-NEIRQIFTAFDVHYRGFLTLEDFKRAFSRVAPKLPARTVLEVFREADQDSDGHVSFRDFEYAM 156          
BLAST of EF-hand calcium binding domain 11 vs. UniProt/SwissProt
Match: sp|Q6AXQ2|EFC11_RAT (EF-hand calcium-binding domain-containing protein 11 OS=Rattus norvegicus OX=10116 GN=Efcab11 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.497e-23
Identity = 53/139 (38.13%), Postives = 77/139 (55.40%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK+A + LFGYKP+K E   +  +A+      +  G SL+ F+  +  Q+     LY  + I+  F + D   + FL L DFK A  ++  KLP   +  +F++ D D DG +SFRDFEY M
Sbjct:   26 VFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEADAVMSSAN-----PDTSGVSLEGFLNVV--QRKKEAQLYR-NEIRHIFTAFDVHYRGFLTLEDFKRAFSQVAPKLPSRTVLEVFREADQDSDGHVSFRDFEYAM 156          
BLAST of EF-hand calcium binding domain 11 vs. UniProt/SwissProt
Match: sp|Q9BUY7|EFC11_HUMAN (EF-hand calcium-binding domain-containing protein 11 OS=Homo sapiens OX=9606 GN=EFCAB11 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.194e-21
Identity = 49/139 (35.25%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK A + LFGYKP+K E+ ++  + +  +      G  L+ F+  + ++K   E     + ++  F + D   + FL L DFK A  ++  KLPE  +  +F+++D D DG +SFRDFEY +
Sbjct:   26 VFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPNTS-----GILLEGFLNIVRKKK---EAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYAL 156          
BLAST of EF-hand calcium binding domain 11 vs. UniProt/SwissProt
Match: sp|Q568G4|EFC11_DANRE (EF-hand calcium-binding domain-containing protein 11 OS=Danio rerio OX=7955 GN=efcab11 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.312e-20
Identity = 55/139 (39.57%), Postives = 80/139 (57.55%), Query Frame = 1
Query:   34 IKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFE 450
            I+ VF + DVD+K Y+++ D K+A + LFGYKP+KSE + L +N  I   R+ K G  L+ F   +  +K + E  Y  +  +Q F + D   + FL L DFKSA   +  +L E  +   F+  D D DG ISF+DFE
Sbjct:   22 IELVFHQCDVDKKGYMSREDLKIAVVMLFGYKPSKSETNILMENGTI---RDCK-GVPLEPFATLM-RRKMSAEDPYEKA--RQIFSAFDVHCRGFLKLDDFKSAFKRVAPRLQERTVLEAFRHADQDSDGHISFKDFE 153          
BLAST of EF-hand calcium binding domain 11 vs. UniProt/SwissProt
Match: sp|Q9LQN4|CML17_ARATH (Probable calcium-binding protein CML17 OS=Arabidopsis thaliana OX=3702 GN=CML17 PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 8.047e-8
Identity = 34/145 (23.45%), Postives = 70/145 (48.28%), Query Frame = 1
Query:   22 NVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQ---KSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDF 447
             +++++ +F  +D ++   L +L+   + +   G KP+  +  TL   AD  S  N  + F    F+  +S +    + R T Y+   + + F+  D     F+   +   +M +L   L    ++ + ++ DSD DGRI+F++F
Sbjct:   13 QINELREIFRSFDRNKDGSLTQLELG-SLLRALGVKPSPDQFETLIDKADTKS--NGLVEFP--EFVALVSPELLSPAKRTTPYTEEQLLRLFRIFDTDGNGFITAAELAHSMAKLGHALTVAELTGMIKEADSDGDGRINFQEF 152          
BLAST of EF-hand calcium binding domain 11 vs. TrEMBL
Match: A0A2K6G7B8 (EF-hand calcium binding domain 11 OS=Propithecus coquereli OX=379532 GN=EFCAB11 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 6.592e-22
Identity = 56/140 (40.00%), Postives = 82/140 (58.57%), Query Frame = 1
Query:   40 NVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
             VF   D D K YL++ DFK+A + LFGYKP+K E+ +L  + +  +      G SL+ F+  I ++K  +  LY  + I+  F + D   + FL L DFK A  ++  KLPE  I  +F+++D D DG +SFRDFEY M
Sbjct:   25 EVFKACDEDNKGYLSREDFKVAVVMLFGYKPSKIEVDSLMSSINPSAS-----GISLEGFLNIIRKKKEAQ--LYR-NEIRHIFTAFDVHYRGFLTLEDFKKAFRQVAPKLPERTILEVFREVDQDSDGHVSFRDFEYAM 156          
BLAST of EF-hand calcium binding domain 11 vs. TrEMBL
Match: A0A4X2L134 (Uncharacterized protein OS=Vombatus ursinus OX=29139 GN=EFCAB11 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 8.815e-22
Identity = 57/140 (40.71%), Postives = 85/140 (60.71%), Query Frame = 1
Query:   40 NVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
             VF   D D+K YL++ DFK+A + LFGYKPTK E  ++   A I S+ +   G  L+ FIK + ++K+ +  LY  + I+Q F + D   + FL L DFK A  ++  KL E ++   F+++D D DG +SF+DFEY M
Sbjct:   25 KVFEACDEDKKGYLSREDFKVAVVMLFGYKPTKIEADSVM--ASINSNAS---GICLEEFIKLMEKKKAAQ--LYQ-NEIRQIFTAFDRQYRGFLTLEDFKKAFKQVAPKLSERIVLEAFREVDQDSDGHVSFKDFEYAM 156          
BLAST of EF-hand calcium binding domain 11 vs. TrEMBL
Match: A0A2K5C842 (EF-hand calcium binding domain 11 OS=Aotus nancymaae OX=37293 GN=EFCAB11 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.329e-21
Identity = 51/139 (36.69%), Postives = 79/139 (56.83%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK+A + LFGYKP+K E+ ++  + +  +      G  L+ F+  + ++K   E     S ++  F + D   + FL L DFK A  ++  KLPE  +  +F+++D D DG +SFRDFEY M
Sbjct:   26 VFKACDEDHKGYLSREDFKVAVVMLFGYKPSKIEVDSVMSSINPNTS-----GILLEEFLNIVRKKK---EAQRYRSEVRHIFTAFDTHYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYAM 156          
BLAST of EF-hand calcium binding domain 11 vs. TrEMBL
Match: A0A2K5C888 (EF-hand calcium binding domain 11 OS=Aotus nancymaae OX=37293 GN=EFCAB11 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.329e-21
Identity = 51/139 (36.69%), Postives = 79/139 (56.83%), Query Frame = 1
Query:   43 VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            VF   D D K YL++ DFK+A + LFGYKP+K E+ ++  + +  +      G  L+ F+  + ++K   E     S ++  F + D   + FL L DFK A  ++  KLPE  +  +F+++D D DG +SFRDFEY M
Sbjct:    2 VFKACDEDHKGYLSREDFKVAVVMLFGYKPSKIEVDSVMSSINPNTS-----GILLEEFLNIVRKKK---EAQRYRSEVRHIFTAFDTHYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYAM 132          
BLAST of EF-hand calcium binding domain 11 vs. TrEMBL
Match: F6Q5F7 (EF-hand calcium binding domain 11 OS=Monodelphis domestica OX=13616 GN=EFCAB11 PE=4 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 4.925e-21
Identity = 55/154 (35.71%), Postives = 85/154 (55.19%), Query Frame = 1
Query:    7 PNMTFNVSDIKN---VFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            P +    SD +    VF   D D+K YL++ DFK+A + LFGYKPTK E  ++     + S +    G  L+ FI  + ++K+        + I+Q F + D   + FL L DF+ A  ++  KLPE ++   F+++D D DG +SF+DFEY M
Sbjct:   11 PGLEVRPSDRRKWLKVFEACDEDKKGYLSREDFKVAVVMLFGYKPTKIEADSV-----MTSVKPNTSGIYLEDFINLMQKKKA---VQLHHNEIRQIFTAFDMQYRGFLTLEDFRKAFRQVAPKLPERIVLEAFREVDQDSDGHVSFKDFEYAM 156          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Cavefish
Match: efcab11 (EF-hand calcium binding domain 11 [Source:NCBI gene;Acc:550510])

HSP 1 Score: 78.5666 bits (192), Expect = 6.183e-19
Identity = 47/137 (34.31%), Postives = 73/137 (53.28%), Query Frame = 1
Query:   40 NVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFE 450
             VF + DV++K YL++ D K+A + LFGYKP+K           ++       G  L+RF+  +  +K + E  Y  +  +  F + D   + FL L DFKS    +  +LP+  +   F+Q+D D DG ISF+DFE
Sbjct:    4 TVFEQCDVEKKGYLSREDLKIAVVMLFGYKPSK-----------VVP------GVPLERFVSLMG-RKLSAEDPYEKT--RHVFSAFDVHCRGFLKLEDFKSVFARVAPRLPDRTVLEAFRQMDHDSDGHISFKDFE 120          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Cavefish
Match: efcab11 (EF-hand calcium binding domain 11 [Source:NCBI gene;Acc:550510])

HSP 1 Score: 60.8474 bits (146), Expect = 4.851e-12
Identity = 37/115 (32.17%), Postives = 59/115 (51.30%), Query Frame = 1
Query:   34 IKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPE 378
            I  VF + DV++K YL++ D K+A + LFGYKP+K       +   +I       G  L+RF+  +  +K + E  Y  +  +  F + D   + FL L DFKS    +  +LP+
Sbjct:    7 ISKVFEQCDVEKKGYLSREDLKIAVVMLFGYKPSKVVPGAAPRERHLI-------GVPLERFVSLMG-RKLSAEDPYEKT--RHVFSAFDVHCRGFLKLEDFKSVFARVAPRLPD 111          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Cavefish
Match: efcab11 (EF-hand calcium binding domain 11 [Source:NCBI gene;Acc:550510])

HSP 1 Score: 46.2098 bits (108), Expect = 1.266e-6
Identity = 32/112 (28.57%), Postives = 56/112 (50.00%), Query Frame = 1
Query:   70 KNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPE-CLISNLFQ 402
            ++YL++ D K+A + LFGYKP+K           ++       G  L+RF+  +  +K + E  Y  +  +  F + D   + FL L DFKS    +  +LP+  ++  LF+
Sbjct:   16 QSYLSREDLKIAVVMLFGYKPSK-----------VVP------GVPLERFVSLMG-RKLSAEDPYEKT--RHVFSAFDVHCRGFLKLEDFKSVFARVAPRLPDRTVLEALFR 107          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Cavefish
Match: CALML6 (calmodulin like 6 [Source:HGNC Symbol;Acc:HGNC:24193])

HSP 1 Score: 45.8246 bits (107), Expect = 2.498e-6
Identity = 39/148 (26.35%), Postives = 69/148 (46.62%), Query Frame = 1
Query:   25 VSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFIS---EQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            +S+ K VF  +D +E N   K       +SL G  PTK ELS + K+ D    ++ K  F+ D F+  ++   E+  N++     + ++  F+  D   K +++    K  ++     L E     + ++ D D DG I + +F  MM
Sbjct:   20 ISEYKGVFEMFD-EEGNGDVKTQELERLMSLMGINPTKRELSQMAKDVD----KDGKGTFNCDSFLGLMALYHERTKNQD-----AELRAAFKVFDKEAKGYIDWNTLKYVLMNAGEPLNEEEAEQMMKEADKDGDGTIDYEEFVAMM 157          
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Nematostella
Match: EDO37209 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGH6])

HSP 1 Score: 78.5666 bits (192), Expect = 5.124e-19
Identity = 46/144 (31.94%), Postives = 78/144 (54.17%), Query Frame = 1
Query:   28 SDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMM 459
            ++I   F   D   K YL+K D K+AF+ LFGYKP+  E+  L       S+ +   G ++D F++  S +   ++       I+Q FQ+ D   + F+ L + K    ++   +    + N+F++ID D DGR+S++DFE+MM
Sbjct:   11 TNILQAFQLADKTSKGYLDKHDLKVAFVYLFGYKPSSYEVQELMNK----SNDDTSSGMTIDTFLRIASTKTLAQD---PDDHIRQVFQAFDMECRGFITLDNAKRVFSQVAPFVSAKNVENVFREIDGDGDGRVSYKDFEFMM 147          
BLAST of EF-hand calcium binding domain 11 vs. Planmine SMEST
Match: SMESG000054424.1 (SMESG000054424.1)

HSP 1 Score: 300.827 bits (769), Expect = 2.405e-106
Identity = 152/153 (99.35%), Postives = 152/153 (99.35%), Query Frame = 1
Query:   13 MTFNVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMMLLKN 471
            MTFNVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELS LFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMMLLKN
Sbjct:    1 MTFNVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSALFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMMLLKN 153          
BLAST of EF-hand calcium binding domain 11 vs. Planmine SMEST
Match: SMESG000054424.1 (SMESG000054424.1)

HSP 1 Score: 135.576 bits (340), Expect = 7.370e-42
Identity = 67/68 (98.53%), Postives = 67/68 (98.53%), Query Frame = 1
Query:   13 MTFNVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDR 216
            MTFNVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELS LFKNADIISHRNEKLGFSLDR
Sbjct:    1 MTFNVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSALFKNADIISHRNEKLGFSLDR 68          

HSP 2 Score: 46.9802 bits (110), Expect = 2.196e-7
Identity = 24/31 (77.42%), Postives = 25/31 (80.65%), Query Frame = 2
Query:  206 HWIDLLNSSLSRKAIGKLYIVFHLSSNVFKV 298
            H  + L  SL RKAIGKLYIVFHLSSNVFKV
Sbjct:   57 HRNEKLGFSLDRKAIGKLYIVFHLSSNVFKV 87          
BLAST of EF-hand calcium binding domain 11 vs. Planmine SMEST
Match: SMESG000008981.1 (SMESG000008981.1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.850e-8
Identity = 36/147 (24.49%), Postives = 68/147 (46.26%), Query Frame = 1
Query:   28 SDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFKNADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGNKNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMMLLK 468
             +++  F  +D D   Y+   + + A + + G  PT++E+  + K AD +   N+         +K     ++ RE       + Q F+ +D    + +N  + K A+    + L E  I   F+  D+D+DG ISF +F  +M L+
Sbjct:   24 EELRRTFKSFDKDRSGYIEAHELRNA-LKMLGENPTENEVKEMIKGADTVCKDNKVEFLEFCHLMKNFENHQTTRE-----EELMQLFKIIDKNKTDTINRDELKLALTSDGVNLTEDEIDATFKCADTDNDGLISFPEFMKLMTLQ 164          
The following BLAST results are available for this feature:
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EFCAB114.569e-2235.25EF-hand calcium binding domain 11 [Source:HGNC Sym... [more]
EFCAB114.907e-2235.25EF-hand calcium binding domain 11 [Source:HGNC Sym... [more]
EFCAB112.998e-1533.04EF-hand calcium binding domain 11 [Source:HGNC Sym... [more]
EFCAB113.155e-1231.97EF-hand calcium binding domain 11 [Source:HGNC Sym... [more]
EFCAB113.512e-1231.97EF-hand calcium binding domain 11 [Source:HGNC Sym... [more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG135261.813e-1328.87gene:FBgn0034774 transcript:FBtr0071878[more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
efcab111.794e-2138.85EF-hand calcium binding domain 11 [Source:NCBI gen... [more]
efcab112.471e-832.20EF-hand calcium binding domain 11 [Source:NCBI gen... [more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
efcab114.914e-1633.33EF-hand calcium binding domain 11 [Source:NCBI gen... [more]
efcab112.105e-732.23EF-hand calcium binding domain 11 [Source:NCBI gen... [more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Efcab116.028e-2438.85EF-hand calcium binding domain 11 [Source:MGI Symb... [more]
Efcab116.028e-2438.85EF-hand calcium binding domain 11 [Source:MGI Symb... [more]
Efcab115.460e-1335.29EF-hand calcium binding domain 11 [Source:MGI Symb... [more]
Calml35.289e-722.30calmodulin-like 3 [Source:MGI Symbol;Acc:MGI:19176... [more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D0E5|EFC11_MOUSE4.216e-2338.85EF-hand calcium-binding domain-containing protein ... [more]
sp|Q6AXQ2|EFC11_RAT4.497e-2338.13EF-hand calcium-binding domain-containing protein ... [more]
sp|Q9BUY7|EFC11_HUMAN2.194e-2135.25EF-hand calcium-binding domain-containing protein ... [more]
sp|Q568G4|EFC11_DANRE1.312e-2039.57EF-hand calcium-binding domain-containing protein ... [more]
sp|Q9LQN4|CML17_ARATH8.047e-823.45Probable calcium-binding protein CML17 OS=Arabidop... [more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2K6G7B86.592e-2240.00EF-hand calcium binding domain 11 OS=Propithecus c... [more]
A0A4X2L1348.815e-2240.71Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
A0A2K5C8424.329e-2136.69EF-hand calcium binding domain 11 OS=Aotus nancyma... [more]
A0A2K5C8884.329e-2136.69EF-hand calcium binding domain 11 OS=Aotus nancyma... [more]
F6Q5F74.925e-2135.71EF-hand calcium binding domain 11 OS=Monodelphis d... [more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
efcab116.183e-1934.31EF-hand calcium binding domain 11 [Source:NCBI gen... [more]
efcab114.851e-1232.17EF-hand calcium binding domain 11 [Source:NCBI gen... [more]
efcab111.266e-628.57EF-hand calcium binding domain 11 [Source:NCBI gen... [more]
CALML62.498e-626.35calmodulin like 6 [Source:HGNC Symbol;Acc:HGNC:241... [more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372095.124e-1931.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand calcium binding domain 11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium binding domain 11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000054424.12.405e-10699.35SMESG000054424.1[more]
SMESG000054424.17.370e-4298.53SMESG000054424.1[more]
SMESG000008981.13.850e-824.49SMESG000008981.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029604 ID=SMED30029604|Name=EF-hand calcium binding domain 11|organism=Schmidtea mediterranea sexual|type=transcript|length=510bp
TTATAGCCAAATATGACTTTCAATGTCAGTGATATAAAAAATGTATTTTT
AAAATATGATGTAGATGAAAAAAATTATTTAAATAAATTAGATTTTAAAT
TAGCATTTATTAGCTTGTTTGGCTATAAACCTACAAAATCAGAATTATCA
ACTTTATTTAAAAATGCAGACATTATTTCTCATCGAAATGAGAAATTGGG
ATTTTCATTGGATAGATTTATTAAATTCATCTCTGAGCAGAAAAGCAATA
GGGAAACTTTATATAGTCTTTCATTTATCAAGCAATGTTTTCAAAGTTTA
GATGGTGGAAATAAAAACTTTTTAAATTTGCTTGATTTCAAATCTGCTAT
GATAGAATTGAATATCAAATTGCCAGAATGCTTAATTTCAAATTTATTCC
AACAAATTGATTCGGATGATGATGGAAGAATTAGCTTTCGAGATTTCGAA
TATATGATGCTCTTGAAAAATTAATATTCGTGCAAATATAATTTTTTTAA
TGGAAAAAAA
back to top

protein sequence of SMED30029604-orf-1

>SMED30029604-orf-1 ID=SMED30029604-orf-1|Name=SMED30029604-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MTFNVSDIKNVFLKYDVDEKNYLNKLDFKLAFISLFGYKPTKSELSTLFK
NADIISHRNEKLGFSLDRFIKFISEQKSNRETLYSLSFIKQCFQSLDGGN
KNFLNLLDFKSAMIELNIKLPECLISNLFQQIDSDDDGRISFRDFEYMML
LKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 126..154
e-value: 1.7
score: 16.0
coord: 90..118
e-value: 19.0
score: 7.5
coord: 9..37
e-value: 7.4
score: 10.8
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 91..151
e-value: 7.6E-10
score: 39.1
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 86..121
score: 8.237
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 5..40
score: 8.851
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 129..155
score: 10.469
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 2..89
e-value: 2.9E-8
score: 35.5
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 90..155
e-value: 1.9E-10
score: 42.5
NoneNo IPR availablePANTHERPTHR23050:SF354EF-HAND CALCIUM-BINDING DOMAIN-CONTAINING PROTEIN 11coord: 8..152
NoneNo IPR availablePANTHERPTHR23050CALCIUM BINDING PROTEINcoord: 8..152
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 135..147
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 8..153