
Smed IDSMED30029603
Length (bp)891
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of SMED30029603 (SMED30029603) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30029603 (SMED30029603) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30029603 (SMED30029603) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30029603 (SMED30029603) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 18

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30029603h1SMcG0018991 Contig1663GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029603h1SMcG0018991 Contig1663GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029603h1SMcG0022771 Contig1663GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029603h1SMcG0022771 Contig1663GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30029603h1SMcG0022771 Contig42010uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029603h1SMcG0022771 Contig42010newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30029603h1SMcG0022771 dd_Smed_v4_1649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029603h1SMcG0022771 dd_Smed_v4_1649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029603h1SMcG0022771 dd_Smed_v4_1649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029603h1SMcG0022771 dd_Smed_v4_1649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029603h1SMcG0022771 dd_Smed_v4_1649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029603h1SMcG0022771 dd_Smed_v4_1649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029603h1SMcG0022771 dd_Smed_v4_1649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30029603h1SMcG0022771 dd_Smed_v4_5453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029603h1SMcG0022771 dd_Smed_v4_5453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029603h1SMcG0022771 dd_Smed_v4_5453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029603h1SMcG0022771 dd_Smed_v6_5453_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029603h1SMcG0022771 dd_Smed_v4_1649_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
SMED30029603 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004657:9364..10300 +4332
v31.012811:2786..3721 +4243
BLAST of SMED30029603 vs. Ensembl Mouse
Match: Qrich2 (glutamine rich 2 [Source:MGI Symbol;Acc:MGI:2684912])

HSP 1 Score: 48.521 bits (114), Expect = 9.023e-6
Identity = 43/122 (35.25%), Postives = 51/122 (41.80%), Query Frame = 2
            G VQPG+   G    G+    PGM               QPG++ P   Q G+  P A QPG+  P   QPG+  P   QPG   P A QPG            QPGM  P A P G+  P 
BLAST of SMED30029603 vs. UniProt/SwissProt
Match: sp|Q25434|FP1_MYTCO (Adhesive plaque matrix protein OS=Mytilus coruscus OX=42192 GN=FP1 PE=2 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 9.095e-6
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 2
            + S Y+P + YP   +    Y S+ +P + YPP  +P + YPP  +P I YPP  +P ++     +P +SYPS
BLAST of SMED30029603 vs. TrEMBL
Match: A0A3Q3KG26 (Uncharacterized protein OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 2 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 3 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 4 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 5 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 6 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 7 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 8 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 9 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 10 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 11 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG

HSP 12 Score: 58.5362 bits (140), Expect = 1.513e-6
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = -1
            YD+PG     + +PGC +G Y +PGC +G Y +PGC +G Y +PGC++  Y +P C +  Y +PG
BLAST of SMED30029603 vs. TrEMBL
Match: A0A2T6C4A6 (Uncharacterized protein DUF4397 OS=Melghirimyces profundicolus OX=1242148 GN=C8P63_1047 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.515e-6
Identity = 36/67 (53.73%), Postives = 43/67 (64.18%), Query Frame = 2
            QPGM +P  GQ GMG+P   QPGMG+P  GQP MG+P  GQP +G+P  GQP M      QP M +P
BLAST of SMED30029603 vs. TrEMBL
Match: A0A1C6V5H1 (Histidine kinase OS=Micromonospora chersina OX=47854 GN=GA0070603_3236 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.277e-6
Identity = 26/53 (49.06%), Postives = 35/53 (66.04%), Query Frame = -1
            + G PA GYP+ G P+ GYP+ G P+ GYP+ G  A+GYP+   PA GY + G
BLAST of SMED30029603 vs. TrEMBL
Match: A0A5F5Y508 (Uncharacterized protein OS=Felis catus OX=9685 GN=QRICH2 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 5.296e-6
Identity = 59/149 (39.60%), Postives = 72/149 (48.32%), Query Frame = 2
            GG + PG      V  G  QPG++    P  G PG   PGM       P   Q G V     QPG+V P AGQ G+     +QPG+  P +GQP +  P  GQPG G P   QPGM+    Q G+ YP A  GG+A P +G      PG
BLAST of SMED30029603 vs. Ensembl Cavefish
Match: ENSAMXT00000040031.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:18801069:18809124:-1 gene:ENSAMXG00000041443.1 transcript:ENSAMXT00000040031.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 3.893e-6
Identity = 19/57 (33.33%), Postives = 25/57 (43.86%), Query Frame = -1
               F+P  PA   P+P  P    P+P  P    P+P   A   P+P  PAA   +P 
BLAST of SMED30029603 vs. Ensembl Nematostella
Match: EDO41408 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G4])

HSP 1 Score: 48.521 bits (114), Expect = 1.284e-6
Identity = 20/49 (40.82%), Postives = 25/49 (51.02%), Query Frame = -1
            +  C   GYP+  C   GYP+  C   GYP+  C  +GYPI  C   GY

HSP 2 Score: 48.1358 bits (113), Expect = 1.539e-6
Identity = 21/49 (42.86%), Postives = 25/49 (51.02%), Query Frame = -1
            +  C   GYP+  C   GYP+  C   GYPI  C  +GYPI  C   GY
BLAST of SMED30029603 vs. Planmine SMEST
Match: SMESG000071278.1 (SMESG000071278.1)

HSP 1 Score: 102.064 bits (253), Expect = 7.620e-27
Identity = 49/71 (69.01%), Postives = 50/71 (70.42%), Query Frame = 3

HSP 2 Score: 83.9593 bits (206), Expect = 7.162e-20
Identity = 52/106 (49.06%), Postives = 57/106 (53.77%), Query Frame = 2
            GN  + KE K+ K   +L   +  HGGHIYPGQPNTFHVTGHVQPGVIHGGYPSTGMPGYSP       G P   G             +   G P       G P
BLAST of SMED30029603 vs. Planmine SMEST
Match: SMESG000071344.1 (SMESG000071344.1)

HSP 1 Score: 65.4698 bits (158), Expect = 6.244e-13
Identity = 55/127 (43.31%), Postives = 67/127 (52.76%), Query Frame = 2
            G+P YSPGMSNY PGMP           + S Y PG+  P        Y S A P   +    Q    YPP  + G+   P GQPG+ CS  +PG+ YPSAPP  + YPS P+S Y PG  P NYP+
The following BLAST results are available for this feature:
BLAST of SMED30029603 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029603 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029603 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029603 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029603 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029603 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Qrich29.023e-635.25glutamine rich 2 [Source:MGI Symbol;Acc:MGI:268491... [more]
back to top
BLAST of SMED30029603 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q25434|FP1_MYTCO9.095e-635.62Adhesive plaque matrix protein OS=Mytilus coruscus... [more]
back to top
BLAST of SMED30029603 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A3Q3KG261.513e-643.08Uncharacterized protein OS=Monopterus albus OX=437... [more]
A0A2T6C4A61.515e-653.73Uncharacterized protein DUF4397 OS=Melghirimyces p... [more]
A0A1C6V5H12.277e-649.06Histidine kinase OS=Micromonospora chersina OX=478... [more]
A0A5F5Y5085.296e-639.60Uncharacterized protein OS=Felis catus OX=9685 GN=... [more]
back to top
BLAST of SMED30029603 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000040031.13.893e-633.33pep primary_assembly:Astyanax_mexicanus-2.0:17:188... [more]
back to top
BLAST of SMED30029603 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029603 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029603 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO414081.284e-640.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30029603 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029603 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30029603 ID=SMED30029603|Name=SMED30029603|organism=Schmidtea mediterranea sexual|type=transcript|length=891bp
back to top

protein sequence of SMED30029603-orf-1

>SMED30029603-orf-1 ID=SMED30029603-orf-1|Name=SMED30029603-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: biological process
Vocabulary: molecular function
GO:0008233peptidase activity
Vocabulary: cellular component
GO:0016021integral component of membrane