Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30029594
Length (bp)1093
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30029594) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30029594) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30029594) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30029594) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029594

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30029594h1SMcG0011376 dd_Smed_v4_1672_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029594h1SMcG0011376 SmedASXL_067061SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029594h1SMcG0011376 dd_Smed_v4_11998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029594h1SMcG0011376 dd_Smed_v4_11998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029594h1SMcG0011376 dd_Smed_v4_11998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029594h1SMcG0011376 dd_Smed_v4_1672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029594h1SMcG0011376 dd_Smed_v6_11998_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678])

HSP 1 Score: 297.745 bits (761), Expect = 7.207e-99
Identity = 158/317 (49.84%), Postives = 208/317 (65.62%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL  QL   +E     D    +LS+IQ E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQL--AEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678])

HSP 1 Score: 296.59 bits (758), Expect = 2.002e-98
Identity = 158/317 (49.84%), Postives = 207/317 (65.30%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL  Q   L E     D    +LS+IQ E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQ---LAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 317          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678])

HSP 1 Score: 293.123 bits (749), Expect = 4.289e-97
Identity = 157/317 (49.53%), Postives = 206/317 (64.98%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL  Q   L E     D    +LS+IQ E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+ E+
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQ---LAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEK 317          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678])

HSP 1 Score: 291.967 bits (746), Expect = 7.079e-97
Identity = 156/316 (49.37%), Postives = 205/316 (64.87%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAE 975
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL  Q   L E     D    +LS+IQ E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+ +
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQ---LAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKGK 316          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:HGNC Symbol;Acc:HGNC:19678])

HSP 1 Score: 281.182 bits (718), Expect = 4.028e-92
Identity = 157/344 (45.64%), Postives = 206/344 (59.88%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGT-----------------------------HFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q+   +                              FN+M +V DR       + EL  Q   L E     D    +LS+IQ E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKDGFSPCCPGWSQTPELKPSACLDLPKWYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQ---LAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 344          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: ubh-4 (Ubiquitin carboxyl-terminal hydrolase ubh-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09444])

HSP 1 Score: 275.404 bits (703), Expect = 9.893e-91
Identity = 142/308 (46.10%), Postives = 200/308 (64.94%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNH-AYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTH--FNIMVLVPDR---LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRK 999
            G+WCLIESDPGVFTE+++GFGV G++  E+  +D   ++    YGLIFL+KW  +      + +D +   +IFFA Q I NACATQAL+N+L N+ D D+KLG  L + K F    D + +G  +SNS++IR VHNSFS   L+ELD K     ED YHF+ Y+P+  ++YE DGL++ P++     ++Q WI   KPVI +RMQ++S     FN+M LVP+R   L+E+   L+   E+ +  + I  +  +I DE+ K E YR EN RRRHNY PF+IELMK+LA+EGKL  LV+ A + A  + K
Sbjct:    5 GSWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDKAMTRPTYGLIFLFKWR-QGDETTGIPSDKQ---NIFFAHQTIQNACATQALINLLMNVEDTDVKLGNILNQYKEFAIDLDPNTRGHCLSNSEEIRTVHNSFSRQTLFELDIKGGES-EDNYHFVTYVPIGNKVYELDGLRELPLEVAEFQKEQDWIEAIKPVIQQRMQKYSEGEITFNLMALVPNRKQKLQEMMENLIQANENNELEEQIADLNKAIADEDYKMEMYRKENNRRRHNYTPFVIELMKILAKEGKLVGLVDNAYQAAKEKSK 307          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: ubh-4 (Ubiquitin carboxyl-terminal hydrolase ubh-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09444])

HSP 1 Score: 275.404 bits (703), Expect = 9.893e-91
Identity = 142/308 (46.10%), Postives = 200/308 (64.94%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNH-AYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTH--FNIMVLVPDR---LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRK 999
            G+WCLIESDPGVFTE+++GFGV G++  E+  +D   ++    YGLIFL+KW  +      + +D +   +IFFA Q I NACATQAL+N+L N+ D D+KLG  L + K F    D + +G  +SNS++IR VHNSFS   L+ELD K     ED YHF+ Y+P+  ++YE DGL++ P++     ++Q WI   KPVI +RMQ++S     FN+M LVP+R   L+E+   L+   E+ +  + I  +  +I DE+ K E YR EN RRRHNY PF+IELMK+LA+EGKL  LV+ A + A  + K
Sbjct:    5 GSWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDKAMTRPTYGLIFLFKWR-QGDETTGIPSDKQ---NIFFAHQTIQNACATQALINLLMNVEDTDVKLGNILNQYKEFAIDLDPNTRGHCLSNSEEIRTVHNSFSRQTLFELDIKGGES-EDNYHFVTYVPIGNKVYELDGLRELPLEVAEFQKEQDWIEAIKPVIQQRMQKYSEGEITFNLMALVPNRKQKLQEMMENLIQANENNELEEQIADLNKAIADEDYKMEMYRKENNRRRHNYTPFVIELMKILAKEGKLVGLVDNAYQAAKEKSK 307          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: ubh-1 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q9UAV3])

HSP 1 Score: 60.8474 bits (146), Expect = 1.368e-10
Identity = 59/223 (26.46%), Postives = 100/223 (44.84%), Query Frame = 1
Query:  103 WCLIESDPGVFTEIIKGFGVSGIECAEII--DMDYMSSLNHAYGLIF-LYKWHPESVPPPNVVTDPEILND-IFFAQQVITNACATQALLNILFNLGDDIKLG-----KTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLV 744
            W  +ES+P V   +I+  GVSG++  +++  D + +    HA  L F  YK   E + P  +    +  +D +FF +Q I+NAC T AL + L NL D I LG     K L E K       S      ++N+ ++  +H      A    D + +   +  +HFI ++   G LYE D  +    + GP   D + +          +++     F+ + +V
Sbjct:    5 WTPLESNPSVINPMIEKMGVSGVKTVDVLFFDDESIGKPQHAVILCFPEYKKVDEIMKP--IYEQAKAADDSVFFMKQKISNACGTFALFHSLANLEDRINLGDGSFAKWLAEAKKVGIEERSDF----LANNAELAGIH------AAAATDGQTAPSGDVEHHFICFVGKNGILYEIDSRRPFAREIGPT-SDATLVKDAGAACQHLIEKLDNVSFSAIAVV 214          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: ubh-3 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q965V9])

HSP 1 Score: 55.0694 bits (131), Expect = 1.199e-8
Identity = 60/235 (25.53%), Postives = 87/235 (37.02%), Query Frame = 1
Query:   88 RADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMD-------------YMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQV--ITNACATQALLNILFNLGDDIKLGK-TLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLV 744
            +  G W  +ES+P      +K  G++G+EC ++   D              +     A    FL K + E      V  + E    +FF  Q   I NAC T AL + L NL + + LGK    +        +   +   +S   D+ + H   +     E  D         YHFI Y+   G+LYE D     P   G    D + I      I E M       F+ M LV
Sbjct:    4 KGKGGWQALESNPETINPFLKKIGITGLECVDVYSFDDEMLQFVPTPQLALILCFPSAEAREFLSKQYEE------VEKNGEKPEGVFFMNQSEEIGNACGTFALFHSLANLENRVNLGKGKFAKWYEKAKLVNEDERSDLLSGDTDLAEAHEETAEEGETEQSDHVD------YHFITYVNKNGQLYEIDSCAPFPRPLGAT-TDSTMIKDASTAIKELMNNVKNLSFSAMALV 225          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: ubh-2 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q8MNY0])

HSP 1 Score: 50.447 bits (119), Expect = 4.323e-7
Identity = 55/228 (24.12%), Postives = 88/228 (38.60%), Query Frame = 1
Query:   91 ADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMD-----YMSSLNHAYGLIFLYKWHPE--SVPPPNVVTDPEILNDIFFAQQV--ITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPED-AYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLV 744
            A G W  +ES+P      +   GVSG+EC ++   D     ++ +   A  L F      E  +     V  + +  + IFF  Q   I +AC T +L + L NL + + LG          S +    K +      D+       + +     ++ ++  PE  AYHFI Y+   G+L+E D     P   G         +     I + M       F+ M LV
Sbjct:    4 ATGGWQALESNPETINPFLSKIGVSGVECVDVFSFDDEMLQFIPTPQLALILCFPSSGVREFRAKQYEEVEKNGKKPDGIFFMNQKKEIGHACGTFSLFHSLANLENRVNLGNGKF------SKWFEKAKLVGEGERSDLLLADTDLAEAHKETAEEGETEHPEHVAYHFITYVNKNGQLFEIDSCSPFPRPLGATTDSTMIRDAFSTSIKDLMDNVQKLSFSAMALV 225          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Uch-L5 (gene:FBgn0011327 transcript:FBtr0333867)

HSP 1 Score: 310.842 bits (795), Expect = 2.022e-104
Identity = 156/318 (49.06%), Postives = 209/318 (65.72%), Query Frame = 1
Query:   85 GRADGNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSG--THFNIMVLVPDRLEELNSQLLMLKESG--------DPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRK 999
            G   GNWCLIESDPGVFTE+I+ FG  G +  EI  +D +   +L   +GLIFL+KW  E  P   VV D E   +IFFA+QVI NACATQA+L++L NL  +DIKLG+TL   K FC  FD + KGLT+SN+  IR VHNSF+   L+ELD K     +D YHF+GYMP+ GRLYE DGL++GPID G I  +Q+WI+  +P+I +RMQR+S    HFN+M L+ DR      Q+  L            D    I  + + I+ E  K +RY++EN+RR+HNY+PFI+EL+K+L E G+L P+ E+A++ AL R +
Sbjct:    2 GDGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDEPAGKVVLDRE---NIFFAKQVINNACATQAILSLLMNLDHEDIKLGETLTNFKEFCQCFDPYNKGLTLSNASQIRTVHNSFARPTLFELDTKNQKKDDDVYHFVGYMPIGGRLYELDGLREGPIDLGEIKSEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNPAPNAMDTEEDRQAEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLKILGENGQLMPIYEKAKQRALEREQ 316          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Uch-L5 (gene:FBgn0011327 transcript:FBtr0076472)

HSP 1 Score: 310.842 bits (795), Expect = 2.022e-104
Identity = 156/318 (49.06%), Postives = 209/318 (65.72%), Query Frame = 1
Query:   85 GRADGNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSG--THFNIMVLVPDRLEELNSQLLMLKESG--------DPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRK 999
            G   GNWCLIESDPGVFTE+I+ FG  G +  EI  +D +   +L   +GLIFL+KW  E  P   VV D E   +IFFA+QVI NACATQA+L++L NL  +DIKLG+TL   K FC  FD + KGLT+SN+  IR VHNSF+   L+ELD K     +D YHF+GYMP+ GRLYE DGL++GPID G I  +Q+WI+  +P+I +RMQR+S    HFN+M L+ DR      Q+  L            D    I  + + I+ E  K +RY++EN+RR+HNY+PFI+EL+K+L E G+L P+ E+A++ AL R +
Sbjct:    2 GDGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDEPAGKVVLDRE---NIFFAKQVINNACATQAILSLLMNLDHEDIKLGETLTNFKEFCQCFDPYNKGLTLSNASQIRTVHNSFARPTLFELDTKNQKKDDDVYHFVGYMPIGGRLYELDGLREGPIDLGEIKSEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNPAPNAMDTEEDRQAEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLKILGENGQLMPIYEKAKQRALEREQ 316          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Uch-L5R (gene:FBgn0030370 transcript:FBtr0073638)

HSP 1 Score: 263.077 bits (671), Expect = 1.507e-85
Identity = 142/309 (45.95%), Postives = 196/309 (63.43%), Query Frame = 1
Query:   91 ADGNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDRLEELNSQLLMLK------ESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMA 984
            A  NWCLIESDPGVFTE+I GFG +G E  EI  I  D    L   +GLIFL+KW  +  P   VVTD    +DIFFA+QVI NACATQALL +L NL  +DI LG+TL +L++ C   D   +G  ++N + IRKVHNSF+   L+ +++      +D YHF+G+MP+KG+L+E DG+ +GPI+   I Q Q+W++  +P+I  RM+R+S    HFN+M LV DR      ++ ML          D    I  + S ++ E  K  RYR ENIRRRHNY+PFI+EL+K L E G+L  + ++A++ +
Sbjct:   21 AANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWLDDK-PAGRVVTD---RSDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEEKIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSHADRQAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDRS 325          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: calypso (gene:FBgn0262166 transcript:FBtr0087245)

HSP 1 Score: 165.236 bits (417), Expect = 2.214e-46
Identity = 105/360 (29.17%), Postives = 170/360 (47.22%), Query Frame = 1
Query:   91 ADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVV--------TDPEILNDIFFAQQVITNACATQALLNILFNLGDD-IKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPE------DAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTH---FNIMVLVPDRLEELNSQLLMLK--------------------ESGDPHDAIPQILSS-----------------------------IQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVER 969
            ADG W  +ESDPG+FT ++K FG   ++  E+ D+     +   YG IFL++W  E      +V         D E ++ IFFAQQV+ N+CAT ALL++L N  ++ ++LG TL  LK+         KGL I N+ ++   HNS +        ++   G        +A+HF+ ++P+ G+L+E DGL+  P++HG     + W +  + V++ER+   +G     FN+M +VPDR   +  +L ML+                    ESG+     P   ++                             + DEN +   ++++  RR HNY  FI   + +LA +G L  LV +
Sbjct:   43 ADG-WLELESDPGLFTLLLKDFGCHDVQVEEVYDLQ--KPIESPYGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKTHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGWEDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTLQKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADENDRRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQ 399          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: calypso (gene:FBgn0262166 transcript:FBtr0087246)

HSP 1 Score: 165.236 bits (417), Expect = 2.214e-46
Identity = 105/360 (29.17%), Postives = 170/360 (47.22%), Query Frame = 1
Query:   91 ADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVV--------TDPEILNDIFFAQQVITNACATQALLNILFNLGDD-IKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPE------DAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTH---FNIMVLVPDRLEELNSQLLMLK--------------------ESGDPHDAIPQILSS-----------------------------IQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVER 969
            ADG W  +ESDPG+FT ++K FG   ++  E+ D+     +   YG IFL++W  E      +V         D E ++ IFFAQQV+ N+CAT ALL++L N  ++ ++LG TL  LK+         KGL I N+ ++   HNS +        ++   G        +A+HF+ ++P+ G+L+E DGL+  P++HG     + W +  + V++ER+   +G     FN+M +VPDR   +  +L ML+                    ESG+     P   ++                             + DEN +   ++++  RR HNY  FI   + +LA +G L  LV +
Sbjct:   43 ADG-WLELESDPGLFTLLLKDFGCHDVQVEEVYDLQ--KPIESPYGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKTHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGWEDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTLQKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADENDRRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQ 399          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: uchl5 (ubiquitin carboxyl-terminal hydrolase L5 [Source:ZFIN;Acc:ZDB-GENE-040426-2051])

HSP 1 Score: 294.278 bits (752), Expect = 8.433e-98
Identity = 155/322 (48.14%), Postives = 215/322 (66.77%), Query Frame = 1
Query:   76 MAGGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMD--YMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQL-----LMLKESGDPHDAIPQILSS----IQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            MAG  + G WCL+ESDPGVFTE+IKGFG  G +  EI  M+     +L   +GLIFL+KW P   P  ++V D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F +SFD+ MKGL +SNS+ IR+VHN F+   ++E D K +   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL +QL     +   +SG+   +I   ++     I++EN K +RY++ENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    1 MAG--SAGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGSIVQDSR-LDQIFFAKQVINNACATQAIISVLLNCTHPDMLLGETLTEFKEFSNSFDAAMKGLALSNSEVIRQVHNGFARQQMFEFDAKSTAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGVCNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEKKIAELQAQLTEEEPMDTDQSGNHLSSIQSEIAKYQLLIEEENQKLKRYKVENIRRKHNYLPFIMELLKTLAEYQQLIPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: uchl5 (ubiquitin carboxyl-terminal hydrolase L5 [Source:ZFIN;Acc:ZDB-GENE-040426-2051])

HSP 1 Score: 293.508 bits (750), Expect = 1.690e-97
Identity = 155/322 (48.14%), Postives = 215/322 (66.77%), Query Frame = 1
Query:   76 MAGGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMD--YMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQL-----LMLKESGDPHDAIPQILSS----IQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            MAG  + G WCL+ESDPGVFTE+IKGFG  G +  EI  M+     +L   +GLIFL+KW P   P  ++V D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F +SFD+ MKGL +SNS+ IR+VHN F+   ++E D K +   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL +QL     +   +SG+   +I   ++     I++EN K +RY++ENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    1 MAG--SAGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGSIVQDSR-LDQIFFAKQVINNACATQAIISVLLNCTHPDMLLGETLTEFKEFSNSFDAAMKGLALSNSEVIRQVHNGFARQQMFEFDAKSTAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGVCNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEKKIVELQAQLTEEEPMDTDQSGNHLSSIQSEIAKYQLLIEEENQKLKRYKVENIRRKHNYLPFIMELLKTLAEYQQLIPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: bap1 (BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) [Source:NCBI gene;Acc:558885])

HSP 1 Score: 174.096 bits (440), Expect = 4.232e-48
Identity = 95/248 (38.31%), Postives = 143/248 (57.66%), Query Frame = 1
Query:  100 NWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVT--------DPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSH----GPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERM------QRHSGTHFNIMVLVPDRLEELNSQLLMLK 789
             W  +ESDPG+FT +++ FGV G++  EI D+      +  YG IFL+KW  E      V T        D +I+ND+FFA Q+I N+CAT ALL++L N    ++LG TL  +K+F   F+   KG  I N+ ++ K HNS +      L +K++        +A+HF+ Y+P+K RL+E DGL+  PIDHGP  +D+ W +  + VI ER+      + +    FN+M +VPDR  +  S+L +LK
Sbjct:    4 GWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQ-SPVYGFIFLFKWIEERRSRRKVSTLVDETSVIDDDIVNDMFFAHQLIPNSCATHALLSVLLNC-SGVELGMTLSRMKAFTKGFNPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYESKLDILK 249          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: bap1 (BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) [Source:NCBI gene;Acc:558885])

HSP 1 Score: 161.77 bits (408), Expect = 1.041e-43
Identity = 90/239 (37.66%), Postives = 137/239 (57.32%), Query Frame = 1
Query:  127 GVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVT--------DPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSH----GPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERM------QRHSGTHFNIMVLVPDRLEELNSQLLMLK 789
            G+FT +++ FGV G++  EI D+      +  YG IFL+KW  E      V T        D +I+ND+FFA Q+I N+CAT ALL++L N    ++LG TL  +K+F   F+   KG  I N+ ++ K HNS +      L +K++        +A+HF+ Y+P+K RL+E DGL+  PIDHGP  +D+ W +  + VI ER+      + +    FN+M +VPDR  +  S+L +LK
Sbjct:   14 GLFTLLVEDFGVKGVQVEEIYDLQSKCQ-SPVYGFIFLFKWIEERRSRRKVSTLVDETSVIDDDIVNDMFFAHQLIPNSCATHALLSVLLNC-SGVELGMTLSRMKAFTKGFNPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYESKLDILK 250          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: uchl1 (ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) [Source:ZFIN;Acc:ZDB-GENE-030131-3844])

HSP 1 Score: 64.3142 bits (155), Expect = 1.658e-11
Identity = 43/152 (28.29%), Postives = 70/152 (46.05%), Query Frame = 1
Query:  304 DIFFAQQVITNACATQALLNILFNLGDDIKL--GKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPED---AYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSG-THFNIMVL 741
            D++F +Q + N+C T  L++ + N  D I       L +     S      +   +  +  I++ H++ +        D+    PE     +HFI ++ V GRLYE DG  DGP+ HGP   D S++     V  E M+R  G   F+ + L
Sbjct:   73 DVYFLKQTVVNSCGTVGLVHAVANNQDSIDFDNNSALKKFLEATSGMSPAERAKELEQNKAIQETHDAVA--------DEGQCRPEADKVNFHFITFVNVNGRLYELDGRIDGPVSHGPTKPD-SFVMDAARVCREFMEREKGEVRFSAVAL 215          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:NCBI gene;Acc:100124308])

HSP 1 Score: 301.212 bits (770), Expect = 2.506e-100
Identity = 159/328 (48.48%), Postives = 215/328 (65.55%), Query Frame = 1
Query:   76 MAGGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRH--SGTHFNIMVLVPDRLEELNSQLLMLK-----ESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRR 996
            MAG  + G WCL+ESDPGVFTE+IKGFG  GI+  EI  ++ ++   L    GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA+++IL N    D+ LG+TL E K F  SFD+ MKGL +SNS+ IR+VHNSF+   ++E D K +   +DA+HF+ Y+PV GRLYE DGL+DGPID GP  +D+ WI+  +PVI +RMQ++      FN+M +V DR +    ++  L+     E     D    ++SS+Q E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E    RR
Sbjct:    1 MAG--SAGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFEDLQPVQGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIISILLNTTHTDVHLGETLSEFKEFTQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSTTKDDDAFHFVSYVPVNGRLYELDGLRDGPIDLGPCKEDE-WISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKITDLQRRLAEEEPMDTDQGSTLMSSMQSEIAKYQLLIEEENQKIKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKHNTRR 324          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:NCBI gene;Acc:100124308])

HSP 1 Score: 294.664 bits (753), Expect = 8.048e-98
Identity = 155/320 (48.44%), Postives = 210/320 (65.62%), Query Frame = 1
Query:   76 MAGGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRH--SGTHFNIMVLVPDRLEELNSQLLMLK-----ESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERA 972
            MAG  + G WCL+ESDPGVFTE+IKGFG  GI+  EI  ++ ++   L    GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA+++IL N    D+ LG+TL E K F  SFD+ MKGL +SNS+ IR+VHNSF+   ++E D K +   +DA+HF+ Y+PV GRLYE DGL+DGPID GP  +D+ WI+  +PVI +RMQ++      FN+M +V DR +    ++  L+     E     D    ++SS+Q E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+ 
Sbjct:    1 MAG--SAGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFEDLQPVQGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIISILLNTTHTDVHLGETLSEFKEFTQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSTTKDDDAFHFVSYVPVNGRLYELDGLRDGPIDLGPCKEDE-WISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKITDLQRRLAEEEPMDTDQGSTLMSSMQSEIAKYQLLIEEENQKIKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKV 316          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:NCBI gene;Acc:100124308])

HSP 1 Score: 294.278 bits (752), Expect = 1.284e-97
Identity = 155/320 (48.44%), Postives = 210/320 (65.62%), Query Frame = 1
Query:   76 MAGGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRH--SGTHFNIMVLVPDRLEELNSQLLMLK-----ESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERA 972
            MAG  + G WCL+ESDPGVFTE+IKGFG  GI+  EI  ++ ++   L    GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA+++IL N    D+ LG+TL E K F  SFD+ MKGL +SNS+ IR+VHNSF+   ++E D K +   +DA+HF+ Y+PV GRLYE DGL+DGPID GP  +D+ WI+  +PVI +RMQ++      FN+M +V DR +    ++  L+     E     D    ++SS+Q E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+ 
Sbjct:    1 MAG--SAGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFEDLQPVQGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIISILLNTTHTDVHLGETLSEFKEFTQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSTTKDDDAFHFVSYVPVNGRLYELDGLRDGPIDLGPCKEDE-WISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKITDLQRRLAEEEPMDTDQGSTLMSSMQSEIAKYQLLIEEENQKIKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKV 316          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: UCHL5 (ubiquitin C-terminal hydrolase L5 [Source:NCBI gene;Acc:100124308])

HSP 1 Score: 275.018 bits (702), Expect = 1.198e-90
Identity = 151/317 (47.63%), Postives = 200/317 (63.09%), Query Frame = 1
Query:   76 MAGGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENS 1017
            MAG  + G WCL+ESDPGVFTE+IKGFG  GI+  EI  ++ ++   L    GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA+++IL N    D+ LG+TL E K F  SFD+ MKGL +SNS+ IR+VHNSF+   ++E D K +   +DA+HF+ Y+PV GRLYE DGL+DGPID GP  +D+ WI+  +P   E M    G+                     L  S     A  Q+L  I++EN K +RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+   + +   K  HEN+
Sbjct:    1 MAG--SAGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFEDLQPVQGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIISILLNTTHTDVHLGETLSEFKEFTQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSTTKDDDAFHFVSYVPVNGRLYELDGLRDGPIDLGPCKEDE-WISAARP--EEPMDTDQGS--------------------TLMSSMQSEIAKYQLL--IEEENQKIKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKVRVILM---KNGHENT 286          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: bap1 (BRCA1 associated protein 1 [Source:NCBI gene;Acc:493568])

HSP 1 Score: 159.844 bits (403), Expect = 4.265e-43
Identity = 89/239 (37.24%), Postives = 134/239 (56.07%), Query Frame = 1
Query:  127 GVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVT--------DPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSH----GPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERM------QRHSGTHFNIMVLVPDRLEELNSQLLMLK 789
            G+FT +++ FGV G++  EI D+         YG IFL+KW  E      V T        + E++N++FFA Q+I N+CAT ALL++L N    + LG TL  +K F   F    KG  I N+ ++ K HNS +      L +K++        +A+HF+ Y+P+KGRL+E DGL+  PIDHGP  +D+ W +  + VI ER+      + +    FN+M +VPDR  +  S+L +LK
Sbjct:    1 GLFTLLVEDFGVKGVQVEEIYDLQSKCP-GPVYGFIFLFKWIEERRSRRKVSTLLDDTSVMEDEVVNNMFFAHQLIPNSCATHALLSVLLNC-SGVHLGPTLSRIKEFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKVYPIDHGPWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRLKYESKLHILK 237          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Uchl5 (ubiquitin carboxyl-terminal esterase L5 [Source:MGI Symbol;Acc:MGI:1914848])

HSP 1 Score: 294.664 bits (753), Expect = 6.290e-98
Identity = 156/317 (49.21%), Postives = 205/317 (64.67%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L  IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K     EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI   +PVI +R+Q++S     FN+M +V DR       + EL  QL   +E     D    +LS+IQ E A+++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTPAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQL--AEEEPMDTDQGSTVLSAIQSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Uchl5 (ubiquitin carboxyl-terminal esterase L5 [Source:MGI Symbol;Acc:MGI:1914848])

HSP 1 Score: 293.893 bits (751), Expect = 1.221e-97
Identity = 156/317 (49.21%), Postives = 204/317 (64.35%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L  IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K     EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI   +PVI +R+Q++S     FN+M +V DR       + EL  Q   L E     D    +LS+IQ E A+++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTPAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQ---LAEEPMDTDQGSTVLSAIQSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 317          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Uchl5 (ubiquitin carboxyl-terminal esterase L5 [Source:MGI Symbol;Acc:MGI:1914848])

HSP 1 Score: 179.489 bits (454), Expect = 2.006e-54
Identity = 108/265 (40.75%), Postives = 140/265 (52.83%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMS--SLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKH 858
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++  S   L   +GLIFL+KW P   P  +VV D   L  IFFA+Q                                         MKGL +SNSD IR+VHNSF+   ++E D K     EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI   +PVI +R+Q++S     FN+M +V DR       + EL  QL   +E     D    +LS+IQ E A++
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LETIFFAKQ-----------------------------------------MKGLALSNSDVIRQVHNSFARQQMFEFDTKTPAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQL--AEEEPMDTDQGSTVLSAIQSEVARN 225          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Bap1 (Brca1 associated protein 1 [Source:MGI Symbol;Acc:MGI:1206586])

HSP 1 Score: 168.703 bits (426), Expect = 3.288e-46
Identity = 93/247 (37.65%), Postives = 140/247 (56.68%), Query Frame = 1
Query:  103 WCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVT--------DPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSH----GPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERM------QRHSGTHFNIMVLVPDRLEELNSQLLMLK 789
            W  +ESDPG+FT +++ FGV G++  EI D+         YG IFL+KW  E      V T        D +I+N++FFA Q+I N+CAT ALL++L N   ++ LG TL  +K F   F    KG  I N+ ++ K HNS +      L +K++        +A+HF+ Y+P+ GRL+E DGL+  PIDHGP  +D+ W +  + VI ER+      + +    FN+M +VPDR  +  ++L +LK
Sbjct:    5 WLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQ-GPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNC-SNVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYETRLHVLK 249          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Uchl5 (ubiquitin carboxyl-terminal esterase L5 [Source:MGI Symbol;Acc:MGI:1914848])

HSP 1 Score: 134.035 bits (336), Expect = 1.413e-37
Identity = 74/159 (46.54%), Postives = 100/159 (62.89%), Query Frame = 1
Query:  553 EDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSG--THFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVER 969
            EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI   +PVI +R+Q++S     FN+M +V DR       + EL  QL   +E     D    +LS+IQ E A+++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+
Sbjct:    3 EDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLA--EEEPMDTDQGSTVLSAIQSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEK 158          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q06AT3|UCHL5_PIG (Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Sus scrofa OX=9823 GN=UCHL5 PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 2.696e-98
Identity = 158/317 (49.84%), Postives = 208/317 (65.62%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL  QL   +E     D    +LS+IQ E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQL--AEEEPMDTDQGSNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9Y5K5|UCHL5_HUMAN (Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=3)

HSP 1 Score: 297.745 bits (761), Expect = 3.461e-98
Identity = 158/317 (49.84%), Postives = 208/317 (65.62%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL  QL   +E     D    +LS+IQ E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQL--AEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9XSJ0|UCHL5_BOVIN (Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Bos taurus OX=9913 GN=UCHL5 PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 2.013e-97
Identity = 157/317 (49.53%), Postives = 207/317 (65.30%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K +   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI+  +PVI +R+Q++S     FN+M +V DR       + EL  Q   L E     D    +LS+IQ E AK++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTAAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQ---LAEEPMDTDQGSNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 317          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9WUP7|UCHL5_MOUSE (Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Mus musculus OX=10090 GN=Uchl5 PE=1 SV=2)

HSP 1 Score: 294.664 bits (753), Expect = 4.400e-97
Identity = 156/317 (49.21%), Postives = 205/317 (64.67%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHE-----------RYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  ++ +    L   +GLIFL+KW P   P  +VV D   L  IFFA+QVI NACATQA++++L N    D+ LG+TL E K F  SFD+ MKGL +SNSD IR+VHNSF+   ++E D K     EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WI   +PVI +R+Q++S     FN+M +V DR       + EL  QL   +E     D    +LS+IQ E A+++           RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR-LETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTPAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQL--AEEEPMDTDQGSTVLSAIQSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q09444|UBH4_CAEEL (Ubiquitin carboxyl-terminal hydrolase ubh-4 OS=Caenorhabditis elegans OX=6239 GN=ubh-4 PE=1 SV=2)

HSP 1 Score: 275.404 bits (703), Expect = 1.258e-89
Identity = 142/308 (46.10%), Postives = 200/308 (64.94%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNH-AYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTH--FNIMVLVPDR---LEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRK 999
            G+WCLIESDPGVFTE+++GFGV G++  E+  +D   ++    YGLIFL+KW  +      + +D +   +IFFA Q I NACATQAL+N+L N+ D D+KLG  L + K F    D + +G  +SNS++IR VHNSFS   L+ELD K     ED YHF+ Y+P+  ++YE DGL++ P++     ++Q WI   KPVI +RMQ++S     FN+M LVP+R   L+E+   L+   E+ +  + I  +  +I DE+ K E YR EN RRRHNY PF+IELMK+LA+EGKL  LV+ A + A  + K
Sbjct:    5 GSWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDKAMTRPTYGLIFLFKWR-QGDETTGIPSDKQ---NIFFAHQTIQNACATQALINLLMNVEDTDVKLGNILNQYKEFAIDLDPNTRGHCLSNSEEIRTVHNSFSRQTLFELDIKGGES-EDNYHFVTYVPIGNKVYELDGLRELPLEVAEFQKEQDWIEAIKPVIQQRMQKYSEGEITFNLMALVPNRKQKLQEMMENLIQANENNELEEQIADLNKAIADEDYKMEMYRKENNRRRHNYTPFVIELMKILAKEGKLVGLVDNAYQAAKEKSK 307          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A4E0RFG2 (Ubiquitin carboxyl-terminal hydrolase OS=Fasciola hepatica OX=6192 GN=D915_008710 PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 4.996e-109
Identity = 158/319 (49.53%), Postives = 219/319 (68.65%), Query Frame = 1
Query:   82 GGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESG-DPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKM 1032
            G  A+GNWCLIESDPGVFTE+I+GFGV G+EC E+ D+    S+  A GLIFL+ W  +S     +V DP+  N IFFA+QVITNACATQA++NIL N+ D +++LG+TLL  KSF   FDS MKG+++S S  IR VHNSFS   ++E D+K S   +D YHF+GY+PV G LYE DGL++GP+DHG IP + +WI+  +P++ +RM +    +FN+M +VP+RL     QL  +K S     + I ++  +I++E  K   +R ENIRRRHNY+P I+EL+K LAE+G L   + +A+  A   ++RR   SN +KM
Sbjct:   10 GSSANGNWCLIESDPGVFTELIRGFGVEGLECEEVYDLKETESIADALGLIFLFNWAGQSSGDEKIVPDPK-ENGIFFAKQVITNACATQAIINILMNIADKNVQLGQTLLSFKSFVEEFDSTMKGISLSTSQQIRTVHNSFSNYQMFEFDEKSSKKQDDVYHFVGYLPVNGVLYELDGLKNGPVDHGKIPANTTWIDFARPILEKRMNQRIDGNFNLMAVVPNRLSIYQKQLEQIKSSSMASQEIIKELERNIENEKRKAASHRQENIRRRHNYLPLIVELLKTLAEQGCLVEYINKAKAAA---QERRAVKSNIAKM 324          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A504YX92 (Ubiquitin carboxyl-terminal hydrolase OS=Fasciola gigantica OX=46835 GN=FGIG_00980 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 2.793e-108
Identity = 158/319 (49.53%), Postives = 218/319 (68.34%), Query Frame = 1
Query:   82 GGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESG-DPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKM 1032
            G  A+GNWCLIESDPGVFTE+I+GFGV G+EC E+ D+    S+  A GLIFL+ W  +S     +V DP+  N IFFA+QVITNACATQA++NIL N+ D +++LG+TLL  KSF   FDS MKG+++S S  IR VHNSFS   ++E D+K S   +D YHF+GY+PV G LYE DGL++GP+DHG IP +  WI+  +P++ +RM +    +FN+M +VP+RL     QL  +K S     + I ++  +I++E  K   +R ENIRRRHNY+P I+EL+K LAE+G L   + +A+  A   ++RR   SN +KM
Sbjct:   10 GSSANGNWCLIESDPGVFTELIRGFGVEGLECEEVYDLKETESIADALGLIFLFNWAGQSSGDEKIVPDPK-ENGIFFAKQVITNACATQAIINILMNIADKNVQLGQTLLSFKSFVEEFDSTMKGISLSTSQQIRTVHNSFSNYQMFEFDEKSSKKQDDVYHFVGYLPVNGVLYELDGLKNGPVDHGKIPANTPWIDFARPILEKRMNQRIDGNFNLMAVVPNRLSIYQKQLEQIKSSSMASQEIIKELERNIENEKRKAASHRQENIRRRHNYLPLIVELLKTLAEQGCLVEYINKAKAAA---QERRAVKSNIAKM 324          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A4Z2D011 (Ubiquitin carboxyl-terminal hydrolase OS=Schistosoma japonicum OX=6182 GN=EWB00_005924 PE=3 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 7.302e-107
Identity = 157/311 (50.48%), Postives = 211/311 (67.85%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLK-ESGDPHDA-IPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNR 1023
            GNWCLIESDPGVFTE+I+GFGV  +EC E+ D+   S+++ A G IFL+ +  +      VV D E    IFFA+Q I+NACATQA++NIL N+ D + +G TL   KSF S FDS MKG  ISNSD IR VHNSFS   L+E D++     ED YHF+ Y+P+ G LYE DGL+ GPIDHG +P++ SWIN  +P++ +RM++     FNIM +VP+RL    +QL   K +SG+P  A I ++ S+I +E  K   YR ENIRRRHNY+P I+EL+K+L E G+L  LVE+A+++AL R      N+ +
Sbjct:    5 GNWCLIESDPGVFTELIRGFGVESLECEEVYDLTSTSNVSDALGFIFLFNYDDKQDDAGEVVFD-ENSRGIFFAKQTISNACATQAIINILLNIDDKVPIGSTLSNFKSFVSDFDSTMKGTAISNSDQIRVVHNSFSNYQLFEFDERAPKSNEDVYHFVSYLPINGTLYELDGLKPGPIDHGKLPENSSWINSVRPLLMKRMEKCVDGKFNIMAVVPNRLAMYENQLAQFKMDSGEPSTAYIAELKSNIANEKKKIAAYRAENIRRRHNYLPLIVELLKVLGESGQLVSLVEKAQKIALERSALNAPNAAK 314          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A131XCB0 (Ubiquitin carboxyl-terminal hydrolase OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 9.035e-107
Identity = 164/321 (51.09%), Postives = 221/321 (68.85%), Query Frame = 1
Query:   79 AGGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMS--SLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLM-LKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKR 1002
            A   + G+WCLIESDPGVFTE+IKGFGV G++  E+  +D  S   L   +GLIFL+KW+    P  ++V D   L  IFFA+QVI NACATQA+L++L N+   DI LG TL   K FC SFD+ MKGLT+SNSD IR+VHNSFS   ++E D K+S   +D YHFIGY+P+ GRLYE DGL++GPID GPIPQ   WI+  +PVI  R+++++    HFN+M L+ DR       L+ +N+QL     E+ D    I ++   IQ+E  K +RY++ENIRR+HNY+P I+E++K L+EE KL PLVE+A E AL ++K+
Sbjct:    3 ASSASAGDWCLIESDPGVFTELIKGFGVKGVQVEELWSLDRESFDKLKPVHGLIFLFKWYRNDEPSGSIVQDNR-LEKIFFAKQVINNACATQAILSVLLNVKHPDIFLGDTLTSFKDFCQSFDATMKGLTLSNSDVIREVHNSFSRQQMFEFDIKQSSKDDDVYHFIGYVPIDGRLYELDGLKEGPIDLGPIPQGTDWIDTVRPVIESRIKQYNEGEIHFNLMALITDRKLLYQKQLDSMNAQLSAGGMETDDVQSEISKLHMLIQEEENKCKRYKVENIRRKHNYLPLIMEILKFLSEEKKLVPLVEKAREKALEKKKQ 322          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A4S2LVQ6 (Ubiquitin carboxyl-terminal hydrolase OS=Opisthorchis felineus OX=147828 GN=CRM22_005976 PE=3 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 2.163e-106
Identity = 154/309 (49.84%), Postives = 216/309 (69.90%), Query Frame = 1
Query:   91 ADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDA---IPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRR 1005
            + GNWCLIESDP VFTE+I+GFG  G+EC E+ D+  +  ++ A GLIFL++W   +    ++V D +  N +FFA+QVITNACATQA++NIL NL D +I LG TL E KSF + FDS MKG  +SNSD IR VHNSFS   ++E D+K S   ED YHF+GY+P+ G LYE DGL++GP+DHG IP++QSW++   P++ +RMQR    +FN++ +VP RL     QL  +++S +  ++   + ++  +I+ E  K   YR EN RRRHNY+PFII+LMK+LAE   L   VERA++MA +R++ +
Sbjct:    3 SSGNWCLIESDPAVFTELIRGFGAQGLECDEVYDLKEIDRVSDALGLIFLFRWDGNNSGDGHLVEDAQSKN-LFFAKQVITNACATQAIINILLNLDDKEIVLGDTLKEFKSFVADFDSSMKGTALSNSDQIRMVHNSFSNYQIFEFDEKISKKDEDVYHFVGYVPIDGVLYELDGLKEGPVDHGSIPENQSWLSFATPILQKRMQRCLNGNFNLLAVVPHRLSVYQKQLAQVQQSTNGTESAELVRELERNIEREKQKAVSYRQENTRRRHNYLPFIIDLMKILAENSALVNSVERAKKMAHDRKQAK 310          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: uchl5 (ubiquitin C-terminal hydrolase L5 [Source:NCBI gene;Acc:103042419])

HSP 1 Score: 298.516 bits (763), Expect = 1.981e-99
Identity = 158/317 (49.84%), Postives = 210/317 (66.25%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMD--YMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDAIPQILSSIQ-----------DENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  M+     +L   +GLIFL+KW P   P  ++V D   L+ IFFA+QVI NACATQA++++L N    D+ LG+TL E K F +SFD+ MKGL +SNS+ IR+VHNSF+   ++E D K +   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WIN  +PVI +R+Q++S     FN+M +V DR       + EL +QL   +E     D    +LSSIQ           +EN K +RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGSIVQDSR-LDQIFFAKQVINNACATQAIVSVLLNCTHSDMHLGETLTEFKEFSNSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSTSKDEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWINAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKISELQAQL--SEEEPMDTDQGGNLLSSIQSEIAKYQLLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEYQQLIPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: bap1 (BRCA1 associated protein 1 [Source:NCBI gene;Acc:103034294])

HSP 1 Score: 172.555 bits (436), Expect = 1.507e-47
Identity = 94/248 (37.90%), Postives = 143/248 (57.66%), Query Frame = 1
Query:  100 NWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVT--------DPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSH----GPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERM------QRHSGTHFNIMVLVPDRLEELNSQLLMLK 789
             W  +ESDPG+FT +++ FGV G++  EI D+      +  YG IFL+KW  E      V T        D +I+ND+FFA Q+I N+CAT ALL++L N    ++LG TL  +K+F   F+   KG  I N+ ++ K HNS +      L +K++        +A+HF+ Y+P+K RL+E DGL+  PIDHGP  +++ W +  + VI ER+      + +    FN+M +VPDR  +  S+L +LK
Sbjct:    4 GWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQ-SPVYGFIFLFKWIEERRSRRKVSTLVDETSVIDDDIVNDMFFAHQLIPNSCATHALLSVLLNC-SGVELGMTLSRMKTFTKGFNPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHGPWGEEEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMKYESRLEVLK 249          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: uchl1 (ubiquitin C-terminal hydrolase L1 [Source:NCBI gene;Acc:103023920])

HSP 1 Score: 55.4546 bits (132), Expect = 1.270e-8
Identity = 30/115 (26.09%), Postives = 53/115 (46.09%), Query Frame = 1
Query:  304 DIFFAQQVITNACATQALLNILFNLGDDIKL--GKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHG 642
            D++F  Q + N+C T  LL+ + N  D +    G TL +     +      +   +  +  I++ H+  +       +  K +     +HFI +  V G+LYE DG  +GP+ HG
Sbjct:   73 DVYFLNQTVVNSCGTVGLLHAVANNQDKMTFEAGSTLKKFLEETTGMSPADRAKQLEKNQAIQQTHDEVAAEGQCRPEADKVN-----FHFITFANVSGQLYELDGRMEGPVKHG 182          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: uchl3 (ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) [Source:ZFIN;Acc:ZDB-GENE-050522-158])

HSP 1 Score: 48.521 bits (114), Expect = 2.788e-6
Identity = 38/129 (29.46%), Postives = 57/129 (44.19%), Query Frame = 1
Query:  292 EILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSF---CSSFDSHMKGLTISNSDDIRKVHNSFSCSALYE---LDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQ 660
            E+  D++F +Q I NAC T  L++ + N    ++       LK+F    S      K   +   + IR  H S +     E   LD+K         HFI  + V G L+E DG +  PI HG   +D+
Sbjct:   79 EVSPDVYFMRQTIGNACGTIGLIHAVANNQGHLEFEPNS-PLKTFLVQSSKLSPEEKATFLEKDESIRVTHESSAQEGQTEAPSLDEKVD------LHFIALVNVGGHLHELDGRKPFPIVHGKTSEDR 200          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: uchl5 (ubiquitin carboxyl-terminal hydrolase L5 [Source:ZFIN;Acc:ZDB-GENE-040426-2051])

HSP 1 Score: 199.904 bits (507), Expect = 4.537e-62
Identity = 112/297 (37.71%), Postives = 168/297 (56.57%), Query Frame = 1
Query:  157 GVSGIECAEI--IDMDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILND-IFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPD-------RLEELNSQLLM--LKESGDPHD--AIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRR 996
            G  G +  EI  ++ +  S L   +GLIFL+KW        ++V D    ND +FFA+Q + NACATQALL++L N+   D+ LG TL   + F S FDS MKGL +SNSD IR+VHNSF+   ++E D + +   EDA+HF+ ++P +GRLYE DGL+DGPID G   Q+  W+   +PVI  R+QR++     F++M +V D       R+ EL + L     +E G         +++  I++EN K +++++    R   Y+ F     + +  E  L P V  A+E A  R+
Sbjct:    1 GCKGAQVEEIYSLEEESFSKLKPVHGLIFLFKWTAGEEMEGSIVRDSR--NDTLFFAKQPVRNACATQALLSVLLNVTHSDVTLGHTLTSFRDFTSGFDSAMKGLALSNSDTIRQVHNSFARQQMFEWDGRAAGKDEDAFHFVAFVPKQGRLYELDGLRDGPIDLGACDQE-DWVKSVRPVIERRIQRYTEGEIRFSLMAVVSDRRMIYERRIAELQAGLTQGEAREGGGARSLAETSELMLLIEEENLKMQQHKVRECARVSGYLAFGTLTTRAIVRESSLIPTVPLAKEKAAARK 294          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: bap1 (BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) [Source:NCBI gene;Acc:558885])

HSP 1 Score: 77.0258 bits (188), Expect = 1.104e-15
Identity = 35/84 (41.67%), Postives = 53/84 (63.10%), Query Frame = 1
Query:  556 DAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGT------HFNIMVLVPDRLEELNSQLLMLK 789
            +A+HF+ Y+P+ GRL+E DGL+  PIDHGP  +++ W +  + VI ER+   +G        FN+M +VPDR +    +L MLK
Sbjct:   21 EAFHFVSYVPINGRLFELDGLKAYPIDHGPWGEEEEWTDKARRVIMERIGLATGGEPYHDIRFNLMAVVPDRRQIYEQKLTMLK 104          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO32776 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU48])

HSP 1 Score: 194.512 bits (493), Expect = 6.349e-59
Identity = 127/371 (34.23%), Postives = 187/371 (50.40%), Query Frame = 1
Query:  100 NWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNV-------VTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDK----KSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSG------THFNIMVLVPDRLEELNSQLLMLKES-----GDPHDA-----------------IPQIL---------------SSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKMDVA*QY 1050
             W  +ESDPG+FT +I+ FGV G +  EI D+       H YG IFL+KW  E      +       V + EI+NDIFFAQQVI N+CAT ALL++L N    I LG+ + +LK F  +F+   KG  I N  ++   HN F+      L +K     S    +A+HF+ Y+P+KGRL+E DGL+  PIDHGP  + + W    + VI+ER+   +G        +N+M +V DR+ E   +L  L        G  H +                 +PQ L               +++++E  K ++Y +++ RR HNY PFI   + +LA+EG +  LVE  +  +L RR  +     RS + V   Y
Sbjct:    3 QWRELESDPGIFTLLIEEFGVKGAQVEEIYDLSKPMK-GHVYGFIFLFKWIEERRSRRKIQHIDESFVENEEIVNDIFFAQQVIPNSCATHALLSVLLNC-PHIDLGENVSKLKDFSKNFNPENKGYVIGNLPELAMSHNKFARPEPKLLPEKTNSISSARALEAFHFVSYVPIKGRLFELDGLKPYPIDHGPWGEQEDWTEKFRRVITERLGIATGGEPYHDIRYNLMAVVADRVTEFEEELEKLTNESILIVGADHISPQCIYIVSLLIHVGTFVLPQELALELHDVELRMTTCETALREEKDKRKKYYVDHCRRTHNYDPFICTFLTMLAQEGHMGQLVE--QHTSLKRRLAQSMAQKRSHIKVKRPY 369          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO34651 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS9])

HSP 1 Score: 151.754 bits (382), Expect = 2.897e-45
Identity = 78/142 (54.93%), Postives = 98/142 (69.01%), Query Frame = 1
Query:   91 ADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMS--SLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGD-DIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFS 507
            A   WCLIESDPGVFTE+I+GFG +G++  EI  +D  S  +L   +G+IFL+KW P   P  +VV D   L  IFFA+QVITNACATQA+L++L N    DI LG  L   K F ++FD  +KGL++SNSD IR VHNSFS
Sbjct:    3 ASAEWCLIESDPGVFTELIRGFGCTGVQVEEIYSLDDASLENLRPVHGIIFLFKWKPGEEPAGSVVQDSRSLG-IFFAKQVITNACATQAILSVLLNTAHPDIDLGPNLSSFKDFSATFDGALKGLSLSNSDVIRAVHNSFS 143          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO37830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEQ2])

HSP 1 Score: 63.929 bits (154), Expect = 1.782e-12
Identity = 46/129 (35.66%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  700 MQRHSG--THFNIMVLVPDR-------LEELN---SQLLM----LKESGDPHDA-------------------------IPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLV 963
            MQR+S     FN+M +V DR       +E LN    QLL     L+ES  P                            I ++ S +  E+ K  RY++ENIRR+HNY+P I+E++KLLA++G+L PLV
Sbjct:    1 MQRYSSEEIRFNLMAIVTDRKMLYLQEIEALNMKKQQLLERIHELRESSKPEGGEAMETDQANQSVSDLEGIVQSMGSEILRLQSLVSAEDDKMLRYKVENIRRKHNYIPLIMEMLKLLAKKGELVPLV 129          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO40453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S784])

HSP 1 Score: 49.6766 bits (117), Expect = 4.516e-7
Identity = 39/155 (25.16%), Postives = 70/155 (45.16%), Query Frame = 1
Query:  292 EILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSF---CSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRH-SGTHFNIMVLV 744
            E+  D+++ +Q ++NAC T A+++ + N    + L     ELK F     S     +G  +   + I + H +   SA     +  S       HF+  +   G +YE DG ++ PI+HG     ++++     V  E M R  +  HF ++ L 
Sbjct:   76 EVSPDLYYMKQTVSNACGTVAIVHSIANNTSQLDLEDG--ELKKFIDATRSLSPQERGEKLETDEGITEAHEA---SAQEGQTEAPSADEPVNLHFVSIVHKDGAVYELDGRKEFPINHGK-STPETFMKDAARVCREFMTRDPTELHFTVVALA 224          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: uchl5 (ubiquitin C-terminal hydrolase L5 [Source:NCBI gene;Acc:101155020])

HSP 1 Score: 293.893 bits (751), Expect = 1.196e-97
Identity = 156/319 (48.90%), Postives = 206/319 (64.58%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMD--YMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDA-------------IPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  M+     +L   +GLIFL+KW P   P  ++V D   L+ IFFA+QVI NACATQA++++L N    DI LG TL E + F  SFD+ MKGL +SNS+ IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WIN  +PVI +R+Q++S     FN+M +V DR       + EL +QL       +P D              I +    I++EN K +RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGSIVQDSR-LDHIFFAKQVINNACATQAIVSVLLNCSHSDIVLGDTLSEFREFSQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSSAKDEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWINAVRPVIEKRIQKYSEGEIRFNLMSIVSDRKMIYEKKIAELQAQLT----EDEPMDTDQSSSFLSSIQSEIAKYQLLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEYQQLMPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: uchl5 (ubiquitin C-terminal hydrolase L5 [Source:NCBI gene;Acc:101155020])

HSP 1 Score: 293.893 bits (751), Expect = 1.196e-97
Identity = 156/319 (48.90%), Postives = 206/319 (64.58%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMD--YMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDA-------------IPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  M+     +L   +GLIFL+KW P   P  ++V D   L+ IFFA+QVI NACATQA++++L N    DI LG TL E + F  SFD+ MKGL +SNS+ IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WIN  +PVI +R+Q++S     FN+M +V DR       + EL +QL       +P D              I +    I++EN K +RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGSIVQDSR-LDHIFFAKQVINNACATQAIVSVLLNCSHSDIVLGDTLSEFREFSQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSSAKDEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWINAVRPVIEKRIQKYSEGEIRFNLMSIVSDRKMIYEKKIAELQAQLT----EDEPMDTDQSSSFLSSIQSEIAKYQLLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEYQQLMPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: uchl5 (ubiquitin C-terminal hydrolase L5 [Source:NCBI gene;Acc:101155020])

HSP 1 Score: 293.893 bits (751), Expect = 1.196e-97
Identity = 156/319 (48.90%), Postives = 206/319 (64.58%), Query Frame = 1
Query:   97 GNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMD--YMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLG-DDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHS--GTHFNIMVLVPDR-------LEELNSQLLMLKESGDPHDA-------------IPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEE 978
            G WCL+ESDPGVFTE+IKGFG  G +  EI  M+     +L   +GLIFL+KW P   P  ++V D   L+ IFFA+QVI NACATQA++++L N    DI LG TL E + F  SFD+ MKGL +SNS+ IR+VHNSF+   ++E D K S   EDA+HF+ Y+PV GRLYE DGL++GPID G   QD  WIN  +PVI +R+Q++S     FN+M +V DR       + EL +QL       +P D              I +    I++EN K +RY+IENIRR+HNY+PFI+EL+K LAE  +L PLVE+A+E
Sbjct:    6 GEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGSIVQDSR-LDHIFFAKQVINNACATQAIVSVLLNCSHSDIVLGDTLSEFREFSQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSSAKDEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD-DWINAVRPVIEKRIQKYSEGEIRFNLMSIVSDRKMIYEKKIAELQAQLT----EDEPMDTDQSSSFLSSIQSEIAKYQLLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEYQQLMPLVEKAKE 318          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: bap1 (BRCA1 associated protein 1 [Source:NCBI gene;Acc:101162036])

HSP 1 Score: 173.711 bits (439), Expect = 4.688e-48
Identity = 94/249 (37.75%), Postives = 144/249 (57.83%), Query Frame = 1
Query:  103 WCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNV--------VTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSH----GPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERM------QRHSGTHFNIMVLVPDRLEELNSQLLMLKES 795
            W  +ESDPG+FT +++ FGV G++  EI D+      +  YG IFL+KW  E      V        V D EI+ND+FFA Q+I N+CAT ALL++L N    ++LG TL  +K+F   F    KG  I N+ ++ + HNS +      L +K++        +A+HF+ Y+P+K RL+E DGL+  PIDHGP  +++ W +  + VI ER+      + +    FN+M +VPDR  +  S+L +LK++
Sbjct:    5 WLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQ-SPVYGFIFLFKWIEERRSRRKVNTLVDETSVIDEEIVNDMFFAHQLIPNSCATHALLSVLLNC-SGVELGSTLSRIKAFTKGFSPESKGYAIGNAPELARAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHGPWGEEEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMKYESKLEVLKKN 251          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: bap1 (BRCA1 associated protein 1 [Source:NCBI gene;Acc:101162036])

HSP 1 Score: 161.384 bits (407), Expect = 1.210e-43
Identity = 89/241 (36.93%), Postives = 138/241 (57.26%), Query Frame = 1
Query:  127 GVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPESVPPPNV--------VTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSH----GPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERM------QRHSGTHFNIMVLVPDRLEELNSQLLMLKES 795
            G+FT +++ FGV G++  EI D+      +  YG IFL+KW  E      V        V D EI+ND+FFA Q+I N+CAT ALL++L N    ++LG TL  +K+F   F    KG  I N+ ++ + HNS +      L +K++        +A+HF+ Y+P+K RL+E DGL+  PIDHGP  +++ W +  + VI ER+      + +    FN+M +VPDR  +  S+L +LK++
Sbjct:   28 GLFTLLVEDFGVKGVQVEEIYDLQSKCQ-SPVYGFIFLFKWIEERRSRRKVNTLVDETSVIDEEIVNDMFFAHQLIPNSCATHALLSVLLNC-SGVELGSTLSRIKAFTKGFSPESKGYAIGNAPELARAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHGPWGEEEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMKYESKLEVLKKN 266          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000040762.1 (SMESG000040762.1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 283/283 (100.00%), Postives = 283/283 (100.00%), Query Frame = 1
Query:  193 MDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKMDVA 1041
            MDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKMDVA
Sbjct:    1 MDYMSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKMDVA 283          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000040762.1 (SMESG000040762.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 280/280 (100.00%), Postives = 280/280 (100.00%), Query Frame = 1
Query:  202 MSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKMDVA 1041
            MSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKMDVA
Sbjct:    1 MSSLNHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDAIPQILSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAEEMALNRRKRRHENSNRSKMDVA 280          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000000839.1 (SMESG000000839.1)

HSP 1 Score: 138.658 bits (348), Expect = 4.670e-36
Identity = 91/306 (29.74%), Postives = 145/306 (47.39%), Query Frame = 1
Query:  103 WCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAYGLIFLYKWHPES---------------------VPPPNVV--TDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHN-----------------------SFSCSALYELDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESG----------DPHDAIPQILSSIQDENA 852
            W  +ESDPG+FT +++  GV G++  +I D+         +G +FL+KW  ES                     V   NV+  TD E LN I+FA QVI N+CAT ALL++L N  + I LG  L + +    +     +GL + N  ++   HN                       S +  ++  L ++     ++ YHF+ Y+P+   LYE DGLQ  PI H  I ++++W      +I  RMQ+ S  H+++M +V DR + L  QL +L ++           +  D +   LSSI+ E++
Sbjct:    8 WLELESDPGLFTMLLENIGVKGVQVEDIYDLTEEIK-EEVFGFVFLFKWRDESKKNKRSQFSVNENTKANGVCNVNSKNVLYETDVEKLNQIYFAHQVIPNSCATNALLSVLMNCHERINLGNVLNKFRDMTINMTPEKRGLALGNMPELADAHNKRARYLRSDNHNSNNSLYHSVAASLNTPSVRSLFNENDQEADETYHFVSYLPIGDGLYELDGLQPYPIKHSVI-ENENWTKICLNIIRNRMQQKSD-HYSLMAVVRDRRKVLADQLSVLNKNRSILQQALVQMEQPDQLDHSLSSIKKESS 310          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000006297.1 (SMESG000006297.1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.095e-11
Identity = 59/227 (25.99%), Postives = 102/227 (44.93%), Query Frame = 1
Query:  103 WCLIESDPGVFTEIIKGFGV-SGIECAEI--IDMDYMSSL-NHAYGLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFNLGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYE--LDDKKSHGPEDA----YHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINCTKPVISERMQRHSGTH-FNIMVLVPD 750
            W  IE++P +  + ++  GV +  +C ++  ID + +  +      L+ LY      +  P     PE  ND+ F +Q I NAC T  +L+ L N  +     +      ++ SSF   +  LT    +  + +      SA++E    D +S  PE +     HF+ ++   G LYE DG ++GP  HG   ++         VI + M R    H FN++ +V +
Sbjct:    3 WIPIEANPDIINQFMQKVGVRTQWQCVDVYGIDPELLEFVPKPVISLLLLYPLTEAVLNKPIGEIRPE--NDLIFIKQTIGNACGTIGILHSLCNNKETFDFSE-----DTYISSFTKRISALT--PDERAKVIEQEEFLSAIHEEVALDGQSAVPEISEHTDLHFVSFIHKNGNLYELDGRENGPKYHGDCNENNFLFKAID-VIKKFMNRDPNEHKFNVIAIVKN 219          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UCHL57.207e-9949.84ubiquitin C-terminal hydrolase L5 [Source:HGNC Sym... [more]
UCHL52.002e-9849.84ubiquitin C-terminal hydrolase L5 [Source:HGNC Sym... [more]
UCHL54.289e-9749.53ubiquitin C-terminal hydrolase L5 [Source:HGNC Sym... [more]
UCHL57.079e-9749.37ubiquitin C-terminal hydrolase L5 [Source:HGNC Sym... [more]
UCHL54.028e-9245.64ubiquitin C-terminal hydrolase L5 [Source:HGNC Sym... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubh-49.893e-9146.10Ubiquitin carboxyl-terminal hydrolase ubh-4 [Sour... [more]
ubh-49.893e-9146.10Ubiquitin carboxyl-terminal hydrolase ubh-4 [Sour... [more]
ubh-11.368e-1026.46Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
ubh-31.199e-825.53Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
ubh-24.323e-724.12Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uch-L52.022e-10449.06gene:FBgn0011327 transcript:FBtr0333867[more]
Uch-L52.022e-10449.06gene:FBgn0011327 transcript:FBtr0076472[more]
Uch-L5R1.507e-8545.95gene:FBgn0030370 transcript:FBtr0073638[more]
calypso2.214e-4629.17gene:FBgn0262166 transcript:FBtr0087245[more]
calypso2.214e-4629.17gene:FBgn0262166 transcript:FBtr0087246[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uchl58.433e-9848.14ubiquitin carboxyl-terminal hydrolase L5 [Source:Z... [more]
uchl51.690e-9748.14ubiquitin carboxyl-terminal hydrolase L5 [Source:Z... [more]
bap14.232e-4838.31BRCA1 associated protein-1 (ubiquitin carboxy-term... [more]
bap11.041e-4337.66BRCA1 associated protein-1 (ubiquitin carboxy-term... [more]
uchl11.658e-1128.29ubiquitin carboxyl-terminal esterase L1 (ubiquitin... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UCHL52.506e-10048.48ubiquitin C-terminal hydrolase L5 [Source:NCBI gen... [more]
UCHL58.048e-9848.44ubiquitin C-terminal hydrolase L5 [Source:NCBI gen... [more]
UCHL51.284e-9748.44ubiquitin C-terminal hydrolase L5 [Source:NCBI gen... [more]
UCHL51.198e-9047.63ubiquitin C-terminal hydrolase L5 [Source:NCBI gen... [more]
bap14.265e-4337.24BRCA1 associated protein 1 [Source:NCBI gene;Acc:4... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uchl56.290e-9849.21ubiquitin carboxyl-terminal esterase L5 [Source:MG... [more]
Uchl51.221e-9749.21ubiquitin carboxyl-terminal esterase L5 [Source:MG... [more]
Uchl52.006e-5440.75ubiquitin carboxyl-terminal esterase L5 [Source:MG... [more]
Bap13.288e-4637.65Brca1 associated protein 1 [Source:MGI Symbol;Acc:... [more]
Uchl51.413e-3746.54ubiquitin carboxyl-terminal esterase L5 [Source:MG... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06AT3|UCHL5_PIG2.696e-9849.84Ubiquitin carboxyl-terminal hydrolase isozyme L5 O... [more]
sp|Q9Y5K5|UCHL5_HUMAN3.461e-9849.84Ubiquitin carboxyl-terminal hydrolase isozyme L5 O... [more]
sp|Q9XSJ0|UCHL5_BOVIN2.013e-9749.53Ubiquitin carboxyl-terminal hydrolase isozyme L5 O... [more]
sp|Q9WUP7|UCHL5_MOUSE4.400e-9749.21Ubiquitin carboxyl-terminal hydrolase isozyme L5 O... [more]
sp|Q09444|UBH4_CAEEL1.258e-8946.10Ubiquitin carboxyl-terminal hydrolase ubh-4 OS=Cae... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RFG24.996e-10949.53Ubiquitin carboxyl-terminal hydrolase OS=Fasciola ... [more]
A0A504YX922.793e-10849.53Ubiquitin carboxyl-terminal hydrolase OS=Fasciola ... [more]
A0A4Z2D0117.302e-10750.48Ubiquitin carboxyl-terminal hydrolase OS=Schistoso... [more]
A0A131XCB09.035e-10751.09Ubiquitin carboxyl-terminal hydrolase OS=Hyalomma ... [more]
A0A4S2LVQ62.163e-10649.84Ubiquitin carboxyl-terminal hydrolase OS=Opisthorc... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
uchl51.981e-9949.84ubiquitin C-terminal hydrolase L5 [Source:NCBI gen... [more]
bap11.507e-4737.90BRCA1 associated protein 1 [Source:NCBI gene;Acc:1... [more]
uchl11.270e-826.09ubiquitin C-terminal hydrolase L1 [Source:NCBI gen... [more]
uchl32.788e-629.46ubiquitin carboxyl-terminal esterase L3 (ubiquitin... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
uchl54.537e-6237.71ubiquitin carboxyl-terminal hydrolase L5 [Source:Z... [more]
bap11.104e-1541.67BRCA1 associated protein-1 (ubiquitin carboxy-term... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO327766.349e-5934.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346512.897e-4554.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378301.782e-1235.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404534.516e-725.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uchl51.196e-9748.90ubiquitin C-terminal hydrolase L5 [Source:NCBI gen... [more]
uchl51.196e-9748.90ubiquitin C-terminal hydrolase L5 [Source:NCBI gen... [more]
uchl51.196e-9748.90ubiquitin C-terminal hydrolase L5 [Source:NCBI gen... [more]
bap14.688e-4837.75BRCA1 associated protein 1 [Source:NCBI gene;Acc:1... [more]
bap11.210e-4336.93BRCA1 associated protein 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000040762.10.000e+0100.00SMESG000040762.1[more]
SMESG000040762.10.000e+0100.00SMESG000040762.1[more]
SMESG000000839.14.670e-3629.74SMESG000000839.1[more]
SMESG000006297.14.095e-1125.99SMESG000006297.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029594 ID=SMED30029594|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1093bp
GCCGTAAAGGCTAACTATCCGGAATCTGTTACTTGTTATTAATATACTTT
TTGTTTGAATATTATAATTTTTGAAATGGCTGGCGGTAGAGCTGATGGTA
ATTGGTGTTTAATTGAAAGCGACCCAGGAGTATTTACTGAAATTATTAAA
GGATTTGGTGTTAGTGGAATTGAATGTGCGGAAATAATAGACATGGACTA
TATGTCTAGTTTAAATCATGCGTATGGCTTAATATTTCTTTACAAATGGC
ATCCGGAATCCGTTCCTCCTCCAAACGTTGTAACTGATCCAGAGATTTTA
AATGACATATTTTTTGCACAACAAGTAATAACAAATGCCTGTGCTACTCA
AGCATTGCTAAATATTCTTTTTAATCTTGGTGATGATATTAAGCTAGGAA
AAACTCTTTTGGAACTAAAAAGTTTTTGCAGCAGTTTTGATTCTCATATG
AAAGGTCTTACCATTAGTAATTCTGATGACATTCGAAAAGTTCACAACAG
CTTCAGCTGCTCTGCTTTATATGAACTTGATGATAAAAAATCACATGGAC
CTGAAGATGCTTACCATTTTATTGGATATATGCCAGTTAAAGGACGATTA
TATGAATTTGATGGATTACAAGATGGTCCCATTGATCATGGACCAATTCC
TCAAGACCAGTCATGGATTAATTGCACTAAACCAGTAATAAGTGAAAGAA
TGCAACGTCATTCAGGCACTCATTTTAATATTATGGTATTAGTTCCCGAT
AGGTTGGAAGAGTTGAATTCTCAACTTTTAATGCTAAAAGAGAGCGGCGA
TCCACATGATGCGATTCCTCAAATTCTTAGTAGCATTCAAGATGAAAATG
CTAAACATGAACGTTATCGAATTGAAAATATTCGTAGGCGTCATAATTAC
ATGCCTTTCATTATAGAGCTAATGAAATTACTAGCCGAAGAAGGAAAATT
AACCCCTTTGGTTGAAAGAGCCGAAGAAATGGCTTTAAACAGGCGCAAGC
GTCGACACGAAAATAGCAACCGTAGCAAAATGGATGTAGCCTAACAATAT
CATAATTTCATTTGAAATAAAGATTGTTAATTTTAAAAAAAAA
back to top

protein sequence of SMED30029594-orf-1

>SMED30029594-orf-1 ID=SMED30029594-orf-1|Name=SMED30029594-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MAGGRADGNWCLIESDPGVFTEIIKGFGVSGIECAEIIDMDYMSSLNHAY
GLIFLYKWHPESVPPPNVVTDPEILNDIFFAQQVITNACATQALLNILFN
LGDDIKLGKTLLELKSFCSSFDSHMKGLTISNSDDIRKVHNSFSCSALYE
LDDKKSHGPEDAYHFIGYMPVKGRLYEFDGLQDGPIDHGPIPQDQSWINC
TKPVISERMQRHSGTHFNIMVLVPDRLEELNSQLLMLKESGDPHDAIPQI
LSSIQDENAKHERYRIENIRRRHNYMPFIIELMKLLAEEGKLTPLVERAE
EMALNRRKRRHENSNRSKMDVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR041507UCH_C
IPR036959Peptidase_C12_UCH_sf
IPR038765Papain-like_cys_pep_sf
IPR001578Peptidase_C12_UCH
IPR017390Ubiquitinyl_hydrolase_UCH37
Vocabulary: molecular function
TermDefinition
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0016579protein deubiquitination
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001578Peptidase C12, ubiquitin carboxyl-terminal hydrolasePRINTSPR00707UBCTHYDRLASEcoord: 12..29
score: 30.16
coord: 83..100
score: 44.44
coord: 175..185
score: 51.95
IPR001578Peptidase C12, ubiquitin carboxyl-terminal hydrolasePFAMPF01088Peptidase_C12coord: 10..210
e-value: 1.1E-59
score: 201.8
IPR001578Peptidase C12, ubiquitin carboxyl-terminal hydrolasePANTHERPTHR10589UBIQUITIN CARBOXYL-TERMINAL HYDROLASEcoord: 9..301
IPR041507Peptidase C12, C-terminal domainPFAMPF18031UCH_Ccoord: 250..292
e-value: 4.1E-19
score: 68.2
IPR036959Peptidase C12, ubiquitin carboxyl-terminal hydrolase superfamilyGENE3DG3DSA:3.40.532.10coord: 2..225
e-value: 9.9E-76
score: 256.1
NoneNo IPR availableGENE3DG3DSA:1.20.58.860coord: 226..288
e-value: 1.0E-15
score: 60.0
NoneNo IPR availablePANTHERPTHR10589:SF16UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5coord: 9..301
NoneNo IPR availableCDDcd09617Peptidase_C12_UCH37_BAP1coord: 10..222
e-value: 3.99288E-103
score: 299.541
IPR017390Ubiquitinyl hydrolase, UCH37 typePIRSFPIRSF038120Uchcoord: 5..313
e-value: 6.8E-102
score: 338.4
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 9..225