GFO_IDH_MocA domain-containing protein
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30029573 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 11
Homology
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Xenopus
Match: dhdh (trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [Source:NCBI gene;Acc:448579]) HSP 1 Score: 55.4546 bits (132), Expect = 4.916e-8 Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 IP +MW P +I+N K E F I K NF N +E HV+QC+ GL ES I L S VA IM++ L++ Sbjct: 249 IPSDMWSPTSIIVNGK-ERKFDIPHTTKPM--NFSNGTGMSYEAEHVRQCLLKGLKESPIMSLADSEMVASIMDEALQQ 324
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Xenopus
Match: dhdh (dihydrodiol dehydrogenase (dimeric) [Source:NCBI gene;Acc:100145807]) HSP 1 Score: 53.9138 bits (128), Expect = 1.685e-7 Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKI 1092 +P MWCP VI+N K E F + K +F NS +E HV+QC+ GL ES I LK S ++ IM+++ Sbjct: 249 VPSCMWCPTSVIVNGK-ETKFPLPHSTKPM--HFTNSTGLSYEAEHVRQCLLKGLKESPIMRLKDSELLSSIMDEV 321
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Mouse
Match: Dhdh (dihydrodiol dehydrogenase (dimeric) [Source:MGI Symbol;Acc:MGI:1919005]) HSP 1 Score: 52.373 bits (124), Expect = 3.802e-7 Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 1 Query: 871 KNMWCPEEVIIN-EKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILK 1098 + +W P E+++N E+ E + KD YNF N ++E NHV++C+ GL ES + PL S +AEI+E+ K Sbjct: 250 QKLWAPTELVVNGERKEFPPPVLGKD----YNFVNGSCMLYEANHVRECLRKGLKESPVVPLAESELLAEILEEARK 322
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DF30|DHDH_XENTR (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus tropicalis OX=8364 GN=dhdh PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 2.604e-7 Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 IP +MW P +I+N K E F I K NF N +E HV+QC+ GL ES I L S VA IM++ L++ Sbjct: 249 IPSDMWSPTSIIVNGK-ERKFDIPHTTKPM--NFSNGTGMSYEAEHVRQCLLKGLKESPIMSLADSEMVASIMDEALQQ 324
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9DBB8|DHDH_MOUSE (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus OX=10090 GN=Dhdh PE=1 SV=1) HSP 1 Score: 52.373 bits (124), Expect = 2.660e-6 Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 1 Query: 871 KNMWCPEEVIIN-EKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILK 1098 + +W P E+++N E+ E + KD YNF N ++E NHV++C+ GL ES + PL S +AEI+E+ K Sbjct: 250 QKLWAPTELVVNGERKEFPPPVLGKD----YNFVNGSCMLYEANHVRECLRKGLKESPVVPLAESELLAEILEEARK 322
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9TV70|DHDH_RABIT (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=DHDH PE=1 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 4.179e-6 Identity = 24/73 (32.88%), Postives = 43/73 (58.90%), Query Frame = 1 Query: 880 WCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILK 1098 WCP E+++N++ + ++K F N++N +E HV+ C+ GL ES + PL S +A+I+E++ K Sbjct: 248 WCPTELVVNKERKEFPLAPEENKKF--NYRNGMGMSYEAQHVRDCLRKGLKESPVIPLAESQLLADILEEVRK 318
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DKE0|DHDH_XENLA (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus laevis OX=8355 GN=dhdh PE=2 SV=1) HSP 1 Score: 51.2174 bits (121), Expect = 6.510e-6 Identity = 30/79 (37.97%), Postives = 41/79 (51.90%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 IP MW P VI+N K E F + + NF N +E HV+QC+ GL ES I L S +A IM++ L++ Sbjct: 249 IPSFMWSPTSVIVNGK-ETKFDVPHTTEPM--NFSNGTGMSYEAEHVRQCLLKGLKESPIMSLADSEMIATIMDEALEQ 324
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Match: F6XRN3 (Uncharacterized protein OS=Monodelphis domestica OX=13616 PE=4 SV=2) HSP 1 Score: 61.2326 bits (147), Expect = 3.352e-7 Identity = 29/80 (36.25%), Postives = 48/80 (60.00%), Query Frame = 1 Query: 865 IPKNMWCPEEVIIN-EKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 IP MWCP E+++N E+ E F + + T+N+ S ++E HV+QC+ GL ES + PL S +A+I+E+ ++ Sbjct: 113 IPSTMWCPTELLVNGERAE--FPLPAVANTETFNYPKSIGLVYEAQHVRQCLLQGLKESSVMPLAESELLADILEEARRQ 190
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Match: A0A4X2KZT4 (Dihydrodiol dehydrogenase OS=Vombatus ursinus OX=29139 GN=DHDH PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 5.894e-7 Identity = 29/79 (36.71%), Postives = 47/79 (59.49%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 IP MWCP E+++N K + F + + +NF NS ++E HV+QC+ GL ES + PL S +A+I+E+ ++ Sbjct: 253 IPFTMWCPTELVVNGK-SSQFPLPEVADTEMFNFINSIGMVYEAQHVRQCLLQGLKESPVMPLAESELLADILEEARRQ 330
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Match: A0A4X2L4U6 (Dihydrodiol dehydrogenase OS=Vombatus ursinus OX=29139 GN=DHDH PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 5.965e-7 Identity = 29/79 (36.71%), Postives = 47/79 (59.49%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 IP MWCP E+++N K + F + + +NF NS ++E HV+QC+ GL ES + PL S +A+I+E+ ++ Sbjct: 250 IPFTMWCPTELVVNGK-SSQFPLPEVADTEMFNFINSIGMVYEAQHVRQCLLQGLKESPVMPLAESELLADILEEARRQ 327
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Match: A0A087TSH4 (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_01924 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 8.509e-7 Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 +PKNMWCP +I E E ++ D N+ +S +E V++C++ G+LES I PL+ S+++AEIM++I ++ Sbjct: 16 LPKNMWCP---VIVETPEKTYEFPLPDTKAPCNYIHSSGLRYEAIEVRECLKKGVLESSIMPLEDSIKLAEIMDEIRQQ 91
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Sea Lamprey
Match: zgc:101723 (dihydrodiol dehydrogenase (dimeric), like [Source:ZFIN;Acc:ZDB-GENE-040426-2180]) HSP 1 Score: 50.0618 bits (118), Expect = 3.388e-7 Identity = 30/79 (37.97%), Postives = 44/79 (55.70%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 IP MW P +VIIN + E F + S NF S +E V++C+ GL ES + PL+ S +A IM++IL++ Sbjct: 249 IPDTMWSPSKVIINGE-EKEFLL--PPPSIPLNFVTSTGMRYEAAEVRRCLLQGLTESRVMPLEESELLAGIMDEILQQ 324
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Medaka
Match: zgc:101723 (trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [Source:NCBI gene;Acc:101161387]) HSP 1 Score: 48.521 bits (114), Expect = 6.606e-6 Identity = 27/79 (34.18%), Postives = 43/79 (54.43%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 +P+ MWCP +I+N + E F + + S NF N +E V+QC+ GL ES I SL +AE+ ++I ++ Sbjct: 309 VPEKMWCPTSLIVNGE-ERHFPV--PEPSLPLNFPNGTGLRYEAEEVRQCLLKGLKESTIMSHADSLLLAELEDEIRRQ 384
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Medaka
Match: zgc:101723 (trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [Source:NCBI gene;Acc:101170260]) HSP 1 Score: 48.1358 bits (113), Expect = 7.878e-6 Identity = 26/79 (32.91%), Postives = 43/79 (54.43%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 +P MWCP +++N K E + + + S NF NS +E V+QC+ GL ES I SL +AE+ +++ ++ Sbjct: 249 VPYPMWCPTSLVVNGK-ETQYPL--PEPSMPLNFLNSTGMRYEAEEVRQCLLRGLKESAIMSHTDSLLLAEVEDEVRRQ 324
BLAST of GFO_IDH_MocA domain-containing protein vs. Planmine SMEST
Match: SMESG000072407.1 (SMESG000072407.1) HSP 1 Score: 163.696 bits (413), Expect = 4.561e-47 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK Sbjct: 248 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 326
BLAST of GFO_IDH_MocA domain-containing protein vs. Planmine SMEST
Match: SMESG000072408.1 (SMESG000072408.1) HSP 1 Score: 108.227 bits (269), Expect = 1.680e-26 Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 1 Query: 865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKIL 1095 IPK WCPEE IN KL+ FK+ER+ +S Y + NSWYFIHEINHV QCI+NG+LESD+HPLK +LE+A I+E ++ Sbjct: 243 IPKEFWCPEEYSINGKLDKSFKLERRKESVNYIYCNSWYFIHEINHVSQCIKNGMLESDLHPLKNTLEIANILEMLI 319 The following BLAST results are available for this feature:
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 2
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 1
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 4
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 4
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 1
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 2
BLAST of GFO_IDH_MocA domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30029573 ID=SMED30029573|Name=GFO_IDH_MocA domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1150bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|