GFO_IDH_MocA domain-containing protein

Overview
NameGFO_IDH_MocA domain-containing protein
Smed IDSMED30029573
Length (bp)1150
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GFO_IDH_MocA domain-containing protein (SMED30029573) t-SNE clustered cells

Violin plots show distribution of expression levels for GFO_IDH_MocA domain-containing protein (SMED30029573) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GFO_IDH_MocA domain-containing protein (SMED30029573) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GFO_IDH_MocA domain-containing protein (SMED30029573) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029573

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30029573h1SMcG0005585 Contig4428uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30029573h1SMcG0005585 Contig4428newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029573h1SMcG0005585 Contig4428uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029573h1SMcG0005585 Contig4428newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029573h1SMcG0019867 Contig4428uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30029573h1SMcG0019867 Contig4428newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029573h1SMcG0019867 Contig4428uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029573h1SMcG0019867 Contig4428newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30029573h1SMcG0019867 SmedASXL_017460SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30029573h1SMcG0019867 SmedASXL_017461SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30029573h1SMcG0019867 dd_Smed_v4_7643_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Xenopus
Match: dhdh (trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [Source:NCBI gene;Acc:448579])

HSP 1 Score: 55.4546 bits (132), Expect = 4.916e-8
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            IP +MW P  +I+N K E  F I    K    NF N     +E  HV+QC+  GL ES I  L  S  VA IM++ L++
Sbjct:  249 IPSDMWSPTSIIVNGK-ERKFDIPHTTKPM--NFSNGTGMSYEAEHVRQCLLKGLKESPIMSLADSEMVASIMDEALQQ 324          
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Xenopus
Match: dhdh (dihydrodiol dehydrogenase (dimeric) [Source:NCBI gene;Acc:100145807])

HSP 1 Score: 53.9138 bits (128), Expect = 1.685e-7
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKI 1092
            +P  MWCP  VI+N K E  F +    K    +F NS    +E  HV+QC+  GL ES I  LK S  ++ IM+++
Sbjct:  249 VPSCMWCPTSVIVNGK-ETKFPLPHSTKPM--HFTNSTGLSYEAEHVRQCLLKGLKESPIMRLKDSELLSSIMDEV 321          
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Mouse
Match: Dhdh (dihydrodiol dehydrogenase (dimeric) [Source:MGI Symbol;Acc:MGI:1919005])

HSP 1 Score: 52.373 bits (124), Expect = 3.802e-7
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  871 KNMWCPEEVIIN-EKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILK 1098
            + +W P E+++N E+ E    +  KD    YNF N    ++E NHV++C+  GL ES + PL  S  +AEI+E+  K
Sbjct:  250 QKLWAPTELVVNGERKEFPPPVLGKD----YNFVNGSCMLYEANHVRECLRKGLKESPVVPLAESELLAEILEEARK 322          
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DF30|DHDH_XENTR (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus tropicalis OX=8364 GN=dhdh PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.604e-7
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            IP +MW P  +I+N K E  F I    K    NF N     +E  HV+QC+  GL ES I  L  S  VA IM++ L++
Sbjct:  249 IPSDMWSPTSIIVNGK-ERKFDIPHTTKPM--NFSNGTGMSYEAEHVRQCLLKGLKESPIMSLADSEMVASIMDEALQQ 324          
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9DBB8|DHDH_MOUSE (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus OX=10090 GN=Dhdh PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 2.660e-6
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  871 KNMWCPEEVIIN-EKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILK 1098
            + +W P E+++N E+ E    +  KD    YNF N    ++E NHV++C+  GL ES + PL  S  +AEI+E+  K
Sbjct:  250 QKLWAPTELVVNGERKEFPPPVLGKD----YNFVNGSCMLYEANHVRECLRKGLKESPVVPLAESELLAEILEEARK 322          
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9TV70|DHDH_RABIT (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=DHDH PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 4.179e-6
Identity = 24/73 (32.88%), Postives = 43/73 (58.90%), Query Frame = 1
Query:  880 WCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILK 1098
            WCP E+++N++ +       ++K F  N++N     +E  HV+ C+  GL ES + PL  S  +A+I+E++ K
Sbjct:  248 WCPTELVVNKERKEFPLAPEENKKF--NYRNGMGMSYEAQHVRDCLRKGLKESPVIPLAESQLLADILEEVRK 318          
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DKE0|DHDH_XENLA (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus laevis OX=8355 GN=dhdh PE=2 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 6.510e-6
Identity = 30/79 (37.97%), Postives = 41/79 (51.90%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            IP  MW P  VI+N K E  F +    +    NF N     +E  HV+QC+  GL ES I  L  S  +A IM++ L++
Sbjct:  249 IPSFMWSPTSVIVNGK-ETKFDVPHTTEPM--NFSNGTGMSYEAEHVRQCLLKGLKESPIMSLADSEMIATIMDEALEQ 324          
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Match: F6XRN3 (Uncharacterized protein OS=Monodelphis domestica OX=13616 PE=4 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 3.352e-7
Identity = 29/80 (36.25%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  865 IPKNMWCPEEVIIN-EKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            IP  MWCP E+++N E+ E  F +     + T+N+  S   ++E  HV+QC+  GL ES + PL  S  +A+I+E+  ++
Sbjct:  113 IPSTMWCPTELLVNGERAE--FPLPAVANTETFNYPKSIGLVYEAQHVRQCLLQGLKESSVMPLAESELLADILEEARRQ 190          
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Match: A0A4X2KZT4 (Dihydrodiol dehydrogenase OS=Vombatus ursinus OX=29139 GN=DHDH PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 5.894e-7
Identity = 29/79 (36.71%), Postives = 47/79 (59.49%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            IP  MWCP E+++N K  + F +     +  +NF NS   ++E  HV+QC+  GL ES + PL  S  +A+I+E+  ++
Sbjct:  253 IPFTMWCPTELVVNGK-SSQFPLPEVADTEMFNFINSIGMVYEAQHVRQCLLQGLKESPVMPLAESELLADILEEARRQ 330          
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Match: A0A4X2L4U6 (Dihydrodiol dehydrogenase OS=Vombatus ursinus OX=29139 GN=DHDH PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 5.965e-7
Identity = 29/79 (36.71%), Postives = 47/79 (59.49%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            IP  MWCP E+++N K  + F +     +  +NF NS   ++E  HV+QC+  GL ES + PL  S  +A+I+E+  ++
Sbjct:  250 IPFTMWCPTELVVNGK-SSQFPLPEVADTEMFNFINSIGMVYEAQHVRQCLLQGLKESPVMPLAESELLADILEEARRQ 327          
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Match: A0A087TSH4 (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_01924 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 8.509e-7
Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            +PKNMWCP   +I E  E  ++    D     N+ +S    +E   V++C++ G+LES I PL+ S+++AEIM++I ++
Sbjct:   16 LPKNMWCP---VIVETPEKTYEFPLPDTKAPCNYIHSSGLRYEAIEVRECLKKGVLESSIMPLEDSIKLAEIMDEIRQQ 91          
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Sea Lamprey
Match: zgc:101723 (dihydrodiol dehydrogenase (dimeric), like [Source:ZFIN;Acc:ZDB-GENE-040426-2180])

HSP 1 Score: 50.0618 bits (118), Expect = 3.388e-7
Identity = 30/79 (37.97%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            IP  MW P +VIIN + E  F +     S   NF  S    +E   V++C+  GL ES + PL+ S  +A IM++IL++
Sbjct:  249 IPDTMWSPSKVIINGE-EKEFLL--PPPSIPLNFVTSTGMRYEAAEVRRCLLQGLTESRVMPLEESELLAGIMDEILQQ 324          
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Medaka
Match: zgc:101723 (trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [Source:NCBI gene;Acc:101161387])

HSP 1 Score: 48.521 bits (114), Expect = 6.606e-6
Identity = 27/79 (34.18%), Postives = 43/79 (54.43%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            +P+ MWCP  +I+N + E  F +   + S   NF N     +E   V+QC+  GL ES I     SL +AE+ ++I ++
Sbjct:  309 VPEKMWCPTSLIVNGE-ERHFPV--PEPSLPLNFPNGTGLRYEAEEVRQCLLKGLKESTIMSHADSLLLAELEDEIRRQ 384          
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Medaka
Match: zgc:101723 (trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [Source:NCBI gene;Acc:101170260])

HSP 1 Score: 48.1358 bits (113), Expect = 7.878e-6
Identity = 26/79 (32.91%), Postives = 43/79 (54.43%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            +P  MWCP  +++N K E  + +   + S   NF NS    +E   V+QC+  GL ES I     SL +AE+ +++ ++
Sbjct:  249 VPYPMWCPTSLVVNGK-ETQYPL--PEPSMPLNFLNSTGMRYEAEEVRQCLLRGLKESAIMSHTDSLLLAEVEDEVRRQ 324          
BLAST of GFO_IDH_MocA domain-containing protein vs. Planmine SMEST
Match: SMESG000072407.1 (SMESG000072407.1)

HSP 1 Score: 163.696 bits (413), Expect = 4.561e-47
Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 1101
            IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK
Sbjct:  248 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKILKK 326          
BLAST of GFO_IDH_MocA domain-containing protein vs. Planmine SMEST
Match: SMESG000072408.1 (SMESG000072408.1)

HSP 1 Score: 108.227 bits (269), Expect = 1.680e-26
Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 1
Query:  865 IPKNMWCPEEVIINEKLENMFKIERKDKSFTYNFKNSWYFIHEINHVKQCIENGLLESDIHPLKASLEVAEIMEKIL 1095
            IPK  WCPEE  IN KL+  FK+ER+ +S  Y + NSWYFIHEINHV QCI+NG+LESD+HPLK +LE+A I+E ++
Sbjct:  243 IPKEFWCPEEYSINGKLDKSFKLERRKESVNYIYCNSWYFIHEINHVSQCIKNGMLESDLHPLKNTLEIANILEMLI 319          
The following BLAST results are available for this feature:
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dhdh4.916e-840.51trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [S... [more]
dhdh1.685e-739.47dihydrodiol dehydrogenase (dimeric) [Source:NCBI g... [more]
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Dhdh3.802e-737.66dihydrodiol dehydrogenase (dimeric) [Source:MGI Sy... [more]
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6DF30|DHDH_XENTR2.604e-740.51Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS... [more]
sp|Q9DBB8|DHDH_MOUSE2.660e-637.66Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS... [more]
sp|Q9TV70|DHDH_RABIT4.179e-632.88Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (F... [more]
sp|Q6DKE0|DHDH_XENLA6.510e-637.97Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS... [more]
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
F6XRN33.352e-736.25Uncharacterized protein OS=Monodelphis domestica O... [more]
A0A4X2KZT45.894e-736.71Dihydrodiol dehydrogenase OS=Vombatus ursinus OX=2... [more]
A0A4X2L4U65.965e-736.71Dihydrodiol dehydrogenase OS=Vombatus ursinus OX=2... [more]
A0A087TSH48.509e-736.71Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (F... [more]
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1017233.388e-737.97dihydrodiol dehydrogenase (dimeric), like [Source:... [more]
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:1017236.606e-634.18trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [S... [more]
zgc:1017237.878e-632.91trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [S... [more]
back to top
BLAST of GFO_IDH_MocA domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072407.14.561e-47100.00SMESG000072407.1[more]
SMESG000072408.11.680e-2662.34SMESG000072408.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029573 ID=SMED30029573|Name=GFO_IDH_MocA domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1150bp
TTTTTCTACATTTTCAAAAATTTACGGAAACTTATCAACAATTTTTACGA
AAATTTAATAAAAAAGTTTTAAAATTAGTTATTTTTTTAATAAACTAAAT
TATAATTTACATTGCTCTTTCTAACTCTCTTACTCATGGAAATGTGTAAT
GTGATAAAGCGCTTAAAATATCCTCAAATTGCATATTTTTATAATTAAAA
ATTCTCTTAGTAAAAGATTTTGTTTCTTTGTATGTATTTTTAGAGTTATT
TTTTTTTCACCAAGAATATTTTTCTGTTATTCTATAGTAAATTCACTTAA
TTTACGTTAGTGTCTATAATTTTTGTCGTTATTTCAAGTTTGTGTTTTTA
AATAAGTCAATTATTTATTATTGAAAATCTTAATTTCTGGTCTAACTACT
AATAATTTACGATAACTGGTAGAAATAAAGATCAAAATATAACCTGTATT
TTTATTATTATTAAATCTTTAATAGTTTTTGACACGTAATTAATTACGTG
AAAGTTAGTTATTTATTTCTTGTTAAAATCAAATTATTAATAATCACTAA
TTATCAAAATTATTTGTTCTATAATTTTATGTCTCACTCGTGTGACATTT
TTTGTGGTTTTATAGAAAATACACCAACAAGCAATCAACTCAAAATATGT
AAATCATTTTTAATTTCAATGGATATAATGTTAACTTGTGGATCAGACTG
TATTCCATTAATAATACATCGAGCAGTGTATGCATGTTGCTTATAACAGA
TTAAATTTGAAAATATTGTAATCAAATTAAAATAAAGTACTATTAAGTTT
CAAGGTCACACTATAGTTGAAAACTCTTATTAATTCTTAATAAATTTATG
TTCTATTTATATAGATTCCTAAAAATATGTGGTGTCCAGAAGAAGTAATA
ATAAATGAAAAACTTGAAAATATGTTTAAAATCGAACGGAAAGATAAATC
ATTTACTTATAATTTCAAAAATAGTTGGTATTTTATCCATGAAATTAATC
ACGTTAAACAATGCATTGAAAACGGCCTATTGGAGAGTGATATTCACCCC
CTCAAAGCTTCTTTGGAAGTTGCAGAAATCATGGAAAAAATTTTGAAGAA
ATAAAATTAATTCTTTGATTGATGTTTTATTAAATTTAATTTATATTTGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0047115trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity
GO:0047837D-xylose 1-dehydrogenase (NADP+) activity
Vocabulary: biological process
TermDefinition
GO:0042843D-xylose catabolic process
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.360.10coord: 1..75
e-value: 3.8E-10
score: 41.8
NoneNo IPR availablePANTHERPTHR22604:SF105TRANS-1,2-DIHYDROBENZENE-1,2-DIOL DEHYDROGENASEcoord: 1..75
NoneNo IPR availablePANTHERPTHR22604OXIDOREDUCTASEScoord: 1..75