GCR304

Overview
NameGCR304
Smed IDSMED30029570
Length (bp)1521
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR304 (SMED30029570) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR304 (SMED30029570) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR304 (SMED30029570) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR304 (SMED30029570) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029570

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029570SMESG000016325.1 SmedASXL_009691SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30029570SMESG000016325.1 dd_Smed_v4_10325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029570SMESG000016325.1 dd_Smed_v6_10325_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR304 vs. Ensembl Human
Match: GALR2 (galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4133])

HSP 1 Score: 169.088 bits (427), Expect = 5.528e-47
Identity = 122/391 (31.20%), Postives = 197/391 (50.38%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTT----QEQKLSLINCHNQIK-LISEPVEKLILEQTTENSLNLTEDLS 1404
            +V VP+LF LI +VG VGN LV+ V++   Q  +TTN+ I++L VADL FI+ CVPF A +Y   GW  G +LC+   ++ ++T + S +TL  +S+DRYLA+ +P+ S  LR  RN + A+G +W L L+ + P L  S   +     +T C            W++ ++R  D            FV  YL PV+++ + Y   + R L      ++  + A   K++VT+M+++V  +F LCW P   + +   +G+ P       + ++S+ ++Y+NS VNP +YA +S++FR+ F  +  C  L   A G    R      C       SG   +RES+      E   +L  C    +  I EP      +        LT D++
Sbjct:   25 AVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYL--SYYRQSQLANLTVC---------HPAWSAPRRRAMD---------ICTFVFSYLLPVLVLGLTYARTL-RYLWRAVDPVAAGSGARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTI--CAGLLGRAPGRASGR-----VCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQPCILEPCPGPSWQGPKAGDSILTVDVA 387          
BLAST of GCR304 vs. Ensembl Human
Match: SSTR5 (somatostatin receptor 5 [Source:HGNC Symbol;Acc:HGNC:11334])

HSP 1 Score: 150.984 bits (380), Expect = 1.989e-40
Identity = 89/278 (32.01%), Postives = 149/278 (53.60%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRR 1170
            +M+  TNI I++LAVAD+L+++  +PF A       WP G VLC++   +  +  + SV+ L +MS+DRYLAVVHP+ S   R  R   +A    W L L  +LPLL+ +D+ EG            C       W       E   ++G ++     V+ +  P+++I + Y  ++ ++   R++ +        ++++VT+MV+VV+++F  CW P  T+ I+ L    P       ++     L+Y+NS  NP LY FLS+NFR++F  +LC R+
Sbjct:   70 KMKTVTNIYILNLAVADVLYML-GLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEG----------GTCN----ASWP------EPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKV---RAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRK 323          
BLAST of GCR304 vs. Ensembl Human
Match: OPRL1 (opioid related nociceptin receptor 1 [Source:HGNC Symbol;Acc:HGNC:8155])

HSP 1 Score: 142.124 bits (357), Expect = 7.647e-38
Identity = 92/281 (32.74%), Postives = 141/281 (50.18%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLI-NSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLK 1176
            +M+  TNI I +LA+AD L ++  +PF     + G WP G  LC+    + Y   + S +TL  MS+DRY+A+ HPIR++ +R S         +W+L  V  +P+ I  S  +E   DE  +CLV+  T + +               +G ++    F+  ++ PV++ISV Y  +I RL   R    S   D  +  +R+T++V+VV+ +F  CW P+Q   + Q  G  P       I      L Y NS +NP LYAFL ENF+  F    C   L+
Sbjct:    4 KMKTATNIYIFNLALADTL-VLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVE---DEEIECLVEIPTPQDY---------------WGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSGSREKDRNL--RRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALR 263          
BLAST of GCR304 vs. Ensembl Human
Match: OPRL1 (opioid related nociceptin receptor 1 [Source:HGNC Symbol;Acc:HGNC:8155])

HSP 1 Score: 142.124 bits (357), Expect = 7.647e-38
Identity = 92/281 (32.74%), Postives = 141/281 (50.18%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLI-NSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLK 1176
            +M+  TNI I +LA+AD L ++  +PF     + G WP G  LC+    + Y   + S +TL  MS+DRY+A+ HPIR++ +R S         +W+L  V  +P+ I  S  +E   DE  +CLV+  T + +               +G ++    F+  ++ PV++ISV Y  +I RL   R    S   D  +  +R+T++V+VV+ +F  CW P+Q   + Q  G  P       I      L Y NS +NP LYAFL ENF+  F    C   L+
Sbjct:    4 KMKTATNIYIFNLALADTL-VLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVE---DEEIECLVEIPTPQDY---------------WGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSGSREKDRNL--RRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALR 263          
BLAST of GCR304 vs. Ensembl Human
Match: OPRL1 (opioid related nociceptin receptor 1 [Source:HGNC Symbol;Acc:HGNC:8155])

HSP 1 Score: 142.124 bits (357), Expect = 7.647e-38
Identity = 92/281 (32.74%), Postives = 141/281 (50.18%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLI-NSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLK 1176
            +M+  TNI I +LA+AD L ++  +PF     + G WP G  LC+    + Y   + S +TL  MS+DRY+A+ HPIR++ +R S         +W+L  V  +P+ I  S  +E   DE  +CLV+  T + +               +G ++    F+  ++ PV++ISV Y  +I RL   R    S   D  +  +R+T++V+VV+ +F  CW P+Q   + Q  G  P       I      L Y NS +NP LYAFL ENF+  F    C   L+
Sbjct:    4 KMKTATNIYIFNLALADTL-VLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVE---DEEIECLVEIPTPQDY---------------WGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSGSREKDRNL--RRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALR 263          
BLAST of GCR304 vs. Ensembl Celegans
Match: npr-9 (Galanin-like G-protein coupled receptor npr-9 [Source:UniProtKB/Swiss-Prot;Acc:Q23497])

HSP 1 Score: 164.851 bits (416), Expect = 2.571e-45
Identity = 102/297 (34.34%), Postives = 158/297 (53.20%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRL-----------LCGRS-------SKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQ-LYGKDP----GGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLL 1158
            QMRN+TN LII LA++DL+F++ CVPFTAV Y    W      C +  +  + +AYCSV+TL LM++DRYLAVV+P+ SMTLR  RNT+IA+  ++ + + S +P+     I           + D+   K       T    E      + Y+  F V  Y+ P+ I  VLYG ++ +L           + GR+       S I    +A   K++VT++V+ V++ + LCW P+   F +  L   +P     G +   + + S  LAY+NS +NP LYA +S++FR  F  ++
Sbjct:   72 QMRNSTNTLIIGLAISDLMFLLLCVPFTAVDYAAPTWIFPEWTCSMINFFQHTSAYCSVWTLTLMALDRYLAVVYPVESMTLRTPRNTVIALCFIYIIIIASQIPVGRMHGIY----------VYDFIMEKRSTCAILTIATAEATPTMARTYFMTFNVFGYVLPLGISVVLYGLMLRKLWDMPRPGNSQSVGGRNLTNRDSGSSIRRRPEATAAKRKVTRLVLCVLITWALCWLPLNVCFFMSGLAYPEPLVISHGVIMVIVQIASQVLAYTNSCLNPILYALMSQSFREGFIRVM 358          
BLAST of GCR304 vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 109.383 bits (272), Expect = 1.550e-25
Identity = 86/373 (23.06%), Postives = 170/373 (45.58%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFT---AVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSN------DAMVTKKRVTKMVIVVIVIFTLCWAPIQTIF--IIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF----ANLLCC------RRLKSFATGTIRDR---RGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQTTENSL 1383
            ++R  TNILI++LAVADLL  +FC+PF+    ++Y    W  G ++C +  ++  +  + S +TLV++S DR++A++  +        R  +  V   W   ++  LPLL  +   E  +D + +C  ++  +             +  +   K+Y ++  ++ Y+ P  ++ + Y  +  ++   R   + +        D   + K++  MVI++  +F LCW P+  +   I + Y           +   ++ LA S+SMVNP +Y   +  FR  F    + LL C      R L    + + R+R    G+ N   ++    + +TR   S   +++     C +     + P+  +++   + NSL
Sbjct:   80 RLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDDQRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFED-QDGLPNCGENWTYFG------------DSGEQVRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRHESVKKLVPMVILISALFALCWLPLLILINVIPEFYPDINSWGYILYLWWFAHGLAMSHSMVNPIIYFIRNARFREGFCFFSSKLLPCISFKELRLLTDNTSRSFRNRSRFSGVINPTSSDEKPATSLTRYSRSGVLDRQ----TCRSARFFEARPL--VVVRNNSANSL 433          
BLAST of GCR304 vs. Ensembl Celegans
Match: nmur-2 (NMUR (NeuroMedin U Receptor) homolog [Source:UniProtKB/TrEMBL;Acc:O17239])

HSP 1 Score: 106.686 bits (265), Expect = 9.047e-25
Identity = 89/356 (25.00%), Postives = 148/356 (41.57%), Query Frame = 1
Query:  340 MRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWP--LGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNST--------------KKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKR------VTKMVIVVIVIFTLCWAPIQTIFIIQLYG--------KDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHN 1317
            M N TN  + SLAV+D++ +I  +P      +   +P      +C+   ++   T+Y S+  +   S +R+LA+ HP+RS          + +   W++  V  LP+     I + P  E          Y+P+    ST              + R +  K+     +T+FFV+    P I I ++Y  +  +L    SS+I    D MV K+R      V KM++ V++ F +CW P     ++ +Y           P   L   +  IS    YSNS  NP LY  LS+ +R AF   +    + +F       R G +  C ++  A       R S   ++    +  HN
Sbjct:   62 MHNPTNYYLFSLAVSDIIALILGLPMEFYQSLDYSYPYRFSEGICKARAFLIEFTSYASIMIICCFSFERWLAICHPLRSKIFSTLWRANVLIILAWTISFVCALPIAFIVQINKLPLPEDAK-------YQPWTNKVSTDGIFVLHTEFCAMNQSRPDQQKMIIIFAFTVFFVI----PAIAIVIMYAHIAVQL---ESSEIDLKGDKMVKKRRNKSNRTVLKMLLSVVITFFICWLPFHIQRLLSVYTTWSETTTISPPVQFLSMIVFYISGFCYYSNSAANPILYNILSQKYRSAFCRTILGDHIANFVFKG-HQRPGQSKRCSSSTEAEQRTLMTRGSVRVDKPHRKLEVHN 402          
BLAST of GCR304 vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 105.916 bits (263), Expect = 2.087e-24
Identity = 76/309 (24.60%), Postives = 144/309 (46.60%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFT---AVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSN------DAMVTKKRVTKMVIVVIVIFTLCWAPIQTIF--IIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF----ANLLCC---RRLKSFATGTIRDRR 1209
            ++R  TNILI++LAVADLL  +FC+PF+    ++Y    W  G ++C +  ++  +  + S +TLV++S DR++A++  +        R  +  V   W   ++  LPLL  +   E  +D + +C  ++  +             +  +   K+Y ++  ++ Y+ P  ++ + Y  +  ++   R   + +        D   + K++  MVI++  +F LCW P+  +   I + Y           +   ++ LA S+SMVNP +Y   +  FR  F    + LL C   + L+     T R  R
Sbjct:   80 RLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDDQRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFED-QDGLPNCGENWTYFG------------DSGEQVRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRHESVKKLVPMVILISALFALCWLPLLILINVIPEFYPDINSWGYILYLWWFAHGLAMSHSMVNPIIYFIRNARFREGFCFFSSKLLPCISFKELRLLTDNTSRRHR 375          
BLAST of GCR304 vs. Ensembl Celegans
Match: npr-34 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EDR6])

HSP 1 Score: 105.145 bits (261), Expect = 8.931e-24
Identity = 86/352 (24.43%), Postives = 148/352 (42.05%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDI-----IEGPRDEITDCLVDYCTYK---PFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYG---FLIYRLLCGR------------------------------------------SSKISHSND--AMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYG---KDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATG--TIRDRRG 1212
            +MRN TNI + SL+ ADL  I FCVP   + Y++  W +GR  C    Y+   T +CSV T+ ++S +R+LA+ +P+R++   +       +  +W    V  +P  +  D      + G R       V +C  +    F+ +  T           K Y     ++  ++PV+ +S+ Y     ++Y+    R                                           S  +H N+  A   KK++ +M+I ++ ++T+CW P     ++  +G   +       + + +  N L Y  S +NP LYAF+S+NFR  F       R+KS   G   +R R G
Sbjct:  102 RMRNVTNIFLASLSTADLCLIWFCVPIMFMKYMSHTWSMGRFACYSVHYIQQFTCFCSVLTMTMISFERFLAIAYPMRNIWFSSIGRAKKVILLIWMSSAVLAVPTAVRMDYETNLSLSGQR-------VHWCRRRFPAQFLGYPRTS--------LNKAYAMYQLLLLIIFPVLTMSICYARVSAIVYKSSKDRVILSQAMVAFSKAATDAVTFSGYSAIPMITTSRNLKTANTTIKSYSNHRNNRVAEANKKQIVQMLISIVCMYTVCWLPTIVDELLTSFGYICRTSNTQTLKHMRMGFNALTYCQSCINPILYAFISQNFRSTFKTAYS--RMKSRLQGVEEMRSRMG 436          
BLAST of GCR304 vs. Ensembl Fly
Match: AstA-R1 (gene:FBgn0266429 transcript:FBtr0333798)

HSP 1 Score: 193.741 bits (491), Expect = 2.124e-56
Identity = 126/311 (40.51%), Postives = 192/311 (61.74%), Query Frame = 1
Query:  241 LTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSD--IIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTL-FFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
            + S  VP+ FG+I   G +GN LVI+V++AN QMR+TTN+LII+LAV+D+LF+IFCVPFTA  YV   WP G V C+  QYM  +T +CSVYTLVLMS DR+LAVVHP+ SM+LR  RN  +A+   W   + + +P+ ++    I +   +  T C+                    +++++  + + + FF+  Y+ P+ +I  LY  ++ RL    +     S ++   K+RVT+MV+VV++ F +CW PI  I +++      G +L   I +IS+ +AY+NS +NP LYAFLS+NFR+AF  ++ C
Sbjct:   72 IVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFS-----------------TEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLW-KSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364          
BLAST of GCR304 vs. Ensembl Fly
Match: AstA-R1 (gene:FBgn0266429 transcript:FBtr0070575)

HSP 1 Score: 193.741 bits (491), Expect = 2.124e-56
Identity = 126/311 (40.51%), Postives = 192/311 (61.74%), Query Frame = 1
Query:  241 LTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSD--IIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTL-FFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
            + S  VP+ FG+I   G +GN LVI+V++AN QMR+TTN+LII+LAV+D+LF+IFCVPFTA  YV   WP G V C+  QYM  +T +CSVYTLVLMS DR+LAVVHP+ SM+LR  RN  +A+   W   + + +P+ ++    I +   +  T C+                    +++++  + + + FF+  Y+ P+ +I  LY  ++ RL    +     S ++   K+RVT+MV+VV++ F +CW PI  I +++      G +L   I +IS+ +AY+NS +NP LYAFLS+NFR+AF  ++ C
Sbjct:   72 IVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFS-----------------TEEEIWSLVGFQVSFFLSSYVAPLTLICFLYMGMLARLW-KSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364          
BLAST of GCR304 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0308641)

HSP 1 Score: 186.422 bits (472), Expect = 4.273e-54
Identity = 115/285 (40.35%), Postives = 170/285 (59.65%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFR-TIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFAT 1188
             MR+TTN++I++LA ADL+F+I C+PFTA  Y+   WP GR  C+  QY+  +TA+ S+YTLVLMSIDR+LAVVHPIRS  +R    T+IA+ T+W + LV ++P+    D++    D   +     CT+              +D +  + Y   FF+  YL P++IIS LY  +I R L  + + +  S ++   +KRVT++V+VV++ F   W P+Q I +++         L +  I V +  LAYS+S +NP LYAFLSENFR+AF   L   RL  + T
Sbjct:   68 NMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVD-YDAKKNITYGMCTFT------------TNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMR-LWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKGLQSNRLGMWTT 338          
BLAST of GCR304 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0085316)

HSP 1 Score: 184.496 bits (467), Expect = 2.935e-53
Identity = 112/277 (40.43%), Postives = 167/277 (60.29%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFR-TIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
             MR+TTN++I++LA ADL+F+I C+PFTA  Y+   WP GR  C+  QY+  +TA+ S+YTLVLMSIDR+LAVVHPIRS  +R    T+IA+ T+W + LV ++P+    D++    D   +     CT+              +D +  + Y   FF+  YL P++IIS LY  +I R L  + + +  S ++   +KRVT++V+VV++ F   W P+Q I +++         L +  I V +  LAYS+S +NP LYAFLSENFR+AF   + C
Sbjct:   68 NMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVD-YDAKKNITYGMCTFT------------TNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMR-LWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNC 330          
BLAST of GCR304 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0336790)

HSP 1 Score: 184.496 bits (467), Expect = 2.935e-53
Identity = 112/277 (40.43%), Postives = 167/277 (60.29%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFR-TIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
             MR+TTN++I++LA ADL+F+I C+PFTA  Y+   WP GR  C+  QY+  +TA+ S+YTLVLMSIDR+LAVVHPIRS  +R    T+IA+ T+W + LV ++P+    D++    D   +     CT+              +D +  + Y   FF+  YL P++IIS LY  +I R L  + + +  S ++   +KRVT++V+VV++ F   W P+Q I +++         L +  I V +  LAYS+S +NP LYAFLSENFR+AF   + C
Sbjct:   68 NMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVD-YDAKKNITYGMCTFT------------TNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMR-LWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNC 330          
BLAST of GCR304 vs. Ensembl Zebrafish
Match: galr2b (galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-131121-48])

HSP 1 Score: 172.555 bits (436), Expect = 1.668e-48
Identity = 102/335 (30.45%), Postives = 171/335 (51.04%), Query Frame = 1
Query:  346 NTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEK 1350
            NTTN+ I++L+VAD  FIIFCVPF A +Y   GW  G  +C++  +   +T Y S +TL  +S+DRYLA+ +P+RS  LR   N ++A+  +W L LV   P L   D+I+     +  C+           W    ++  D         T  FV  Y+ PV+I+S+ Y   I + L      +   +++   K++VTKM+I+V V+F +CW P   + +  LYG  P         ++S+C+AY+NS +NP +YA +S++FR+ F  +  C   K       R++  + N   T     +G T   +   +  +       N+ ++++ P+ +
Sbjct:   60 NTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYLSYYDLIDFENSNV--CVPG---------WEEHNRKVLD---------TCTFVFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSCILSKKG-----RNKVHVVNVANTVPGFEAGSTEVSQMNEENAR------QNESEMVNRPLAQ 362          
BLAST of GCR304 vs. Ensembl Zebrafish
Match: galr2b (galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-131121-48])

HSP 1 Score: 172.555 bits (436), Expect = 1.668e-48
Identity = 102/335 (30.45%), Postives = 171/335 (51.04%), Query Frame = 1
Query:  346 NTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEK 1350
            NTTN+ I++L+VAD  FIIFCVPF A +Y   GW  G  +C++  +   +T Y S +TL  +S+DRYLA+ +P+RS  LR   N ++A+  +W L LV   P L   D+I+     +  C+           W    ++  D         T  FV  Y+ PV+I+S+ Y   I + L      +   +++   K++VTKM+I+V V+F +CW P   + +  LYG  P         ++S+C+AY+NS +NP +YA +S++FR+ F  +  C   K       R++  + N   T     +G T   +   +  +       N+ ++++ P+ +
Sbjct:   60 NTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYLSYYDLIDFENSNV--CVPG---------WEEHNRKVLD---------TCTFVFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSCILSKKG-----RNKVHVVNVANTVPGFEAGSTEVSQMNEENAR------QNESEMVNRPLAQ 362          
BLAST of GCR304 vs. Ensembl Zebrafish
Match: galr1b (galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-140624-1])

HSP 1 Score: 166.392 bits (420), Expect = 1.970e-46
Identity = 104/309 (33.66%), Postives = 168/309 (54.37%), Query Frame = 1
Query:  250 VAVPILFGLI--MXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISH-SNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCR 1167
            V VP++FG I  + +     ++V++  I + + R+TTNI I++L++ADL F++FCVPF A +Y    W  G  LC+   Y   ++   S++TLV MS+DRY+AVV   +S  +RN RN +I V  +W L  +  +P+  +  + + P+   +     +C       W    +R     V    Y     V+ YL P+++I+  Y  ++Y L      KI + S  +  +K++  + V++V+  F +CW P   I +   +G+ P  +      +IS+CLAY NS VNP LYAFLSENFR+A   +  CR
Sbjct:   34 VIVPVIFGCIFFLGIIGNTLVMVVIGKIKSRRSRSTTNIFILNLSIADLSFLLFCVPFQATIYSLPEWIFGAFLCKFVHYFVMVSMLVSIFTLVAMSVDRYIAVVLSKKSPCIRNRRNALIGVCVIWMLSFIFAVPVAQHQILTDHPKAPNS----TFC-------WEIWTER-----VAKHTYKVTILVIGYLLPLLLITCCYAKVLYHL----HKKIKNMSKKSERSKRKTAQTVLLVVAAFLICWMPHHIIAMWVEFGQFPLNDASFAFRIISHCLAYGNSCVNPILYAFLSENFRKACKQVFTCR 322          
BLAST of GCR304 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 155.992 bits (393), Expect = 1.848e-42
Identity = 103/307 (33.55%), Postives = 169/307 (55.05%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMR-NTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
            SV + ++F +I +VG VGN LV+ V+I N QM   +TN+ I++L +ADL FI+FCVP  A +Y    W  G  +C+   ++ Y+T Y S++TL  +S+DRYLA+ +P+RS   R  RN + ++  VW+L L  + P L  S   +   D  T C+           W+   ++  D            F+  YL PV+I+ + Y   I R L      +   +++   K++VTKM+I+V V+F LCW P   + +   +G  P  +    + ++S+ +AY+NS +NP +YA +S++FR+ F  +  C
Sbjct:   18 SVIISLIFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYL--SYYQQMDLDGTTVCIP---------AWSVHHRQAMD---------ICTFIFGYLIPVLILGITYARTI-RYLWTSVDPMQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTYVLRILSHLVAYANSCLNPIVYALVSKHFRKGFKKVFGC 303          
BLAST of GCR304 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 155.992 bits (393), Expect = 1.848e-42
Identity = 103/307 (33.55%), Postives = 169/307 (55.05%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMR-NTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
            SV + ++F +I +VG VGN LV+ V+I N QM   +TN+ I++L +ADL FI+FCVP  A +Y    W  G  +C+   ++ Y+T Y S++TL  +S+DRYLA+ +P+RS   R  RN + ++  VW+L L  + P L  S   +   D  T C+           W+   ++  D            F+  YL PV+I+ + Y   I R L      +   +++   K++VTKM+I+V V+F LCW P   + +   +G  P  +    + ++S+ +AY+NS +NP +YA +S++FR+ F  +  C
Sbjct:   18 SVIISLIFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYL--SYYQQMDLDGTTVCIP---------AWSVHHRQAMD---------ICTFIFGYLIPVLILGITYARTI-RYLWTSVDPMQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTYVLRILSHLVAYANSCLNPIVYALVSKHFRKGFKKVFGC 303          
BLAST of GCR304 vs. Ensembl Xenopus
Match: GALR2 (galanin receptor 2 [Source:NCBI gene;Acc:100486593])

HSP 1 Score: 176.022 bits (445), Expect = 1.024e-49
Identity = 115/318 (36.16%), Postives = 177/318 (55.66%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIR 1200
            SV +P+L+ LI +VG VGN LV+ V++ N ++ NTTN+ I++L VADL FIIFCVPF A +Y    W  G  +C+   +  Y+T Y S +TL  +S+DRYLA+ +P+RS  LR  +N ++A+  +WSL LV + P L  S   E     +T C        P   W  + +R  D   F            Y+ PV+I+S+ Y   I R L      I   +++   K+RVT+M+I+V V+F LCW P   + +   +G  P  N    + ++S+ ++Y+NS VNP +YA +S++FR+ F  +  C  L+  A   + 
Sbjct:   17 SVLIPVLYSLIFLVGTVGNSLVLAVLLRNGKVNNTTNLFILNLGVADLCFIIFCVPFQATIYTLDSWVFGPFMCKAVHFFIYLTMYASSFTLTTVSLDRYLAIRYPLRSRELRTPKNALLAITLIWSLSLVFSGPYL--SYYQEFQLSNLTVC-------HPV--WQDSYRRAMDLCTFA---------FSYVIPVLILSLTYARTI-RYLWTAVDPIEDMSESKRAKRRVTRMIIIVAVLFCLCWLPHHLVILCVWFGYFPLNNFTYALRILSHLVSYANSCVNPVVYALVSKHFRKGFRKIFRCLLLRQRAANKVH 313          
BLAST of GCR304 vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 171.014 bits (432), Expect = 8.178e-48
Identity = 109/308 (35.39%), Postives = 173/308 (56.17%), Query Frame = 1
Query:  244 TSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQ-MRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
             S+ VP++F LI ++G VGN LV+ V++ + Q   NTTN+ I++L+VAD+ FIIFCVPF A +Y    W  G  +C+   +  Y+T Y S +TL  +S+DRYLA+ +P+RS  LR   N I  +  +W L +V   P L   D+++     I  C+  +            K+R        KI  T  F++ Y+ PV+I+S+ Y   I + L      +   +++   K++VTKM+I+V V+F LCW P   + +  LYG  P         ++S+C+AY+NS +NP +YA +S++FR+ F  +  C
Sbjct:   25 ASIVVPVIFSLIFLLGTVGNSLVLAVLLRSGQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVFGAFMCKAVHFFIYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAIATMAIIWGLSVVFAGPYLSYYDLMDYESSHI--CMPGW------------KERTR------KIMDTGTFIVGYVIPVLIVSLSYTRTI-KYLWTAVDPLEDMSESKKAKRKVTKMIIIVTVLFCLCWLPHHVVVMCYLYGDFPFNQATYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFQKVFSC 311          
BLAST of GCR304 vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 170.629 bits (431), Expect = 1.941e-47
Identity = 109/308 (35.39%), Postives = 173/308 (56.17%), Query Frame = 1
Query:  244 TSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQ-MRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
             S+ VP++F LI ++G VGN LV+ V++ + Q   NTTN+ I++L+VAD+ FIIFCVPF A +Y    W  G  +C+   +  Y+T Y S +TL  +S+DRYLA+ +P+RS  LR   N I  +  +W L +V   P L   D+++     I  C+  +            K+R        KI  T  F++ Y+ PV+I+S+ Y   I + L      +   +++   K++VTKM+I+V V+F LCW P   + +  LYG  P         ++S+C+AY+NS +NP +YA +S++FR+ F  +  C
Sbjct:   48 ASIVVPVIFSLIFLLGTVGNSLVLAVLLRSGQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVFGAFMCKAVHFFIYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAIATMAIIWGLSVVFAGPYLSYYDLMDYESSHI--CMPGW------------KERTR------KIMDTGTFIVGYVIPVLIVSLSYTRTI-KYLWTAVDPLEDMSESKKAKRKVTKMIIIVTVLFCLCWLPHHVVVMCYLYGDFPFNQATYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFQKVFSC 334          
BLAST of GCR304 vs. Ensembl Xenopus
Match: ENSXETT00000041298.1 (galanin receptor 3 [Source:NCBI gene;Acc:100488248])

HSP 1 Score: 169.474 bits (428), Expect = 2.379e-47
Identity = 104/307 (33.88%), Postives = 171/307 (55.70%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMR-NTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
             + VP++F LI  +G VGN LV+ V++ N Q + NTTN+ I++L VADL FI+ CVPF A +Y   GW  G  LC+   +  Y++ Y S +TL  +S+DRYLA+ +P++S  LR SRN + A+G +W+L ++   P L    II    +++  C+ +         W   +++  D            FV  YL PV+I+ + Y   I   L      +  ++++   K +VTKM+I+V V+F +CW P   + +   +G  P         ++S+C++Y+NS +NP +YA +S++FR+ F  +  C
Sbjct:   17 GIIVPVVFSLIFALGTVGNGLVLAVLLRNGQTKYNTTNLFILNLGVADLCFILLCVPFQATIYTLDGWLFGAFLCKAVHFSIYLSMYASSFTLAAVSVDRYLAIRYPLKSRDLRTSRNALAAIGVIWALSILFAGPYLSYYHIIL--YNQVPICIPN---------WEDRRRKIMDVST---------FVFGYLLPVLILGLSYARTIC-FLWTSVDPVKTASESRKAKHKVTKMIIIVAVLFCICWLPHHLVILCFWFGHFPFNKATYAFRLVSHCMSYANSCLNPIVYALISKHFRKRFKQVFTC 302          
BLAST of GCR304 vs. Ensembl Xenopus
Match: kiss1r (KISS1 receptor [Source:NCBI gene;Acc:100316929])

HSP 1 Score: 149.443 bits (376), Expect = 7.738e-40
Identity = 97/312 (31.09%), Postives = 166/312 (53.21%), Query Frame = 1
Query:  256 VPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSR-NTIIAVGTVWSLFLVSNLPLLINSDIIE----GPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVT---------KKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFR-TIHVISNCLAYSNSMVNPFLYAFLSENFRRAF 1146
            VP+ F ++M+VG  GN LVI VI  + QMR  TN  I +LA  D++F++ CVPFTA +Y   GW  G  +C+   Y+  ++   +  TL  MS+DR+   V+P++S+  R  R    ++VG +W    + ++P+ I + +IE    GP+   ++        K F+ +N                    F++ YL P+I I + Y  ++Y++  GR S     N   V          + ++++MV V++++FT+CW PIQ   + Q +      + +   + + +NC++Y+NS +NP +YAF+  NFR+AF
Sbjct:   45 VPLFFAMLMLVGLTGNSLVIYVISKHKQMRTVTNFYIANLAATDIIFLVSCVPFTAALYPLPGWIFGEFMCKFVNYIQQVSVQATCVTLTAMSVDRWYVTVYPLQSLRQRTPRVAAAVSVG-IWIGSFIVSIPVPIYNQLIEGYWFGPQIYCSESFPSVSHEKAFILYN--------------------FLVVYLLPLITICICYSAMVYQM--GRPSVEPVDNSYQVQLLAERSELMRTKISRMVAVIVLLFTICWGPIQLYILFQAFSPSFKRDYYTYKVKIWANCMSYTNSSINPIVYAFMGANFRKAF 333          
BLAST of GCR304 vs. Ensembl Mouse
Match: Galr2 (galanin receptor 2 [Source:MGI Symbol;Acc:MGI:1337018])

HSP 1 Score: 164.851 bits (416), Expect = 1.203e-45
Identity = 108/322 (33.54%), Postives = 180/322 (55.90%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRS-SKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF----ANLLCCRRLKSFATGTI 1197
            +V VP+ F LI +VG VGN LV+ V++   Q  +TTN+ I++L VADL FI+ CVPF A +Y    W  G +LC+   ++ ++T + S +TL  +S+DRYLA+ +P+ S  LR  RN + A+G +W L L+ + P L  S   +     +T C            W++ ++R  D            FV  YL PV+++S+ Y   ++ L   R+   ++  + +   K++VT+M+++V V+F LCW P   + +   +G+ P       + ++S+ ++Y+NS VNP +YA +S++FR+ F    A LL  RR    A+G +
Sbjct:   24 AVLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYL--SYYSQSQLANLTVC---------HPAWSAPRRRAMD---------LCTFVFSYLLPVLVLSLTYARTLHYLW--RTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLL--RRAPRRASGRV 321          
BLAST of GCR304 vs. Ensembl Mouse
Match: Oprl1 (opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:97440])

HSP 1 Score: 145.591 bits (366), Expect = 1.064e-38
Identity = 100/311 (32.15%), Postives = 152/311 (48.87%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLI-NSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDR-RGITNECGTNVLATSGVTR 1263
            +M+  TNI I +LA+AD L ++  +PF     + G WP G  LC+    + Y   + S +TL  MS+DRY+A+ HPIR++ +R S         +W+L  V  +P+ I  S  +E   DE  +CLV+    + +               +G ++    F+  ++ PV+IISV Y  +I RL   R   +S S +     +R+T++V+VV+ +F  CW P+Q   ++Q  G  PG      I      L Y NS +NP LYAFL ENF+  F    C   L       + DR R I  + G     +  V R
Sbjct:   64 KMKTATNIYIFNLALADTL-VLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVE---DEEIECLVEIPAPQDY---------------WGPVFAICIFLFSFIIPVLIISVCYSLMIRRLRGVR--LLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHR--EMQVSDRVRSIAKDVGLGCKTSETVPR 351          
BLAST of GCR304 vs. Ensembl Mouse
Match: Oprl1 (opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:97440])

HSP 1 Score: 145.591 bits (366), Expect = 2.632e-38
Identity = 100/312 (32.05%), Postives = 152/312 (48.72%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLI-NSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDR-RGITNECGTNVLATSGVTRK 1266
            +M+  TNI I +LA+AD L ++  +PF     + G WP G  LC+    + Y   + S +TL  MS+DRY+A+ HPIR++ +R S         +W+L  V  +P+ I  S  +E   DE  +CLV+    + +               +G ++    F+  ++ PV+IISV Y  +I RL   R   +S S +     +R+T++V+VV+ +F  CW P+Q   ++Q  G  PG      I      L Y NS +NP LYAFL ENF+  F    C   L       + DR R I  + G     +  V R 
Sbjct:   78 KMKTATNIYIFNLALADTL-VLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVE---DEEIECLVEIPAPQDY---------------WGPVFAICIFLFSFIIPVLIISVCYSLMIRRLRGVR--LLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHR--EMQVSDRVRSIAKDVGLGCKTSETVPRP 366          
BLAST of GCR304 vs. Ensembl Mouse
Match: Oprl1 (opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:97440])

HSP 1 Score: 144.436 bits (363), Expect = 3.277e-38
Identity = 100/311 (32.15%), Postives = 151/311 (48.55%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLI-NSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDR-RGITNECGTNVLATSGVTR 1263
            +M+  TNI I +LA+AD L ++  +PF     + G WP G  LC+    + Y   + S +TL  MS+DRY+A+ HPIR++ +R S         +W+L  V  +P+ I  S  +E   DE  +CLV+    + +               +G ++    F+  ++ PV+IISV Y  +I RL   R    S   D  +  +R+T++V+VV+ +F  CW P+Q   ++Q  G  PG      I      L Y NS +NP LYAFL ENF+  F    C   L       + DR R I  + G     +  V R
Sbjct:   78 KMKTATNIYIFNLALADTL-VLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVE---DEEIECLVEIPAPQDY---------------WGPVFAICIFLFSFIIPVLIISVCYSLMIRRLRGVRLLSGSREKDRNL--RRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHR--EMQVSDRVRSIAKDVGLGCKTSETVPR 365          
BLAST of GCR304 vs. Ensembl Mouse
Match: Oprl1 (opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:97440])

HSP 1 Score: 144.436 bits (363), Expect = 3.277e-38
Identity = 100/311 (32.15%), Postives = 151/311 (48.55%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLI-NSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDR-RGITNECGTNVLATSGVTR 1263
            +M+  TNI I +LA+AD L ++  +PF     + G WP G  LC+    + Y   + S +TL  MS+DRY+A+ HPIR++ +R S         +W+L  V  +P+ I  S  +E   DE  +CLV+    + +               +G ++    F+  ++ PV+IISV Y  +I RL   R    S   D  +  +R+T++V+VV+ +F  CW P+Q   ++Q  G  PG      I      L Y NS +NP LYAFL ENF+  F    C   L       + DR R I  + G     +  V R
Sbjct:   78 KMKTATNIYIFNLALADTL-VLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVE---DEEIECLVEIPAPQDY---------------WGPVFAICIFLFSFIIPVLIISVCYSLMIRRLRGVRLLSGSREKDRNL--RRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHR--EMQVSDRVRSIAKDVGLGCKTSETVPR 365          
BLAST of GCR304 vs. UniProt/SwissProt
Match: sp|Q8WPA2|AR_BOMMO (Allatostatin-A receptor OS=Bombyx mori OX=7091 GN=AR PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.189e-61
Identity = 141/328 (42.99%), Postives = 202/328 (61.59%), Query Frame = 1
Query:  205 CMKTTTMDYMKILTSVA---VPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTL-FFVMFYLWPVIIISVLYGFLIYRLL----CGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
            C  TT  +  ++L  V    VPI FG I +VG VGN LV++V+ AN  MR+TTN+LII+LAVADLLF+IFCVPFTA  YV   WP G   C++ QY   +TA+ SVYTLVLMS+DR++AVVHPI SM++R  +N ++A+  +W + L + +P+     I  G R+           Y  F + N +   + +++ + K+ + + FF+  Y+ P+ +ISVLY  ++ RL      GR S  S        +K+VT+MV+VV+V+F +CW PIQ I +++   K        T  ++S+ LAY NS VNP LYAFLSENFR AF  ++ C
Sbjct:   25 CNYTTDFENGELLEKVVSRVVPIFFGFIGIVGLVGNALVVLVVAANPGMRSTTNLLIINLAVADLLFVIFCVPFTATDYVMPRWPFGDWWCKVVQYFIVVTAHASVYTLVLMSLDRFMAVVHPIASMSIRTEKNALLAIACIWVVILTTAIPV----GICHGERE-----------YSYFNR-NHSSCVFLEERGYSKLGFQMSFFLSSYVIPLALISVLYMCMLTRLWKSAPGGRVSAESRRG-----RKKVTRMVVVVVVVFAVCWCPIQIILLVKALNKYHITYFTVTAQIVSHVLAYMNSCVNPVLYAFLSENFRVAFRKVMYC 331          
BLAST of GCR304 vs. UniProt/SwissProt
Match: sp|E7F7V7|GAL2B_DANRE (Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr2b PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.259e-47
Identity = 102/335 (30.45%), Postives = 171/335 (51.04%), Query Frame = 1
Query:  346 NTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEK 1350
            NTTN+ I++L+VAD  FIIFCVPF A +Y   GW  G  +C++  +   +T Y S +TL  +S+DRYLA+ +P+RS  LR   N ++A+  +W L LV   P L   D+I+     +  C+           W    ++  D         T  FV  Y+ PV+I+S+ Y   I + L      +   +++   K++VTKM+I+V V+F +CW P   + +  LYG  P         ++S+C+AY+NS +NP +YA +S++FR+ F  +  C   K       R++  + N   T     +G T   +   +  +       N+ ++++ P+ +
Sbjct:   60 NTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYLSYYDLIDFENSNV--CVPG---------WEEHNRKVLD---------TCTFVFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSCILSKKG-----RNKVHVVNVANTVPGFEAGSTEVSQMNEENAR------QNESEMVNRPLAQ 362          
BLAST of GCR304 vs. UniProt/SwissProt
Match: sp|O43603|GALR2_HUMAN (Galanin receptor type 2 OS=Homo sapiens OX=9606 GN=GALR2 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.654e-46
Identity = 122/391 (31.20%), Postives = 197/391 (50.38%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTT----QEQKLSLINCHNQIK-LISEPVEKLILEQTTENSLNLTEDLS 1404
            +V VP+LF LI +VG VGN LV+ V++   Q  +TTN+ I++L VADL FI+ CVPF A +Y   GW  G +LC+   ++ ++T + S +TL  +S+DRYLA+ +P+ S  LR  RN + A+G +W L L+ + P L  S   +     +T C            W++ ++R  D            FV  YL PV+++ + Y   + R L      ++  + A   K++VT+M+++V  +F LCW P   + +   +G+ P       + ++S+ ++Y+NS VNP +YA +S++FR+ F  +  C  L   A G    R      C       SG   +RES+      E   +L  C    +  I EP      +        LT D++
Sbjct:   25 AVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYL--SYYRQSQLANLTVC---------HPAWSAPRRRAMD---------ICTFVFSYLLPVLVLGLTYARTL-RYLWRAVDPVAAGSGARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTI--CAGLLGRAPGRASGR-----VCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQPCILEPCPGPSWQGPKAGDSILTVDVA 387          
BLAST of GCR304 vs. UniProt/SwissProt
Match: sp|O88854|GALR2_MOUSE (Galanin receptor type 2 OS=Mus musculus OX=10090 GN=Galr2 PE=2 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 8.413e-45
Identity = 108/322 (33.54%), Postives = 180/322 (55.90%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRS-SKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF----ANLLCCRRLKSFATGTI 1197
            +V VP+ F LI +VG VGN LV+ V++   Q  +TTN+ I++L VADL FI+ CVPF A +Y    W  G +LC+   ++ ++T + S +TL  +S+DRYLA+ +P+ S  LR  RN + A+G +W L L+ + P L  S   +     +T C            W++ ++R  D            FV  YL PV+++S+ Y   ++ L   R+   ++  + +   K++VT+M+++V V+F LCW P   + +   +G+ P       + ++S+ ++Y+NS VNP +YA +S++FR+ F    A LL  RR    A+G +
Sbjct:   24 AVLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYL--SYYSQSQLANLTVC---------HPAWSAPRRRAMD---------LCTFVFSYLLPVLVLSLTYARTLHYLW--RTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLL--RRAPRRASGRV 321          
BLAST of GCR304 vs. UniProt/SwissProt
Match: sp|O08726|GALR2_RAT (Galanin receptor type 2 OS=Rattus norvegicus OX=10116 GN=Galr2 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.921e-44
Identity = 102/300 (34.00%), Postives = 169/300 (56.33%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF 1146
            +V VP+ F LI +VG VGN LV+ V++   Q  +TTN+ I++L VADL FI+ CVPF A +Y    W  G +LC+   ++ ++T + S +TL  +S+DRYLA+ +P+ S  LR  RN + A+G +W L L+ + P L  S   +     +T C            W++ ++R  D            FV  YL PV+++S+ Y   + R L      ++  + +   K++VT+M+I+V V+F LCW P   + +   +G+ P       + ++S+ ++Y+NS VNP +YA +S++FR+ F
Sbjct:   25 AVLVPLFFALIFLVGTVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYL--SYYRQSQLANLTVC---------HPAWSAPRRRAMD---------LCTFVFSYLLPVLVLSLTYARTL-RYLWRTVDPVTAGSGSQRAKRKVTRMIIIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGF 303          
BLAST of GCR304 vs. TrEMBL
Match: A0A193KUR9 (GCR304 OS=Schmidtea mediterranea OX=79327 GN=gcr304 PE=2 SV=1)

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 448/448 (100.00%), Postives = 448/448 (100.00%), Query Frame = 1
Query:  139 MMVLFEPLNNPILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQTTENSLNLTEDLSSKTDLSEMDKNGKFETFVLLETHITD 1482
            MMVLFEPLNNPILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMVVGFVGNLLVIVVIIANIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQTTENSLNLTEDLSSKTDLSEMDKNGKFETFVLLETHITD
Sbjct:    1 MMVLFEPLNNPILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMVVGFVGNLLVIVVIIANIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQTTENSLNLTEDLSSKTDLSEMDKNGKFETFVLLETHITD 448          
BLAST of GCR304 vs. TrEMBL
Match: A0A193KUP0 (GCR064 OS=Schmidtea mediterranea OX=79327 GN=gcr064 PE=2 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 1.424e-119
Identity = 210/412 (50.97%), Postives = 282/412 (68.45%), Query Frame = 1
Query:  172 ILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKS---FATGTIRDRRGITN----------ECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQT 1368
            I N T L    C  +T   Y  +LTS+ VPILFGLI+++G  GN++V+VVII N +MRN+TNILI SLA+ADL FI FC+PFT V+YV  GWPLG   C+IYQ++ Y+TAYCSVYTLVLM  DR+LAVVHPI S  +R+ RNT + V  +W LF  +NLPLL+NS +I+G ++   +C+V YC+Y P ++WN T  +Y  D  FGK ++T FF+  Y  P+++IS+LYG L+ RLL GR+SK++ SN+A+ +KKRVT MV++VIV F  CW PIQ++F++Q+Y  D GG LFRTIH+ SNCLAY+NSMVNP LYAFLSENFRR+F +LLCC+  +S   +        RG +N          +   N + TS + R  E+T   Q   LINC++  KL     E  +  +T
Sbjct:    2 INNKTFLFSPPCNVSTVNIYEFVLTSIVVPILFGLIIILGAFGNIMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKNDGNDMKTSSM-RAIETT---QNDVLINCNSTTKLNDNKEEITVFLET 409          
BLAST of GCR304 vs. TrEMBL
Match: A0A5J4NUA6 (Allatostatin receptor OS=Paragonimus westermani OX=34504 GN=DEA37_0000272 PE=3 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 2.559e-93
Identity = 164/381 (43.04%), Postives = 248/381 (65.09%), Query Frame = 1
Query:  187 PLAVSLCMKTTT----MDYMKILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRD-EITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRR--LKSFATG--TIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSL 1302
            P+  + C+++ +    ++++ I      P+LF +I +VG VGNLLVIVV++AN QMRNTTNILI +LA+ADL FI+ C+P T ++Y  GGWPLG +LC ++ Y ++++ YCSVYTL+LMS+DR+LAVV+PI+ + +R   N++ AV  VW + L++NLPL + S +++G  +   + C+ +YCTYK  +          D+K FGK+++TLFF+  YL P++II  LY  LIYRL C +  ++  S ++  ++KRVT +VI V++IF L W P+  +F+ Q Y +DP   LFR I ++ NCLAY NS VNP  YAFLS NFR+AF +LL  RR  + +  T   TI + R    +C   +  T+   +   +    Q+L+L
Sbjct:   10 PINATNCIQSLSSAEELNHLTIFARYVTPVLFSVIFIVGLVGNLLVIVVVLANAQMRNTTNILIFALAIADLAFIVLCIPSTTIVYFVGGWPLGDILCHMFYYCSFVSVYCSVYTLLLMSLDRFLAVVYPIQCVHIRTQSNSVKAVLCVWIVLLLANLPLFMLSRVVQGSAEGSNSSCVTNYCTYKYLVVEVENSNLVTDNKEFGKVFFTLFFLFGYLIPLVIICALYICLIYRLRCRKIVQLKQSAESRRSQKRVTTLVITVVIIFGLSWLPLHVVFLFQYYSEDPNTTLFRVIQIVCNCLAYGNSCVNPIFYAFLSINFRKAFIDLLHGRRQPVGTIPTKLVTIINNRNTIQDCDNLLQKTADQQKSSNTVIPVQELTL 390          
BLAST of GCR304 vs. TrEMBL
Match: A0A193KUH5 (GCR032 OS=Schmidtea mediterranea OX=79327 GN=gcr032 PE=2 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 2.125e-90
Identity = 162/316 (51.27%), Postives = 221/316 (69.94%), Query Frame = 1
Query:  238 ILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFA 1185
            I+T +  P +FG+I+V GF GNLLVI+V+  N Q+RN TNILI SLA+AD+ FI FCVP TA +++  GW LG + C+IYQ+ TY+TAY SVYTLVLMS+DRYLAVVHPI S+ +R  +N +  V + W +F++ N PLL NS +   P   I D    YCTY P +++N T   Y ++  FG++Y  LF +  YL P+  I +LY  LI++LL    S+IS S+ A+ +KKRVT+MV++V+VIF LCW PIQ +FIIQ  G +P    F+  HV ++ LAYSNSM+NP LYAF S NFR AF ++L C++ +SF+
Sbjct:    9 IITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPP-TSINDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTCLIWKLLFNSESRISQSDKALQSKKRVTRMVVIVVVIFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQK-QSFS 322          
BLAST of GCR304 vs. TrEMBL
Match: A0A4Z2CN30 (Allatostatin-A receptor OS=Schistosoma japonicum OX=6182 GN=EWB00_009094 PE=3 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 4.283e-88
Identity = 171/366 (46.72%), Postives = 257/366 (70.22%), Query Frame = 1
Query:  148 LFEPLNNPILNDTPLAVSLCMKTTTMDYMK---ILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDE-ITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGT 1233
            ++ P  NP+ + +P     C++    D +    +   +  P++FG+I+++GFVGNLLV++V++AN QMRNTTNILI SLAVAD+ FI+ CVP  A++YVTG WPLG  LC+IY Y +Y++ YCSVYTLVLMS+DR++AVV+P + + +R  +NT IAV   W++ L++N+PL +++ ++EGP +   + C+ +YCTY   + ++S      D++  G++++ LFF+  YL+P +II +LY  LI RL CG SSK++HS +A+ +KKRVT +V+ V+++F + W PI TIF+IQ Y KDPG +LFR I ++ NCLAY NS +NP LY FLSE FR AF+ L+C R+  S   G ++ ++   NE GT
Sbjct:   38 IYPPRTNPVSSGSP-----CLQRFRSDELNLFLVFARIVTPVVFGMILIIGFVGNLLVMIVVLANAQMRNTTNILIFSLAVADMAFIVICVPSAAIVYVTGKWPLGLSLCRIYYYSSYVSVYCSVYTLVLMSLDRFMAVVYPTQCIHIRTQKNTTIAVVITWTVVLITNIPLFVDAILVEGPPEGGESSCVTEYCTYSWLVNFDSQTNMARDNRRGGQMFFLLFFLFGYLFPFVIICLLYISLILRLRCGPSSKMAHSAEALRSKKRVTHLVVTVVIVFGISWLPIHTIFLIQYYAKDPGTDLFRIIQILGNCLAYGNSSINPILYTFLSEKFRTAFSKLICNRKSNS-RVGRLK-QKSFDNETGT 396          
BLAST of GCR304 vs. Ensembl Cavefish
Match: galr2b (galanin receptor type 2-like [Source:NCBI gene;Acc:103040671])

HSP 1 Score: 170.244 bits (430), Expect = 1.106e-47
Identity = 107/308 (34.74%), Postives = 172/308 (55.84%), Query Frame = 1
Query:  244 TSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMR-NTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
             SV V ++F LI ++G VGN LV+ V++ + Q+  NTTN+ I++L+VAD  FIIFCVPF A +Y   GW  G  +C++  +   +T Y S +TL  +S+DRYLA+ +P+RS  LR   N ++A+  +W L L+   P L   D+I+     +  C+           W    ++  D         T  FV  Y+ PV+I+S+ Y   I + L      +   +++   K++VTKM+I+V V+F +CW P   + +  LYG  P         ++S+C+AY+NS +NP +YA +S++FR+ F  +  C
Sbjct:   25 ASVIVSVVFSLIFLLGTVGNSLVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVIIWGLSLIFAGPYLSYYDLIDFENSNV--CVPG---------WEEHNRKVLD---------TCTFVFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDVMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC 311          
BLAST of GCR304 vs. Ensembl Cavefish
Match: ENSAMXT00000006013.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:4195125:4261560:1 gene:ENSAMXG00000005876.2 transcript:ENSAMXT00000006013.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 2.513e-44
Identity = 105/309 (33.98%), Postives = 168/309 (54.37%), Query Frame = 1
Query:  250 VAVPILFGLI--MXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISH-SNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCR 1167
            V VP++FG I  + +     ++V++  I + + R+TTNI I++L++ADL F++FCVPF A +Y    W  G  LC+   Y   +T   S++TLV MS+DRY+AVV   +S  +RN RN ++ V  +W L LV  +P+  +  + + P    +     +C       W              +I+ T+  V+ YL P+++I+  Y  ++Y L      KI + S  +  +K++  + V++V+  F LCW P   I +   +G  P  +      ++S+CLAY NS VNP LYAFLSENFR+A   +  CR
Sbjct:   35 VLVPVVFGCIFFLGIVGNALVMVVLGRIKSGRSRSTTNIFILNLSIADLSFLLFCVPFQATIYSLPEWIFGAFLCKSVHYFVTVTMLVSIFTLVAMSVDRYVAVVLSKKSPCIRNRRNALLGVWIIWLLSLVFAVPVAQHQVVTDHPDAPNS----SFC-------W--------------EIWVTI-LVIGYLLPLVLITCCYAKVLYHL----HKKIKNMSKKSERSKRKTAQTVLLVVAAFLLCWMPHHIIAMWVEFGDFPLNDASFAFRIVSHCLAYGNSCVNPILYAFLSENFRKACRQVFTCR 313          
BLAST of GCR304 vs. Ensembl Cavefish
Match: GALR1 (galanin receptor type 1 [Source:NCBI gene;Acc:103047815])

HSP 1 Score: 157.918 bits (398), Expect = 1.412e-43
Identity = 100/292 (34.25%), Postives = 153/292 (52.40%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRG 1212
            + R+TTNI I++L+VADL +++FCVPF A +YV   W LG   C+   Y   ++   S++TL  MS+DRY+A+V    S ++R +RN ++AV  +W L L    P+  +  IIE   D  T C         +  W     R        KIY    FV  Y+ P+++IS  Y  ++  L   R    + S  +  +K++  + V+VV+V+F L W P   + +   +G  P         V ++CLAYSNS VNP +YAFLSENFR+A+  +  C+         I++ R 
Sbjct:   54 RARSTTNIFILNLSVADLSYLLFCVPFQATVYVLPTWVLGAFACKFVHYFFTVSMLVSIFTLSAMSVDRYVAIVRARSSSSVRVARNALLAVVAIWLLSLAMAAPVAYHQRIIER-EDNATYC---------WELWPQAHHR--------KIYVVCTFVFGYVLPLLLISFCYARVLNHL---RKKLKNMSKKSEASKRKTAQTVLVVVVVFCLSWLPHHVVHLWVEFGSFPLNQASFIFRVAAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCQITSESPLNDIKEVRS 324          
BLAST of GCR304 vs. Ensembl Cavefish
Match: oprm1 (delta-type opioid receptor [Source:NCBI gene;Acc:103040064])

HSP 1 Score: 154.451 bits (389), Expect = 6.103e-42
Identity = 94/274 (34.31%), Postives = 142/274 (51.82%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDI----IEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF 1146
            +M+  TNI I +LA+AD L     +PF +V Y+ G WP G VLC+I   + Y   + S++TL  MS+DRY+AV HP++++  R  RN  I     W L     LP+++ +      ++ P D   DC +++    P   W            +  +     F+  ++ PV+II+V YG +I RL   R   +S S +     +R+T+MV+VV+ +F +CW PI    II+     P   L          L Y+NS +NP LYAFL ENF+R F
Sbjct:   75 KMKTATNIYIFNLALADAL-ATSTLPFQSVNYLMGTWPFGDVLCKIVMSIDYYNMFTSIFTLTTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMVMASTTAARVDFPMD--IDCTLEF----PHPSW-----------YWENLLKICVFIFAFIMPVLIITVCYGLMILRLRSVR--MLSGSKEKDRNLRRITRMVLVVVAVFIICWTPIHIFVIIKALATIPNSLLQTITWHFCIALGYTNSCLNPVLYAFLDENFKRCF 328          
BLAST of GCR304 vs. Ensembl Cavefish
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:103028491])

HSP 1 Score: 153.68 bits (387), Expect = 1.004e-41
Identity = 87/265 (32.83%), Postives = 143/265 (53.96%), Query Frame = 1
Query:  352 TNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF 1146
            T++ I++L  ADL FI+ CVP  A +Y    W  G + C+   +  Y+T + S  TL  +S+DRYLA+ +P+R+  +R  RN +I +G VW++ LV + P L  S   +   D  T C+           W+  ++R  D            FV  YL PV+++S+ Y   I R L      +  +++    K+RVTKM+I+V V+F LCW P   + +   +G  P  +    + ++S+ +AY+NS +NP +YA +S++FR+ F
Sbjct:   53 TSVFIVNLCAADLGFIVLCVPVQAAVYTLPEWRFGSLACRTAHFAVYLTMHASALTLTAVSLDRYLAIRYPLRAREMRTPRNALICIGVVWAVSLVLSSPYL--SYYQQMDLDGTTVCI---------PAWDYQQRRAMD---------VCTFVFGYLIPVLVLSLTYARTI-RYLWTSVDPVQDASECRRAKRRVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTYVLRILSHLVAYTNSCLNPIVYALVSKHFRKGF 296          
BLAST of GCR304 vs. Ensembl Sea Lamprey
Match: galr1b (galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-140624-1])

HSP 1 Score: 162.925 bits (411), Expect = 5.278e-46
Identity = 100/304 (32.89%), Postives = 157/304 (51.64%), Query Frame = 1
Query:  343 RNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVT-KMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATS 1251
            RNTTN  I++L+VADL F++ CVPF + +YV   W  G  LC+   Y   +    S++TL  MS++RY+AVVH  RS  LR +RN +  V  +W+L +V+ +P   N  +++G         V+Y     F  W +   +        + Y T  F+  YL P+++IS  Y  ++  L      K+ + +      K+ T + V+VV+ +F + W P   I +  LYG  P  +      ++S+CL+Y NS  NP +YAFLSENFR+A+  +  C+   S +      R  + N   T+   TS
Sbjct:   64 RNTTNTFILNLSVADLTFLMVCVPFQSTIYVLPTWVFGAFLCKAVHYFVTVFMLVSIFTLAAMSVERYIAVVHSHRSPVLRTTRNALAGVAVIWALSVVAAIPCAQNRMLVDG---------VNYSHPGQFFCWEAEASKR-------RAYITGIFIFGYLLPLLLISCCYISVLTHL----QRKVRNISKKSQRSKKKTAQTVLVVVAVFCISWLPHHVIHMWVLYGSFPLTSASFAFRIVSHCLSYGNSCANPIIYAFLSENFRKAYRQVFSCQLPVSSSLKAKSTRIRLENFSSTHTCTTS 347          
BLAST of GCR304 vs. Ensembl Sea Lamprey
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 150.599 bits (379), Expect = 1.500e-41
Identity = 101/318 (31.76%), Postives = 169/318 (53.14%), Query Frame = 1
Query:  247 SVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRN---TTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATG 1191
            SV VP++F LI ++G  GN LVI+V++ + Q  +   TTNI I++L+VADL FI+FCVPF A +Y   GW  G  LC+   ++ ++T + S +TL  +S+DRYLA+ +P+RS  LR  R     +  +W L LV   P L     +      ++ C+           W    ++  D          + FV  YL PV ++ + Y F + + L      +   +++   K++VT M+++V  +F  CW P   + +   +G  P  +      ++S+C++Y+NS +NP +YA +S++FR+ F      R+  +FA G
Sbjct:   25 SVTVPVVFLLIFLLGAFGNSLVIIVLLCSGQRGSSNTTTNIFILNLSVADLCFILFCVPFQATIYTLDGWIFGSFLCKAVHFIIFLTMFASSFTLAAVSVDRYLAIRYPLRSRELRTPRKAAAVIAAIWGLALVFAGPYLSYYQAVT--FQNMSMCMP---------VWAKEPRKLMD---------MVTFVCGYLVPVSVLGLAYAFTL-KYLWTAVDPLEEMSESKRAKRKVTTMILIVAGLFCACWLPHHVLILYFWFGHFPLTHATYAFRLLSHCMSYANSCLNPLVYALVSKHFRKGF------RKAFAFACG 315          
BLAST of GCR304 vs. Ensembl Sea Lamprey
Match: oprk1 (opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE-030729-1])

HSP 1 Score: 146.747 bits (369), Expect = 1.835e-40
Identity = 95/317 (29.97%), Postives = 151/317 (47.63%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECG-TNVLATSGVTRKRESTTQ 1284
            +M+  TN  I +LA+AD L +   +PF +  Y+ G WP G V+C++   + Y   + S++TL +MS+DRY+AV HP++++  R      +    +W L     +P+++         + I +C++D+    P +KW +  K                F+  ++ PV+II V Y  ++ RL   R   +S S +     +R+T+MV++V+ IF +CW PI    II+                I   L Y+NS +NP LYAFL ENF+R F           F     RD +G +   G  N   TS      E T Q
Sbjct:    5 KMKTATNTYIFNLALADTL-VTTTLPFQSADYLMGSWPFGEVICKVVMSIDYYNMFTSIFTLTIMSVDRYIAVCHPVKALDFRTPSKAKLINICIWILSSAIGIPVIVMGT--AKKEEGIIECILDF--PHPAVKWENLLK-------------ICVFIFAFILPVLIIVVCYSLMVLRLRTVR--LLSGSKEKDRNLRRITRMVLIVVAIFVICWTPIHLFVIIKSRVSISDTPTVSAAWYICVALGYTNSCLNPVLYAFLDENFKRCFKEF-------CFPAAFRRDLQGSSRVGGRPNRGQTSAAFSHTERTRQ 294          
BLAST of GCR304 vs. Ensembl Sea Lamprey
Match: oprm1 (opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-010125-1])

HSP 1 Score: 144.821 bits (364), Expect = 7.482e-40
Identity = 98/279 (35.13%), Postives = 148/279 (53.05%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKI-SHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRR 1170
            +M+  TNI I +LA+AD L     +PF  V Y    WP GRVLC++   + Y   + S++TL +MSIDRY+AV HP+R++  R      +    +WSL     LP++I + + +  ++   DC +++  Y     W++  K             T  FV  +  PV +I+V YG +I RL   RS ++ S S +   T +R+T+MV+VV+  F +CW PI    I++   + P   +      +   L Y NS +NPFLYAFL ENF+R F    C RR
Sbjct:   11 KMKTATNIYIFNLALADTL-ATSTLPFQIVNYFMSTWPFGRVLCKLIISIDYYNMFTSIFTLTMMSIDRYIAVCHPVRALDFRTPVKAKLVNICIWSLSSAIGLPVMIIA-VTKQDKNGNVDCTLEFPIY-----WDNMLK-------------TCVFVFAFFIPVCVITVCYGLMITRL---RSVRVLSGSKEKDRTMRRITRMVLVVVAAFVVCWTPIHLYVIVRAIVRIPESAVVTVSWHVCIALGYVNSSMNPFLYAFLDENFKRCFRE-FCFRR 265          
BLAST of GCR304 vs. Ensembl Sea Lamprey
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 138.658 bits (348), Expect = 5.826e-37
Identity = 115/337 (34.12%), Postives = 176/337 (52.23%), Query Frame = 1
Query:  208 MKTTTMDYMKILTSV-AVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNS-RNTIIAVGTVWSLFLVSNLPLLI--NSDIIE--GPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSS-----------KISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQ-LYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCC 1164
            M  T  + M  +T    VP+LF LIM+VG VGN LVI VI  N QMR  TN  I++LA  D++F++ CVPFTA +Y    W  G  +C+   Y+  +T   +  TL  MS+DR    V+PIRS+  R       I++G +W   LV +LP+ +   +D  E  GP+         YC    F  + S    +        + Y+  FV+ Y+ P++ ISV Y  +I ++  GR +            ++  N+A  T+ +VT+MV+VV+++F LCW PIQ   + Q  Y           +   +NC++Y+NS +NPF+Y F+ ++FR+ F     C
Sbjct:   22 MNVTRGEEMPFMTDAWLVPLLFALIMLVGLVGNSLVIFVITKNRQMRTVTNFFIVNLAGTDIIFLVCCVPFTATLYPLPSWVFGDFMCKFVNYLQQVTVQATCMTLTAMSVDRCYVTVYPIRSLQHRTPCLAACISIG-IWIGSLVMSLPMALYHKTDTKEWYGPK--------TYC----FDAFPSVPHEH------AFVLYS--FVLVYMLPLVTISVCYSIMIKKI--GRPAVEPQDDNVQLQMLTERNEA--TRAKVTRMVVVVVLVFMLCWGPIQLFILFQSFYPHFAISYTTYKLKTWANCMSYANSSINPFVYCFMGDSFRKTFKKAFPC 333          
BLAST of GCR304 vs. Ensembl Nematostella
Match: EDO49619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFL1])

HSP 1 Score: 122.479 bits (306), Expect = 1.958e-31
Identity = 92/292 (31.51%), Postives = 149/292 (51.03%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGG-WPLGRVLCQ-IYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKR-----VTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRR--LKSFA 1185
             MRNT N LI++LA+AD+   + C+PF  V+ V G  W LG  +C+ ++  MT++ A CS  TL  +S DRY AVVHP +     + R T+  + + W +  +  LP ++    + G                  M  +S  + +  D +  ++Y    FV  Y  P++II+  Y  +  +L   +S++I  +  A           +TKM++ V++I+ LC  P Q +++   +G         T+   +  L Y NS+VNPFLYA L++ F++ FA LLCC+   LKS A
Sbjct:   25 NMRNTRNYLIVNLAIADITVALVCIPFDVVIRVYGDTWVLGAAMCKMVWPSMTFV-ATCSAATLAAISFDRYRAVVHPWKPRL--SMRQTLAVIVSTWLVSFLVVLPYIL----VLG------------------MDGHSCTEFWLKD-IHRQLYTVFLFVFAYALPLVIIAFAYSRVALKLR-EQSNRIEKNKLASGIPSSSKYNWITKMLVTVVLIYALCLLPNQVLWLWMEFGTGNEFEHMNTLLTFTGMLVYINSIVNPFLYAGLNDEFKKGFARLLCCKGKYLKSIA 289          
BLAST of GCR304 vs. Ensembl Nematostella
Match: EDO47535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM40])

HSP 1 Score: 119.398 bits (298), Expect = 2.749e-30
Identity = 74/282 (26.24%), Postives = 146/282 (51.77%), Query Frame = 1
Query:  340 MRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWP---LGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSN---DAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNC---LAYSNSMVNPFLYAFLSENFRRAFANLL 1158
            M+ T N LI+++A+ADLL  +  +P    +Y    W    +G V C+   +   ++   S+  LV +S+DRY A++HP + + +   RNT +    +W +  + N+  L+  ++  G +  + +C          M WN+  +  ++   F + Y+    ++ Y+ P+++I  LY  +  +L   +   ++ +N    A  +K++V +M+I+V+V+F LCW P   + II  Y  D    + +   ++ +    L ++NS +NP LY  L++ F+R F N++
Sbjct:   22 MKTTFNFLIVNMAIADLLVSVMVMPLQ-FLYYGQQWISDWIGSVTCKWVNFSGTLSITASIIALVAISLDRYFAIIHPFKHLPI--IRNTKLITSFIWIVSALFNVLYLVLFEVNLGRKSGVWEC---------HMNWNTISRDGKEQFEFARTYFMATLILLYIVPLVVIGTLYVLIGRKLWSRKIPGVTTANVKRYAETSKRKVLRMLIIVVVVFALCWLPAHIMHIIIYYHSDIYFQIVQNTPIVESIVFFLCHANSAINPILYVVLNKKFQREFINVM 291          
BLAST of GCR304 vs. Ensembl Nematostella
Match: EDO49911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF82])

HSP 1 Score: 112.849 bits (281), Expect = 6.086e-28
Identity = 83/285 (29.12%), Postives = 146/285 (51.23%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYV------TGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLL----CGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQT-IFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLL 1158
            +MR  TN  I ++A ADLL  +F +  T    +      + G  LG +LC+  Q+   ++  CSV+++  +S+DR+ A+  P++ +        IIA+  +W+   + + P LI +  +EG  +++ +C+     + P            DD     +Y    FV+FY  P+ II+ LY  +++RL      G++S  + SN    T K+V KM+I V+ +F LCW P+   +F++ L   +    L   +  I+  L ++NS +NP+LY   +ENFR+ F  + 
Sbjct:   29 RMRTVTNYFITNVAFADLLTTVFNMMPTLFWIIERKDPWSVGGTLGEILCKTLQFFQCVSVACSVFSMAAISMDRFFAIFRPLKRIITFKLAKFIIAL--IWASSCLISSP-LIYALKLEGDGEDV-NCVE---VWAPLF----------DDYTSPMVYTIALFVLFYALPLTIIAALYAVIMFRLWRRQTPGQNSTSNQSNKER-TNKKVLKMLITVVAVFALCWLPLYVRMFLVFLQPSNFPCGLPYHLDFITLFLGHANSSINPYLYVVFNENFRKGFKTIF 295          
BLAST of GCR304 vs. Ensembl Nematostella
Match: EDO42883 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S011])

HSP 1 Score: 112.464 bits (280), Expect = 6.497e-28
Identity = 80/282 (28.37%), Postives = 138/282 (48.94%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAV-MYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSK--------ISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGK---DPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF 1146
             M+ +TN L+++L +ADLL   F +PF  V +Y+T  W  G  +C+I  +   +    S+  L  +S++RYL V     ++ +  +RNT I    +W + +   LPLLI    I    +E       YC       W S+            IY  +   +FY  P+I+++ LY  +  +L   RS++        IS +   + +K R+TK+ + +I+ F L WAP   + ++  + +   +    +   I  I +C+A+SN  +NP LY ++S+NFR A 
Sbjct:   24 NMKTSTNTLLLNLCIADLLIAAFYLPFVTVDLYITDHWIFGGFMCRIVSFSQSVGTKASILILTALSLERYLTVCK--SNLVIVTARNTCIICIVLWGVAIAFTLPLLIAKTTISIEENE-------YC----IESWTSSH---------AIIYTLVVLTLFYFVPLIVMTALYAKIGKKLF--RSTRRTNSMRLSISSNKLTVTSKARLTKICVTIILSFALSWAPTHILTLVYYFSEMTPESYTIVNMIIFPIVSCVAFSNCALNPLLYCYMSQNFRNAL 281          
BLAST of GCR304 vs. Ensembl Nematostella
Match: EDO44418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN5])

HSP 1 Score: 111.694 bits (278), Expect = 1.024e-27
Identity = 79/275 (28.73%), Postives = 130/275 (47.27%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKI-----SHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF 1146
             M++ TN+ I +LA +DLL     +P       T  W  G VLC++  Y+  ++   SV TL+ ++ DR++A++ P R      +  TII +  +WSL L    PL+  + +          C  D         W        D K   + Y  + FVM Y  P++ ++VLY  ++ +L   R  +I     S S+   V++K+V KM+I VI++FT  W P+     I  +           ++ +S  L + NS  NP+LYA  ++N+R  F
Sbjct:   26 HMKSVTNLFIANLAASDLLITFLGMPHQITELYTTEWMFGTVLCKLVVYLQSVSVGSSVLTLLAITKDRFVAIIFPFRPRMSFKTAKTIIML--IWSLSLGIMAPLIYATKVHNN------QCTED---------WTPA----FDAKTAPRDYTVVLFVMLYAVPMLTMAVLYAIIVRKL--WRRRRIGEVIPSASSKNEVSRKKVIKMLITVIMLFTFSWLPLHVFSFISFFAPFCPDTSNTALYFVSLFLGHGNSAANPYLYALFNQNYRDGF 277          
BLAST of GCR304 vs. Ensembl Medaka
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:101155603])

HSP 1 Score: 175.637 bits (444), Expect = 1.186e-49
Identity = 119/359 (33.15%), Postives = 197/359 (54.87%), Query Frame = 1
Query:  244 TSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMR-NTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNV---LATSGVTRKRESTTQEQKLSLIN 1308
            TSV V ++F LI ++G +GN LV+ V++ + Q+  NTTN+ I++L+VAD  FIIFCVPF A +Y   GW  G  +C++  +   +T Y S +TL  +S+DRYLA+ +P+RS  LR   N ++A+  +W L LV   P L   D+I+     +  C+           W       E D+   K+  T  F+  Y+ PV+I+S+ Y   I + L      +   +++   K++VTKM+I+V V+F +CW P   + +  LYG  P         ++S+C+AY+NS VNP +YA +S++FR+ F  +  C  +   A G  R++  + +   T      A++ V++  E   ++ +  +IN
Sbjct:   25 TSVIVSVVFSLIFLLGTIGNSLVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYLSYYDLIDYANSTV--CIPG---------WE------EQDR---KVLDTCTFLFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCVNPIVYALVSKHFRKGFKKVFSCILI---ANG--RNKVHVVHVANTGPGFEAASTEVSQMNEENMRQNECEMIN 357          
BLAST of GCR304 vs. Ensembl Medaka
Match: sstr2b (somatostatin receptor 2 [Source:NCBI gene;Acc:101172660])

HSP 1 Score: 156.377 bits (394), Expect = 1.271e-42
Identity = 99/280 (35.36%), Postives = 157/280 (56.07%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKIS-HSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRL 1173
            +M+  TNI I++LAVAD+LF++  +PF A+      WP G VLC+I   +  +  + S++ L++MSIDRYLAVVHPIRS   R  R        VW + L+ NLP++I S II     +   C   +CT    + W   ++ Y    +F    YT  F++ +  P+++I + Y F+I ++   +SS I   S+    ++++VT+MV +V+ +F  CW P     +  + G        R+       L Y+NS  NP LYAFLSENF+++F N+LC +++
Sbjct:   74 KMKTVTNIYILNLAVADVLFML-GLPFIALQLALVHWPFGPVLCRIVMTVDSLNQFTSIFCLMVMSIDRYLAVVHPIRSTKWRKPRVAKTINVAVWGVSLLVNLPIVIYSGIIM----KHDSC---FCT----IVWPEPQEAYYTAFMF----YT--FILGFFLPLMVICLCYLFIIIKV---KSSGIRVGSSMRKRSERKVTRMVSIVVAVFVFCWLPFYVFNVTSVTGTISTTPFLRSTFAFVVVLGYANSCANPILYAFLSENFKKSFQNVLCLKKV 332          
BLAST of GCR304 vs. Ensembl Medaka
Match: galr1a (galanin receptor 1 [Source:NCBI gene;Acc:101159001])

HSP 1 Score: 142.895 bits (359), Expect = 6.534e-38
Identity = 95/298 (31.88%), Postives = 156/298 (52.35%), Query Frame = 1
Query:  343 RNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVT-KMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGT 1233
            R TTNI I++L++ADL +++FC+PF + +Y+   W LG  +C+   Y   ++   S++TL  MS+DRY+A+VH  +S ++R ++  +I V  +W + LV   P++   +I     D  T C            W         D+   KIY    FV  Y+ P+++IS  Y     ++L     K+ + +      K+ T + V+VV+V+F L W P   + +   +G  P       + V ++CLAYSNS VNP +YAFLSENFR+A+  +  C+   S     + D + I ++  T
Sbjct:   68 RGTTNIFILNLSIADLSYLLFCIPFQSTVYILPSWVLGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYIAIVHSRKSSSIRVAKYALIGVVVIWIISLVMAAPIMHYQNIFHS-SDNYTFC------------W-----EVWPDQTQKKIYVVCTFVFGYVLPLLLISFCYA----KVLNHLHKKLRNMSKKSEASKKKTAQTVLVVVVVFCLSWLPHHVVHLWAEFGTFPLNQASFVLRVAAHCLAYSNSSVNPVIYAFLSENFRKAYKQVFKCQTGAS--NSPLNDIKEIRSKADT 341          
BLAST of GCR304 vs. Ensembl Medaka
Match: ENSORLT00000043055.1 (G-protein coupled receptor 54 [Source:NCBI gene;Acc:101162001])

HSP 1 Score: 142.124 bits (357), Expect = 2.044e-37
Identity = 102/315 (32.38%), Postives = 165/315 (52.38%), Query Frame = 1
Query:  256 VPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVW-SLFLVSNLPLLINSDIIE----GPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISH-------SNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKD--PGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLL 1158
            VP+ F LIM+VG VGN LVI VI  + QMR  TN  I +LA  D++F++ CVPFTA +Y   GW  G  +C+   ++  +T   +  TL  MS DR    V+P++S+  R  +  +I    +W S F++S+ P+LI   + E    GPR         YC            +R+   K+  + +    F+  YL PV+ IS  Y  ++ R+       I H       S   +  + +V+KMV+V++++F +CW PIQ   + Q +  +  P    ++ I   +NC++Y+NS VNP +Y F+  +F+++F  + 
Sbjct:   50 VPLFFSLIMLVGLVGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGTFMCKFVAFLQQVTVQATCITLTAMSGDRCYVTVYPLKSLRHRTPKVAMIVSICIWISSFILSS-PILIYQRLEEGYWYGPR--------QYCV-----------ERFP-SKLHERAFILYQFIAAYLLPVLTISFCYTLMVKRVGQPTVEPIDHHYQVNLLSERTISIRSKVSKMVVVIVLLFAICWGPIQIFVLFQSFYPNYRPNYTTYK-IKTWANCMSYANSSVNPIIYGFMGASFQKSFRKIF 342          
BLAST of GCR304 vs. Ensembl Medaka
Match: oprm1 (delta-type opioid receptor [Source:NCBI gene;Acc:101161184])

HSP 1 Score: 138.272 bits (347), Expect = 4.618e-36
Identity = 90/270 (33.33%), Postives = 138/270 (51.11%), Query Frame = 1
Query:  337 QMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAF 1146
            +M+  TNI I +LA+AD L +   +PF +V Y+ G WP G +LC++   + Y   + S++TL  MSIDRY+AV HP++++  R  RN  I     W L     LP++  +   +    +I DC + +    P   W++  K                F+  ++ PV+II++ YG +I RL   R    S   D  +  +R+T+MV+VV+ +F +CW PI    II      P   L          L Y+NS +NP LY +L ENF+R F
Sbjct:   75 KMKTATNIYIFNLALADAL-VTSTLPFQSVNYLMGSWPFGDLLCKMVMSIDYYNMFTSIFTLTTMSIDRYIAVCHPVKALDFRTPRNAKIVNICNWILSSAIGLPVMFMAATAKS-HPKIVDCKLIF--PHPSWYWDTLLK-------------ICVFIFAFIMPVLIITICYGLMILRLKSVRMLSGSQEKDKNL--RRITRMVLVVVAVFIVCWTPIHVFVIITALINIPSSTLQTITWHFCIALGYTNSSLNPVLYGYLDENFKRCF 325          
BLAST of GCR304 vs. Planmine SMEST
Match: SMESG000016325.1 (SMESG000016325.1)

HSP 1 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 447/447 (100.00%), Postives = 447/447 (100.00%), Query Frame = 1
Query:  142 MVLFEPLNNPILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQTTENSLNLTEDLSSKTDLSEMDKNGKFETFVLLETHITD 1482
            MVLFEPLNNPILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMVVGFVGNLLVIVVIIANIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQTTENSLNLTEDLSSKTDLSEMDKNGKFETFVLLETHITD
Sbjct:    1 MVLFEPLNNPILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMVVGFVGNLLVIVVIIANIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFATGTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQTTENSLNLTEDLSSKTDLSEMDKNGKFETFVLLETHITD 447          
BLAST of GCR304 vs. Planmine SMEST
Match: SMESG000014669.1 (SMESG000014669.1)

HSP 1 Score: 366.311 bits (939), Expect = 5.786e-123
Identity = 210/412 (50.97%), Postives = 282/412 (68.45%), Query Frame = 1
Query:  172 ILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKS---FATGTIRDRRGITN----------ECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISEPVEKLILEQT 1368
            I N T L    C  +T   Y  +LTS+ VPILFGLI+++G  GN++V+VVII N +MRN+TNILI SLA+ADL FI FC+PFT V+YV  GWPLG   C+IYQ++ Y+TAYCSVYTLVLM  DR+LAVVHPI S  +R+ RNT + V  +W LF  +NLPLL+NS +I+G ++   +C+V YC+Y P ++WN T  +Y  D  FGK ++T FF+  Y  P+++IS+LYG L+ RLL GR+SK++ SN+A+ +KKRVT MV++VIV F  CW PIQ++F++Q+Y  D GG LFRTIH+ SNCLAY+NSMVNP LYAFLSENFRR+F +LLCC+  +S   +        RG +N          +   N + TS + R  E+T   Q   LINC++  KL     E  +  +T
Sbjct:    2 INNKTFLFSPPCNVSTVNIYEFVLTSIVVPILFGLIIILGAFGNIMVLVVIIFNKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVVYYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQSRVEYEKTHFSHNRGGSNSFKGRTRRQSKDDGNDMKTSSM-RAIETT---QNDVLINCNSTTKLNDNKEEITVFLET 409          
BLAST of GCR304 vs. Planmine SMEST
Match: SMESG000074480.1 (SMESG000074480.1)

HSP 1 Score: 240.736 bits (613), Expect = 2.156e-74
Identity = 146/317 (46.06%), Postives = 201/317 (63.41%), Query Frame = 1
Query:  232 MKILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVD---YCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTK--KRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCR 1167
            M++LTS+ VP LFG+I VVG +GN LVI VII N  MRN+TNILI SLA ADL FI+FC+P T  +Y+  GW     LC IYQY+T++T YCSVYTLVLMS DRYLA+VHPI S+  R    ++ AV   W   ++ NLP LINS ++     ++ +       YC  K  + +N     Y DD      +Y  FF+  +L P+ +I +LYG L+YR+    S ++++   A +T+  K+VT++V+ VI+ F + W P+  +F+IQ    DP    FR  H+++N +AY NSM+NP LYAFLSENFR AF   L C+
Sbjct:   46 MQVLTSIIVPALFGIIFVVGLLGNGLVIAVIIRNGHMRNSTNILISSLAFADLTFIVFCIPLTISIYIYQGWIWNNFLCMIYQYLTWLTVYCSVYTLVLMSADRYLAIVHPITSVNWRTRNRSLTAVYISWIALIIINLPFLINSRVLYTIPVKLANNQTRKNYYCGNKKLVNYNEAMDGYIDDYKALFNHYFTFFLFGFLLPLSMIVILYGLLLYRI----SQRLNNQQSANITRSNKKVTRLVVSVIIAFGVSWLPLHIVFLIQSTYGDPSNVAFRAFHMVANSMAYGNSMINPILYAFLSENFRTAFKKFLTCK 358          
BLAST of GCR304 vs. Planmine SMEST
Match: SMESG000009917.1 (SMESG000009917.1)

HSP 1 Score: 167.162 bits (422), Expect = 8.156e-49
Identity = 98/191 (51.31%), Postives = 131/191 (68.59%), Query Frame = 1
Query:  235 KILTSVAVPILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGK--IYYT 801
             I+T +  P +FG+I+V GF GNLLVI+V+  N Q+RN TNILI SLA+AD+ FI FCVP TA +++  GW LG + C+IYQ+ TY+TAY SVYTLVLMS+DRYLAVVHPI S+ +R  +N +  V + W +F++ N PLL NS  +  P   I D    YCTY P +++N T   Y ++  FG+   YYT
Sbjct:    8 SIITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSG-VAYPPTSINDTKDFYCTYMPTVRYNETLMGYLENGQFGRQLYYYT 197          
BLAST of GCR304 vs. Planmine SMEST
Match: SMESG000009917.1 (SMESG000009917.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.706e-47
Identity = 96/183 (52.46%), Postives = 127/183 (69.40%), Query Frame = 1
Query:  259 PILFGLIMXXXXXXXXXXXXXXXXXXQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGK--IYYT 801
            P +FG+I+V GF GNLLVI+V+  N Q+RN TNILI SLA+AD+ FI FCVP TA +++  GW LG + C+IYQ+ TY+TAY SVYTLVLMS+DRYLAVVHPI S+ +R  +N +  V + W +F++ N PLL NS  +  P   I D    YCTY P +++N T   Y ++  FG+   YYT
Sbjct:    4 PSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSG-VAYPPTSINDTKDFYCTYMPTVRYNETLMGYLENGQFGRQLYYYT 185          
The following BLAST results are available for this feature:
BLAST of GCR304 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALR25.528e-4731.20galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:41... [more]
SSTR51.989e-4032.01somatostatin receptor 5 [Source:HGNC Symbol;Acc:HG... [more]
OPRL17.647e-3832.74opioid related nociceptin receptor 1 [Source:HGNC ... [more]
OPRL17.647e-3832.74opioid related nociceptin receptor 1 [Source:HGNC ... [more]
OPRL17.647e-3832.74opioid related nociceptin receptor 1 [Source:HGNC ... [more]
back to top
BLAST of GCR304 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-92.571e-4534.34Galanin-like G-protein coupled receptor npr-9 [So... [more]
npr-221.550e-2523.06Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
nmur-29.047e-2525.00NMUR (NeuroMedin U Receptor) homolog [Source:UniP... [more]
npr-222.087e-2424.60Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
npr-348.931e-2424.43NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of GCR304 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AstA-R12.124e-5640.51gene:FBgn0266429 transcript:FBtr0333798[more]
AstA-R12.124e-5640.51gene:FBgn0266429 transcript:FBtr0070575[more]
AstA-R24.273e-5440.35gene:FBgn0039595 transcript:FBtr0308641[more]
AstA-R22.935e-5340.43gene:FBgn0039595 transcript:FBtr0085316[more]
AstA-R22.935e-5340.43gene:FBgn0039595 transcript:FBtr0336790[more]
back to top
BLAST of GCR304 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2b1.668e-4830.45galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-1311... [more]
galr2b1.668e-4830.45galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-1311... [more]
galr1b1.970e-4633.66galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-1406... [more]
galr2a1.848e-4233.55galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
galr2a1.848e-4233.55galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
back to top
BLAST of GCR304 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALR21.024e-4936.16galanin receptor 2 [Source:NCBI gene;Acc:100486593... [more]
sp38.178e-4835.39Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
sp31.941e-4735.39Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
ENSXETT00000041298.12.379e-4733.88galanin receptor 3 [Source:NCBI gene;Acc:100488248... [more]
kiss1r7.738e-4031.09KISS1 receptor [Source:NCBI gene;Acc:100316929][more]
back to top
BLAST of GCR304 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galr21.203e-4533.54galanin receptor 2 [Source:MGI Symbol;Acc:MGI:1337... [more]
Oprl11.064e-3832.15opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
Oprl12.632e-3832.05opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
Oprl13.277e-3832.15opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
Oprl13.277e-3832.15opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of GCR304 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WPA2|AR_BOMMO4.189e-6142.99Allatostatin-A receptor OS=Bombyx mori OX=7091 GN=... [more]
sp|E7F7V7|GAL2B_DANRE1.259e-4730.45Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr... [more]
sp|O43603|GALR2_HUMAN2.654e-4631.20Galanin receptor type 2 OS=Homo sapiens OX=9606 GN... [more]
sp|O88854|GALR2_MOUSE8.413e-4533.54Galanin receptor type 2 OS=Mus musculus OX=10090 G... [more]
sp|O08726|GALR2_RAT1.921e-4434.00Galanin receptor type 2 OS=Rattus norvegicus OX=10... [more]
back to top
BLAST of GCR304 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUR90.000e+0100.00GCR304 OS=Schmidtea mediterranea OX=79327 GN=gcr30... [more]
A0A193KUP01.424e-11950.97GCR064 OS=Schmidtea mediterranea OX=79327 GN=gcr06... [more]
A0A5J4NUA62.559e-9343.04Allatostatin receptor OS=Paragonimus westermani OX... [more]
A0A193KUH52.125e-9051.27GCR032 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A4Z2CN304.283e-8846.72Allatostatin-A receptor OS=Schistosoma japonicum O... [more]
back to top
BLAST of GCR304 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2b1.106e-4734.74galanin receptor type 2-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000006013.22.513e-4433.98pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
GALR11.412e-4334.25galanin receptor type 1 [Source:NCBI gene;Acc:1030... [more]
oprm16.103e-4234.31delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
galr2a1.004e-4132.83galanin receptor type 2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of GCR304 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr1b5.278e-4632.89galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-1406... [more]
galr2a1.500e-4131.76galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
oprk11.835e-4029.97opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
oprm17.482e-4035.13opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-01... [more]
kiss1rb5.826e-3734.12KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
back to top
BLAST of GCR304 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR304 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496191.958e-3131.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475352.749e-3026.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499116.086e-2829.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428836.497e-2828.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444181.024e-2728.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR304 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2a1.186e-4933.15galanin receptor type 2 [Source:NCBI gene;Acc:1011... [more]
sstr2b1.271e-4235.36somatostatin receptor 2 [Source:NCBI gene;Acc:1011... [more]
galr1a6.534e-3831.88galanin receptor 1 [Source:NCBI gene;Acc:101159001... [more]
ENSORLT00000043055.12.044e-3732.38G-protein coupled receptor 54 [Source:NCBI gene;Ac... [more]
oprm14.618e-3633.33delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of GCR304 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016325.10.000e+0100.00SMESG000016325.1[more]
SMESG000014669.15.786e-12350.97SMESG000014669.1[more]
SMESG000074480.12.156e-7446.06SMESG000074480.1[more]
SMESG000009917.18.156e-4951.31SMESG000009917.1[more]
SMESG000009917.11.706e-4752.46SMESG000009917.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029570 ID=SMED30029570|Name=GCR304|organism=Schmidtea mediterranea sexual|type=transcript|length=1521bp
CTCTTCCGATCTTGAATACCAAACGGAGTTAGGGGGGCGCAATTCTAATA
TTTTGTTTTTTACACAAACTTTATCACAAATGCATGCAAATTAAATGACT
TGAGATTTTACCTTTCATAATCAAATCATCAGCGATAAATGATGGTGCTG
TTTGAACCCCTCAACAATCCGATTCTCAATGACACGCCTTTAGCAGTTTC
CTTGTGTATGAAAACGACAACGATGGACTACATGAAGATCCTAACGAGTG
TCGCCGTACCGATTCTATTCGGTTTGATAATGGTTGTTGGATTCGTTGGA
AATCTCCTGGTAATAGTTGTCATAATAGCCAACATACAAATGAGAAATAC
AACAAACATTTTGATAATATCCCTGGCAGTAGCAGATTTGTTATTCATAA
TATTTTGCGTTCCATTTACCGCTGTCATGTACGTCACTGGTGGATGGCCG
CTTGGAAGAGTTCTCTGCCAGATTTATCAGTACATGACGTATATCACTGC
GTATTGTAGTGTATATACGTTGGTTTTGATGAGCATTGACCGCTATTTGG
CTGTCGTCCATCCAATTCGTAGTATGACTTTGAGGAATAGTAGAAATACC
ATAATTGCAGTAGGAACCGTTTGGAGTTTGTTTCTCGTATCAAATTTACC
GCTTTTAATAAATTCAGATATCATTGAGGGTCCGAGAGACGAGATCACAG
ATTGTCTCGTTGATTATTGTACATACAAGCCATTTATGAAGTGGAACAGT
ACGAAGAAAAGGTATGAAGATGATAAAGTGTTCGGAAAGATTTATTATAC
TCTATTTTTTGTGATGTTTTATCTTTGGCCTGTAATAATCATTTCAGTTC
TCTACGGGTTTCTAATATATCGTTTGCTATGTGGTCGTTCGTCGAAAATA
TCTCATTCAAATGACGCAATGGTTACGAAGAAAAGAGTCACGAAAATGGT
GATTGTAGTCATAGTCATTTTTACCCTCTGTTGGGCTCCAATTCAAACCA
TTTTCATCATTCAACTATATGGAAAAGATCCCGGGGGAAATTTATTTCGA
ACAATTCACGTAATCAGCAACTGCTTGGCGTATTCCAACAGCATGGTCAA
TCCGTTTCTGTATGCATTTCTGTCCGAAAACTTTAGACGGGCATTTGCAA
ATTTGCTTTGTTGTAGGCGGTTGAAAAGTTTTGCGACCGGAACGATTCGT
GACCGGCGTGGAATTACAAATGAGTGTGGCACTAATGTCCTGGCAACATC
CGGGGTGACTAGGAAACGTGAATCGACAACCCAGGAACAAAAGCTTTCGT
TAATTAATTGTCACAATCAAATTAAATTAATTTCCGAACCGGTTGAGAAA
TTGATCCTCGAACAGACAACCGAGAACTCGTTAAATCTGACTGAAGATTT
ATCCAGTAAAACTGATCTGTCTGAAATGGATAAAAATGGTAAATTCGAGA
CTTTTGTTCTCCTGGAAACACATATTACTGATTAATGGGCAACAAATCTT
TTATTTTTATTGATGATATTA
back to top

protein sequence of SMED30029570-orf-1

>SMED30029570-orf-1 ID=SMED30029570-orf-1|Name=SMED30029570-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MMVLFEPLNNPILNDTPLAVSLCMKTTTMDYMKILTSVAVPILFGLIMVV
GFVGNLLVIVVIIANIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVT
GGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRN
SRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFM
KWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGR
SSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGG
NLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFAT
GTIRDRRGITNECGTNVLATSGVTRKRESTTQEQKLSLINCHNQIKLISE
PVEKLILEQTTENSLNLTEDLSSKTDLSEMDKNGKFETFVLLETHITD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000405Galanin_rcpt
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000405Galanin receptor familyPRINTSPR00663GALANINRcoord: 86..100
score: 49.33
coord: 103..121
score: 26.32
coord: 145..161
score: 47.65
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 39..63
score: 31.33
coord: 117..139
score: 32.05
coord: 267..291
score: 28.29
coord: 153..174
score: 19.92
coord: 220..243
score: 21.58
coord: 307..333
score: 35.89
coord: 72..93
score: 38.6
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 48..340
e-value: 3.1E-6
score: -17.6
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 54..325
e-value: 5.3E-57
score: 193.1
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 123..139
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 18..376
e-value: 7.6E-87
score: 293.1
NoneNo IPR availablePANTHERPTHR24230G-PROTEIN COUPLED RECEPTORcoord: 35..382
NoneNo IPR availablePANTHERPTHR24230:SF126ALLATOSTATIN A RECEPTOR 2, ISOFORM Acoord: 35..382
NoneNo IPR availableCDDcd150967tmA_AstA_R_insectcoord: 38..336
e-value: 3.37607E-121
score: 352.753
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 37..347
NoneNo IPR availableTMHMMTMhelixcoord: 222..244
NoneNo IPR availableTMHMMTMhelixcoord: 271..293
NoneNo IPR availableTMHMMTMhelixcoord: 306..328
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 74..96
NoneNo IPR availableTMHMMTMhelixcoord: 153..175
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 54..325
score: 48.356