Serine/arginine-rich splicing factor 4

Overview
NameSerine/arginine-rich splicing factor 4
Smed IDSMED30029555
Length (bp)1402
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/arginine-rich splicing factor 4 (SMED30029555) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/arginine-rich splicing factor 4 (SMED30029555) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/arginine-rich splicing factor 4 (SMED30029555) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/arginine-rich splicing factor 4 (SMED30029555) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029555

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029555SMESG000045507.1 SMESG000045502.1 SmedASXL_014399SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30029555SMESG000045501.1 SMESG000045502.1 SmedASXL_010401SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029555SMESG000045501.1 SMESG000045502.1 SmedASXL_010401SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30029555SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029555SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30029555SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30029555SMESG000045507.1 SMESG000045502.1 dd_Smed_v4_13817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30029555SMESG000045501.1 dd_Smed_v4_473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30029555SMESG000045501.1 dd_Smed_v4_473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029555SMESG000045501.1 dd_Smed_v4_473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029555SMESG000045501.1 dd_Smed_v4_473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029555SMESG000045507.1 SMESG000045502.1 dd_Smed_v6_13817_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30029555SMESG000045507.1 SMESG000045502.1 OX_Smed_1.0.04904ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30029555SMESG000045501.1 dd_Smed_v6_473_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029555SMESG000045501.1 dd_Smed_v6_473_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 170.244 bits (430), Expect = 1.490e-49
Identity = 94/188 (50.00%), Postives = 126/188 (67.02%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YGR+  VD+KNGYGFVE +D RDA+DAV++L+G +L GERV VE AR             D    G  +    Y SR +  R     P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A++K DG E+ G  +++ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARG-------PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 171.014 bits (432), Expect = 3.271e-49
Identity = 94/188 (50.00%), Postives = 126/188 (67.02%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YGR+  VD+KNGYGFVE +D RDA+DAV++L+G +L GERV VE AR             D    G  +    Y SR +  R     P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A++K DG E+ G  +++ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARG-------PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 170.629 bits (431), Expect = 5.031e-49
Identity = 94/188 (50.00%), Postives = 126/188 (67.02%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YGR+  VD+KNGYGFVE +D RDA+DAV++L+G +L GERV VE AR             D    G  +    Y SR +  R     P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A++K DG E+ G  +++ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARG-------PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Human
Match: SRSF4 (serine and arginine rich splicing factor 4 [Source:HGNC Symbol;Acc:HGNC:10786])

HSP 1 Score: 173.326 bits (438), Expect = 6.240e-49
Identity = 93/188 (49.47%), Postives = 120/188 (63.83%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L  +  ERD+++FF+ YG+I  VD+KNGYGFVE DD RDA+DAV++L+G  L GERV VE AR                  G               R     P R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A+EK DG E+ G K+++ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARG-------------PRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Human
Match: SRSF6 (serine and arginine rich splicing factor 6 [Source:HGNC Symbol;Acc:HGNC:10788])

HSP 1 Score: 170.244 bits (430), Expect = 3.348e-48
Identity = 94/188 (50.00%), Postives = 126/188 (67.02%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YGR+  VD+KNGYGFVE +D RDA+DAV++L+G +L GERV VE AR             D    G  +    Y SR +  R     P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A++K DG E+ G  +++ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARG-------PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Celegans
Match: rsp-1 (Probable splicing factor, arginine/serine-rich 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23121])

HSP 1 Score: 146.362 bits (368), Expect = 6.462e-40
Identity = 87/198 (43.94%), Postives = 123/198 (62.12%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXX-----------XXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVG-EVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+Y+G L  R+ E+DI+ FFR YG+IR V +KNG+GFVE DD+RDAEDAVHDL+G +L GERV ++ ++     G   G GG   G    +  +                  R      +P  + HR++V +LSSR+SWQDLKD +R+ G E T+A+AHK RPN+ ++ F+  SD+K  IEK DG +L G K+K+ +D
Sbjct:    4 RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLKNGFGFVEFDDKRDAEDAVHDLNGKELGGERVILDYSKPRGGGGDRGGFGGGGRGGARVSSYSGGGGGGRDRFDRYDRGPPRRESRYGRPYSTRHRVVVENLSSRISWQDLKDQVRRQGVEPTYAEAHK-RPNEALLCFATPSDLKRCIEKCDGMDLNGRKIKMIDD 200          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Celegans
Match: rsp-2 (Probable splicing factor, arginine/serine-rich 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23120])

HSP 1 Score: 134.806 bits (338), Expect = 4.791e-36
Identity = 72/189 (38.10%), Postives = 113/189 (59.79%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVG-EVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            M R+Y+G LP R  +RD++ FFR YG++  V +KNG+GFV+  D+RDA+DAVHDL+G +L GERV +E  R          +    G              + +      +P  +  R+++++LS+R SWQD+KD +RK+G E T+++AHK   NQ +V F++  D++ A+ K  G +L G KLK  ++
Sbjct:    1 MVRVYIGRLPNRASDRDVEHFFRGYGKLSDVIMKNGFGFVDFQDQRDADDAVHDLNGKELCGERVILEFPRRKV-----GYNEERSGSGFRGREPTFRKGGERQFSNRYSRPCSTRFRLVIDNLSTRYSWQDIKDHIRKLGIEPTYSEAHKRNVNQAIVCFTSHDDLRDAMNKLQGEDLNGRKLKCTDE 184          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Celegans
Match: rsp-1 (Probable splicing factor, arginine/serine-rich 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23121])

HSP 1 Score: 94.7449 bits (234), Expect = 6.567e-23
Identity = 59/143 (41.26%), Postives = 82/143 (57.34%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----------XXXXXXXKPIRSEHRIIVNDLSSRVSWQDLK 488
            R+Y+G L  R+ E+DI+ FFR YG+IR V +KNG+GFVE DD+RDAEDAVHDL+G +L GERV ++ ++     G   G GG   G    +  +                  R      +P  + HR++V +LSSR+SWQ  K
Sbjct:    4 RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLKNGFGFVEFDDKRDAEDAVHDLNGKELGGERVILDYSKPRGGGGDRGGFGGGGRGGARVSSYSGGGGGGRDRFDRYDRGPPRRESRYGRPYSTRHRVVVENLSSRISWQQEK 146          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Celegans
Match: rsp-1 (Probable splicing factor, arginine/serine-rich 1 [Source:UniProtKB/Swiss-Prot;Acc:Q23121])

HSP 1 Score: 94.7449 bits (234), Expect = 6.567e-23
Identity = 59/143 (41.26%), Postives = 82/143 (57.34%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----------XXXXXXXKPIRSEHRIIVNDLSSRVSWQDLK 488
            R+Y+G L  R+ E+DI+ FFR YG+IR V +KNG+GFVE DD+RDAEDAVHDL+G +L GERV ++ ++     G   G GG   G    +  +                  R      +P  + HR++V +LSSR+SWQ  K
Sbjct:    4 RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLKNGFGFVEFDDKRDAEDAVHDLNGKELGGERVILDYSKPRGGGGDRGGFGGGGRGGARVSSYSGGGGGGRDRFDRYDRGPPRRESRYGRPYSTRHRVVVENLSSRISWQQEK 146          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Celegans
Match: rsp-3 (Probable splicing factor, arginine/serine-rich 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEW6])

HSP 1 Score: 94.3597 bits (233), Expect = 1.034e-21
Identity = 70/185 (37.84%), Postives = 91/185 (49.19%), Query Frame = 3
Query:   87 MPR-------LYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYG----FVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYD 608
            MPR       +YVGNLP  + E++++  F +YGRI+ VDIK+G G    FVE +D RDAEDAV   DG +  G R+ VE  R     G       D G     +                     + +R+IV  L    SWQDLKD MR  G+V +AD    R   GVVEF+   D+K A+ K D
Sbjct:    1 MPRGGSEDQKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRIRVEFTRGVGPRGPGGRPLQDGGDHRGGDFRGGRGGGRGGGPQRR-----TGYRVIVEGLPPTGSWQDLKDHMRDAGDVCYADV--ARDGTGVVEFTRYEDVKYAVRKLD 178          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0082802)

HSP 1 Score: 176.792 bits (447), Expect = 4.220e-51
Identity = 98/187 (52.41%), Postives = 127/187 (67.91%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+YVG LP  + ERD+++FF+ YGR R + IKNGYGFVE +D RDA+DAV++L+G +LLGERV VE AR  AR           GGR         +   +    +    P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVT+ADAHK R N+GVVEF++ SDMK AIEK D  EL G ++ + ED
Sbjct:    5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 191          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0308197)

HSP 1 Score: 177.178 bits (448), Expect = 5.063e-51
Identity = 98/187 (52.41%), Postives = 127/187 (67.91%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+YVG LP  + ERD+++FF+ YGR R + IKNGYGFVE +D RDA+DAV++L+G +LLGERV VE AR  AR           GGR         +   +    +    P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVT+ADAHK R N+GVVEF++ SDMK AIEK D  EL G ++ + ED
Sbjct:    5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 191          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0308195)

HSP 1 Score: 177.178 bits (448), Expect = 5.063e-51
Identity = 98/187 (52.41%), Postives = 127/187 (67.91%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+YVG LP  + ERD+++FF+ YGR R + IKNGYGFVE +D RDA+DAV++L+G +LLGERV VE AR  AR           GGR         +   +    +    P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVT+ADAHK R N+GVVEF++ SDMK AIEK D  EL G ++ + ED
Sbjct:    5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 191          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0082801)

HSP 1 Score: 176.792 bits (447), Expect = 7.153e-51
Identity = 100/186 (53.76%), Postives = 127/186 (68.28%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+YVG LP  + ERD+++FF+ YGR R + IKNGYGFVE +D RDA+DAV++L+G +LLGERV VE AR  AR           GGR         +   SR       P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVT+ADAHK R N+GVVEF++ SDMK AIEK D  EL G ++ + ED
Sbjct:    5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKSSSRYG----PPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 186          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Fly
Match: B52 (gene:FBgn0004587 transcript:FBtr0308196)

HSP 1 Score: 176.792 bits (447), Expect = 7.153e-51
Identity = 100/186 (53.76%), Postives = 127/186 (68.28%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+YVG LP  + ERD+++FF+ YGR R + IKNGYGFVE +D RDA+DAV++L+G +LLGERV VE AR  AR           GGR         +   SR       P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVT+ADAHK R N+GVVEF++ SDMK AIEK D  EL G ++ + ED
Sbjct:    5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKSSSRYG----PPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 186          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Zebrafish
Match: srsf5a (serine and arginine rich splicing factor 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7336])

HSP 1 Score: 182.57 bits (462), Expect = 4.347e-54
Identity = 104/186 (55.91%), Postives = 132/186 (70.97%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L     ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G +L  ERVT+E ARS    GG  G GG    R    R +R              P+R+EHRIIV +LSSR+SWQDLKDLMRKVGEVTF DAH+ + N+GVVEF++ SDMK AIEK DG +L G KLK+YED
Sbjct:    5 RVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDYRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGGRFSPRFGGYRQSRSGGSRYG------PPVRTEHRIIVENLSSRISWQDLKDLMRKVGEVTFVDAHRTKKNEGVVEFASHSDMKNAIEKLDGTDLNGRKLKLYED 184          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Zebrafish
Match: srsf5a (serine and arginine rich splicing factor 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7336])

HSP 1 Score: 182.57 bits (462), Expect = 4.347e-54
Identity = 104/186 (55.91%), Postives = 132/186 (70.97%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L     ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G +L  ERVT+E ARS    GG  G GG    R    R +R              P+R+EHRIIV +LSSR+SWQDLKDLMRKVGEVTF DAH+ + N+GVVEF++ SDMK AIEK DG +L G KLK+YED
Sbjct:    5 RVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDYRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGGRFSPRFGGYRQSRSGGSRYG------PPVRTEHRIIVENLSSRISWQDLKDLMRKVGEVTFVDAHRTKKNEGVVEFASHSDMKNAIEKLDGTDLNGRKLKLYED 184          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Zebrafish
Match: srsf5a (serine and arginine rich splicing factor 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7336])

HSP 1 Score: 167.162 bits (422), Expect = 9.750e-48
Identity = 104/217 (47.93%), Postives = 132/217 (60.83%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFV-------------------------------EIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L     ERD++KFF+ YGRIR +++KNG+GFV                               E DD RDA+DAV++L+G +L  ERVT+E ARS    GG  G GG    R    R +R              P+R+EHRIIV +LSSR+SWQDLKDLMRKVGEVTF DAH+ + N+GVVEF++ SDMK AIEK DG +L G KLK+YED
Sbjct:    5 RVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVVSIKTLEGLFCLRRASEVSVLLPPAVCFCLQEFDDYRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGGRFSPRFGGYRQSRSGGSRYG------PPVRTEHRIIVENLSSRISWQDLKDLMRKVGEVTFVDAHRTKKNEGVVEFASHSDMKNAIEKLDGTDLNGRKLKLYED 215          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Zebrafish
Match: srsf6b (serine and arginine rich splicing factor 6b [Source:ZFIN;Acc:ZDB-GENE-041219-1])

HSP 1 Score: 168.703 bits (426), Expect = 1.278e-47
Identity = 89/188 (47.34%), Postives = 126/188 (67.02%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YG++  +D+KNGYGFVE +D RDA+DAV++L+G +L GERV VE AR   R     G G    G   ++  +               P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDM+ A++K DG ++ G K+++ ED
Sbjct:    1 MPRVYIGKLSYHVREKDIQRFFGGYGKLMEIDLKNGYGFVEFEDTRDADDAVYELNGKELCGERVIVEHARGPRRDRDGYGGGYGGFGGRSNSGYSSRSRSGRDKYG---PPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSHSDMRRALDKLDGTDINGRKIRLVED 185          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Zebrafish
Match: srsf5b (serine and arginine rich splicing factor 5b [Source:ZFIN;Acc:ZDB-GENE-040718-354])

HSP 1 Score: 166.392 bits (420), Expect = 1.351e-47
Identity = 93/185 (50.27%), Postives = 125/185 (67.57%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R+++G L     E+D+++FF+ YGRIR +D+K G+GFVE DD RDAEDAV++LDG +L  ERVT+E AR                GRG   R      R S+D   +  P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVTFADAH+   N+GVVEF++ SD+K A+EK  G E+ G K+K+ E
Sbjct:    5 RIFIGRLNPSAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR---------VRLRGGRGRGGGGRFPARYGRGSQDSRRNPPPMRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPNLNEGVVEFASHSDLKNALEKLSGKEINGRKIKLVE 180          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Xenopus
Match: fnbp1l (formin binding protein 1 like [Source:Xenbase;Acc:XB-GENE-489112])

HSP 1 Score: 173.326 bits (438), Expect = 2.431e-50
Identity = 100/186 (53.76%), Postives = 131/186 (70.43%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L     ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G  L  ERVT+E AR+    GG  G GG  GGR  +    R  +     RY    P+R+EHRIIV +LSSRVSWQDLKD MRK GEVT+ DAH+   N+GVVEF++ +DMK A++K DG EL G K+K+ ED
Sbjct:    5 RVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKVLCNERVTIEHARNRRGRGGMMGGGGGGGGRYPNRFAYRQSNSGGPSRYG--PPVRTEHRIIVENLSSRVSWQDLKDFMRKAGEVTYVDAHRSNRNEGVVEFASYTDMKNALDKLDGVELSGRKIKLTED 188          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Xenopus
Match: fnbp1l (formin binding protein 1 like [Source:Xenbase;Acc:XB-GENE-489112])

HSP 1 Score: 173.711 bits (439), Expect = 2.436e-50
Identity = 100/186 (53.76%), Postives = 131/186 (70.43%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L     ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G  L  ERVT+E AR+    GG  G GG  GGR  +    R  +     RY    P+R+EHRIIV +LSSRVSWQDLKD MRK GEVT+ DAH+   N+GVVEF++ +DMK A++K DG EL G K+K+ ED
Sbjct:    5 RVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKVLCNERVTIEHARNRRGRGGMMGGGGGGGGRYPNRFAYRQSNSGGPSRYG--PPVRTEHRIIVENLSSRVSWQDLKDFMRKAGEVTYVDAHRSNRNEGVVEFASYTDMKNALDKLDGVELSGRKIKLTED 188          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Xenopus
Match: srsf5 (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:448003])

HSP 1 Score: 166.007 bits (419), Expect = 2.352e-47
Identity = 91/185 (49.19%), Postives = 121/185 (65.41%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R+++G L     E+D+++FF+ YGRIR +D+K G+GFVE DD RDA+DAV++LDG +L  ERVT+E AR                      R N   S        S  PIR+E+R+IV +LSSRVSWQDLKD MR+ GEVTFADAH+ + N+GVVEF++ SD+K AIEK  G E+ G K+K+ E
Sbjct:    5 RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDADDAVYELDGKELCNERVTIEHAR---------LRSRGGPRGLGRGRYNDRFSSRRPRGDRSAPPIRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYSDLKNAIEKLSGKEINGRKIKLIE 180          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Xenopus
Match: grm6 (glutamate receptor, metabotropic 6 [Source:Xenbase;Acc:XB-GENE-949374])

HSP 1 Score: 170.629 bits (431), Expect = 1.255e-45
Identity = 86/188 (45.74%), Postives = 119/188 (63.30%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L  R  ERD+++FF+ +G+I  VD+KNGYGFVE +D RDAEDAV++++G +L GERV VE AR+                                       P+R+ +R+ V +LSSR SWQDLKD MR+ GEVT+ADAH+ R N+GV+EF + SDM+ A+EK DG E+ G K+++ ED
Sbjct:    6 MPRVYIGRLSHRARERDVERFFKGFGKIVEVDLKNGYGFVEFEDSRDAEDAVYEMNGRELCGERVIVEHARA------------------PRRDIRSGYGYRKGGSDKYGPPVRTMYRLRVENLSSRCSWQDLKDFMRQAGEVTYADAHQRRQNEGVIEFRSYSDMRRALEKLDGSEINGRKIQLVED 175          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Xenopus
Match: grm6 (glutamate receptor, metabotropic 6 [Source:Xenbase;Acc:XB-GENE-949374])

HSP 1 Score: 170.629 bits (431), Expect = 1.387e-45
Identity = 86/188 (45.74%), Postives = 119/188 (63.30%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L  R  ERD+++FF+ +G+I  VD+KNGYGFVE +D RDAEDAV++++G +L GERV VE AR+                                       P+R+ +R+ V +LSSR SWQDLKD MR+ GEVT+ADAH+ R N+GV+EF + SDM+ A+EK DG E+ G K+++ ED
Sbjct:    6 MPRVYIGRLSHRARERDVERFFKGFGKIVEVDLKNGYGFVEFEDSRDAEDAVYEMNGRELCGERVIVEHARA------------------PRRDIRSGYGYRKGGSDKYGPPVRTMYRLRVENLSSRCSWQDLKDFMRQAGEVTYADAHQRRQNEGVIEFRSYSDMRRALEKLDGSEINGRKIQLVED 175          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Mouse
Match: Srsf4 (serine/arginine-rich splicing factor 4 [Source:MGI Symbol;Acc:MGI:1890577])

HSP 1 Score: 173.326 bits (438), Expect = 4.320e-48
Identity = 93/188 (49.47%), Postives = 120/188 (63.83%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L  +  ERD+++FF+ YG+I  VD+KNGYGFVE DD RDA+DAV++L+G  L GERV VE AR                  G               R     P R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A+EK DG E+ G K+++ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARG-------------PRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Mouse
Match: Srsf6 (serine/arginine-rich splicing factor 6 [Source:MGI Symbol;Acc:MGI:1915246])

HSP 1 Score: 167.162 bits (422), Expect = 3.059e-47
Identity = 92/188 (48.94%), Postives = 125/188 (66.49%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YGR+  +D+KNGYGFVE +D RDA+DAV++L+  +L GERV VE AR             D    G  +    Y SR +  R     P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A++K DG E+ G  +++ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYGFVEFEDSRDADDAVYELNSKELCGERVIVEHARG-------PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Mouse
Match: Srsf5 (serine/arginine-rich splicing factor 5 [Source:MGI Symbol;Acc:MGI:98287])

HSP 1 Score: 157.532 bits (397), Expect = 2.468e-44
Identity = 91/185 (49.19%), Postives = 126/185 (68.11%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R+++G L     E+D+++FF+ YGRIR +D+K G+GFVE +D RDA+DAV++LDG +L  ERVT+E AR+ +R G  RG   DR        + R              P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVTFADAH+ + N+GVVEF++  D+K AIEK  G E+ G K+K+ E
Sbjct:    5 RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNA-----------PPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIE 178          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Mouse
Match: Srsf5 (serine/arginine-rich splicing factor 5 [Source:MGI Symbol;Acc:MGI:98287])

HSP 1 Score: 157.532 bits (397), Expect = 2.468e-44
Identity = 91/185 (49.19%), Postives = 126/185 (68.11%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R+++G L     E+D+++FF+ YGRIR +D+K G+GFVE +D RDA+DAV++LDG +L  ERVT+E AR+ +R G  RG   DR        + R              P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVTFADAH+ + N+GVVEF++  D+K AIEK  G E+ G K+K+ E
Sbjct:    5 RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNA-----------PPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIE 178          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Mouse
Match: Srsf5 (serine/arginine-rich splicing factor 5 [Source:MGI Symbol;Acc:MGI:98287])

HSP 1 Score: 157.532 bits (397), Expect = 2.468e-44
Identity = 91/185 (49.19%), Postives = 126/185 (68.11%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R+++G L     E+D+++FF+ YGRIR +D+K G+GFVE +D RDA+DAV++LDG +L  ERVT+E AR+ +R G  RG   DR        + R              P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVTFADAH+ + N+GVVEF++  D+K AIEK  G E+ G K+K+ E
Sbjct:    5 RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNA-----------PPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIE 178          
BLAST of Serine/arginine-rich splicing factor 4 vs. UniProt/SwissProt
Match: sp|P26686|SRR55_DROME (Serine-arginine protein 55 OS=Drosophila melanogaster OX=7227 GN=B52 PE=1 SV=4)

HSP 1 Score: 177.948 bits (450), Expect = 5.147e-50
Identity = 98/187 (52.41%), Postives = 127/187 (67.91%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+YVG LP  + ERD+++FF+ YGR R + IKNGYGFVE +D RDA+DAV++L+G +LLGERV VE AR  AR           GGR         +   +    +    P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVT+ADAHK R N+GVVEF++ SDMK AIEK D  EL G ++ + ED
Sbjct:    5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVED 191          
BLAST of Serine/arginine-rich splicing factor 4 vs. UniProt/SwissProt
Match: sp|Q13247|SRSF6_HUMAN (Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 1.608e-47
Identity = 94/188 (50.00%), Postives = 126/188 (67.02%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YGR+  VD+KNGYGFVE +D RDA+DAV++L+G +L GERV VE AR             D    G  +    Y SR +  R     P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A++K DG E+ G  +++ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARG-------PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. UniProt/SwissProt
Match: sp|Q08170|SRSF4_HUMAN (Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 2.628e-47
Identity = 93/188 (49.47%), Postives = 120/188 (63.83%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L  +  ERD+++FF+ YG+I  VD+KNGYGFVE DD RDA+DAV++L+G  L GERV VE AR                  G               R     P R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A+EK DG E+ G K+++ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARG-------------PRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor 4 vs. UniProt/SwissProt
Match: sp|Q8VE97|SRSF4_MOUSE (Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.683e-47
Identity = 93/188 (49.47%), Postives = 120/188 (63.83%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L  +  ERD+++FF+ YG+I  VD+KNGYGFVE DD RDA+DAV++L+G  L GERV VE AR                  G               R     P R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A+EK DG E+ G K+++ ED
Sbjct:    1 MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARG-------------PRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175          
BLAST of Serine/arginine-rich splicing factor 4 vs. UniProt/SwissProt
Match: sp|Q3B7L6|SRSF6_BOVIN (Serine/arginine-rich splicing factor 6 OS=Bos taurus OX=9913 GN=SRSF6 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.033e-47
Identity = 93/188 (49.47%), Postives = 125/188 (66.49%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YGR+  +D+KNGYGFVE +D RDA+DAV++L+G +L GERV VE AR             D    G  +    Y SR +  R     P+R+E R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDMK A++K DG E+ G  +++ ED
Sbjct:    1 MPRVYIGRLSYNVREKDIQRFFSGYGRLLGIDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARG-------PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEFRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. TrEMBL
Match: A0A5C6NY23 (Serine/arginine-rich splicing factor 5 OS=Takifugu flavidus OX=433684 GN=D4764_16G0002350 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 4.056e-53
Identity = 100/186 (53.76%), Postives = 130/186 (69.89%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G+L     ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G +L  ERVT+E ARS    GG  G G   GG G                     P+R+EHR+IV +LSSR+SWQDLKD+MRK GEVTF DAH+   N+GVVEF++ SDMK+AI K+DG EL G KLKV+ED
Sbjct:    5 RVFIGHLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGRFGGGGGGGGGGGGGYRPSRSSGPRYGPPVRTEHRLIVENLSSRISWQDLKDMMRKAGEVTFVDAHRPNKNEGVVEFASRSDMKSAISKFDGTELNGRKLKVFED 190          
BLAST of Serine/arginine-rich splicing factor 4 vs. TrEMBL
Match: A0A4Z2DVW6 (Serine/arginine-rich splicing factor 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_003396 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 3.287e-52
Identity = 103/190 (54.21%), Postives = 128/190 (67.37%), Query Frame = 3
Query:   81 FKMPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            FKM R+YVG +P R  ERDI++FF+ YGR+R + +KNGYGFVE D+ +DA+DAV+DL G  L GER+ VE AR         G+ G     G            S        P R+E+R+IV +LSSRVSWQDLKDLMRK GEVT+ADAHK   N G+VEF+  +DMK AIEK+DGYELYG +L+VYED
Sbjct:    8 FKMSRVYVGRIPPRCTERDIERFFKGYGRLRDIVLKNGYGFVEFDNEKDADDAVYDLHGRDLRGERLIVEHAR------LPPGTRGGSRRAGGGGGGGGGGGGGSGRDRRYGPPTRTEYRVIVENLSSRVSWQDLKDLMRKAGEVTYADAHKSAKNDGIVEFAAYADMKEAIEKFDGYELYGRRLRVYED 191          
BLAST of Serine/arginine-rich splicing factor 4 vs. TrEMBL
Match: A0A4S2LP49 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005846 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.514e-52
Identity = 98/188 (52.13%), Postives = 123/188 (65.43%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            M R+Y+G+LP R  ERDI++FF+ YGR+R V +KNGYGFVE D+ +DA+DAV+DL G +L GER+ VE AR                                        P R+E+R++V +LSSRVSWQDLKDLMRK G+VT+ADAHK   N G+VEFS  +DMK AIEK+DGYELYG KL+VYED
Sbjct:    1 MSRVYIGHLPARCSERDIERFFKGYGRLRDVVLKNGYGFVEFDNEKDADDAVYDLHGRELRGERIIVEHAR------------------LPPGSRGGSRRSGGGRDRRYGPPTRTEYRVVVENLSSRVSWQDLKDLMRKAGDVTYADAHKSARNDGIVEFSQYADMKEAIEKFDGYELYGRKLRVYED 170          
BLAST of Serine/arginine-rich splicing factor 4 vs. TrEMBL
Match: A0A419QAN3 (Serine/arginine-rich splicing factor 4 OS=Clonorchis sinensis OX=79923 GN=Srsf4 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.514e-52
Identity = 98/188 (52.13%), Postives = 123/188 (65.43%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            M R+Y+G+LP R  ERDI++FF+ YGR+R V +KNGYGFVE D+ +DA+DAV+DL G +L GER+ VE AR                                        P R+E+R++V +LSSRVSWQDLKDLMRK G+VT+ADAHK   N G+VEFS  +DMK AIEK+DGYELYG KL+VYED
Sbjct:    1 MSRVYIGHLPARCSERDIERFFKGYGRLRDVVLKNGYGFVEFDNEKDADDAVYDLHGRELRGERIIVEHAR------------------LPPGSRGGSRRSGGGRDRRYGPPTRTEYRVVVENLSSRVSWQDLKDLMRKAGDVTYADAHKSARNDGIVEFSQYADMKEAIEKFDGYELYGRKLRVYED 170          
BLAST of Serine/arginine-rich splicing factor 4 vs. TrEMBL
Match: A0A1S8WLU0 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_08917 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 5.002e-52
Identity = 100/188 (53.19%), Postives = 126/188 (67.02%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            M R+Y+G+LP R  ERDI++FF+ YGR+R V +KNGYGFVE D+ +DA+DAV+DL G +L GER+ VE AR                       +     R    R     P R+E+R++V +LSSRVSWQDLKDLMRK G+VT+ADAHK   N G+VEFS  +DMK AIEK+DGYELYG KL+VYED
Sbjct:    1 MSRVYIGHLPARCSERDIERFFKGYGRLRDVVLKNGYGFVEFDNEKDADDAVYDLHGRELRGERIIVEHAR-------------------LPPGSRGGSRRSGGGRDRYGPPTRTEYRVVVENLSSRVSWQDLKDLMRKAGDVTYADAHKSARNDGIVEFSQYADMKEAIEKFDGYELYGRKLRVYED 169          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Cavefish
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:103034457])

HSP 1 Score: 178.333 bits (451), Expect = 2.714e-52
Identity = 99/186 (53.23%), Postives = 130/186 (69.89%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L     ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G +L  ERVT+E ARS    GG  G GG R    F        +           P+R+EHRI+V +LSSR+SWQDLKDLMRKVG+VTF DAH+   N+GVVEF++ SDMK AIEK DG +L G K+K++ED
Sbjct:    5 RVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELCSERVTIEHARSRRGRGGGPGMGGGRFSPRFGGYRQSRSAGSRYG-----PPVRTEHRIVVENLSSRISWQDLKDLMRKVGDVTFVDAHRTNKNEGVVEFASHSDMKNAIEKLDGTDLNGRKIKLFED 185          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Cavefish
Match: srsf6a (serine and arginine rich splicing factor 6a [Source:ZFIN;Acc:ZDB-GENE-040426-2824])

HSP 1 Score: 173.326 bits (438), Expect = 2.716e-49
Identity = 93/188 (49.47%), Postives = 126/188 (67.02%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YG++  VD+KNGYGFVE +D RDA+DAV++L+G +L GERV VE AR   R     G GG  GG       +               P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R N+GV+EF + SDM+ A+EK DG ++ G K+++ ED
Sbjct:    1 MPRVYIGRLSYHVREKDIQRFFGGYGKLLEVDLKNGYGFVEFEDTRDADDAVYELNGKELCGERVMVEHARGPRRDRDGYGGGGYYGGGRSKCGYSSRSRSGRDKYG---PPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSQSDMRRALEKLDGTDINGRKIRLVED 185          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Cavefish
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:103034457])

HSP 1 Score: 169.088 bits (427), Expect = 5.626e-49
Identity = 89/186 (47.85%), Postives = 119/186 (63.98%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L     ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G +L  ER  V                            N +D            P+R+EHRI+V +LSSR+SWQDLKDLMRKVG+VTF DAH+   N+GVVEF++ SDMK AIEK DG +L G K+K++ED
Sbjct:    5 RVFIGRLSPHARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELCSERYGV-----------------CDWTECIKASYNNHDDSSFFSLPRYGPPVRTEHRIVVENLSSRISWQDLKDLMRKVGDVTFVDAHRTNKNEGVVEFASHSDMKNAIEKLDGTDLNGRKIKLFED 173          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Cavefish
Match: srsf5b (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:103029514])

HSP 1 Score: 167.162 bits (422), Expect = 3.504e-48
Identity = 93/185 (50.27%), Postives = 126/185 (68.11%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R+++G L     E+D+++FF+ YGRIR +D+K G+GFVE DD RDAEDAV++LDG +L  ERVT+E AR                GRG   R      R S+D   +  P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVTFADAH+ + N+GVVEF++ SD+K A+EK  G E+ G K+K+ E
Sbjct:    5 RIFIGRLNPSAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR---------VRLRGGRGRGGGGRFPDRYGRGSQDSRRNPPPMRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASHSDLKNALEKLSGKEINGRKIKLIE 180          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Cavefish
Match: srsf5b (serine/arginine-rich splicing factor 5 [Source:NCBI gene;Acc:103029514])

HSP 1 Score: 167.162 bits (422), Expect = 3.504e-48
Identity = 93/185 (50.27%), Postives = 126/185 (68.11%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R+++G L     E+D+++FF+ YGRIR +D+K G+GFVE DD RDAEDAV++LDG +L  ERVT+E AR                GRG   R      R S+D   +  P+R+E+R+IV +LSSRVSWQDLKD MR+ GEVTFADAH+ + N+GVVEF++ SD+K A+EK  G E+ G K+K+ E
Sbjct:    5 RIFIGRLNPSAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR---------VRLRGGRGRGGGGRFPDRYGRGSQDSRRNPPPMRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASHSDLKNALEKLSGKEINGRKIKLIE 180          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Sea Lamprey
Match: SRSF5 (serine and arginine rich splicing factor 5 [Source:HGNC Symbol;Acc:HGNC:10787])

HSP 1 Score: 156.377 bits (394), Expect = 1.716e-44
Identity = 84/189 (44.44%), Postives = 118/189 (62.43%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARS---NAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++  L   +  +D++KFF+ YG+IR +DIK G+GFVE DD RDA+DAV DL+G +L  ER+TVE AR+                     +  R     S  +        P R++HR++V +LSS VSWQDLKD MR+ GEVTFADAH++  N GVVEF+  +DMK AI+K +G E+ G K+K+ E+
Sbjct:    6 RVFIARLGPHVRTKDVEKFFKGYGKIRDIDIKAGFGFVEFDDCRDADDAVSDLNGRELNNERMTVEHARAPRARGDRMDTFVRRPSGPPPTYRPRGGGPSSSSASSGGRYGPPSRTDHRLVVENLSSTVSWQDLKDYMRQAGEVTFADAHRIHQNVGVVEFATRNDMKNAIDKLNGKEINGRKIKLVEE 194          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010377.1 (pep scaffold:Pmarinus_7.0:GL481287:28:8451:-1 gene:ENSPMAG00000009397.1 transcript:ENSPMAT00000010377.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 6.947e-40
Identity = 80/188 (42.55%), Postives = 116/188 (61.70%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            M R+Y+GNL  R  ++DI++FF+ YG+I  + IK+G+GFVE DD RDA DAV +L G +L GERV +E AR                G G         S           P R+++R++V ++SSR SWQDLKD MR+ GEVT+AD   +R ++GVVEF   +DM+ A++K DG ++YG K+++ E+
Sbjct:    1 MSRIYLGNLSYRARDKDIERFFKGYGKIVEISIKHGFGFVEFDDTRDANDAVCELSGRELCGERVVIEHARG-------PKRDLHGYGGGGGGGGGGSSSSGGGYGGMHGPPPRTDYRLVVENVSSRCSWQDLKDYMRQAGEVTYAD---VRGDEGVVEFLTYADMRRALDKLDGSDMYGRKIRLTEE 178          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008861.1 (pep scaffold:Pmarinus_7.0:GL476733:183781:191694:-1 gene:ENSPMAG00000008001.1 transcript:ENSPMAT00000008861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 4.132e-33
Identity = 77/188 (40.96%), Postives = 112/188 (59.57%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            M RLY+G L  +  E+DI++F R +G+I  + +KNGY FVE++D RDA+ AV++L+G  L G+ V VE AR         G+    GGR    R                 PIR+E+R++V +LS+R   + LKD +R+ GEV + +AH  R N+G VEF    DMK A+++ DG EL+G KLK+ E+
Sbjct:    1 MARLYLGKLSYKASEKDIERFLRGFGKIVEISLKNGYAFVELEDGRDADSAVYELNGRDLCGDPVVVEHARGRPGGPLGVGASSIFGGRSGLYRP----------------PIRTEYRLVVENLSTRCDAEQLKDSLRRAGEVMYGEAHVERDNEGFVEFRTFVDMKRALDELDGMELFGRKLKLREE 172          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006373.1 (pep scaffold:Pmarinus_7.0:GL478975:164155:166212:-1 gene:ENSPMAG00000005755.1 transcript:ENSPMAT00000006373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 7.835e-11
Identity = 31/71 (43.66%), Postives = 44/71 (61.97%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDI---KNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMA 296
            ++YVGNL     E D++K F  YG +RSV +     G+ FV+ +D RDA D+  +LDG  + G RV VEM+
Sbjct:   16 KVYVGNLGSGATEYDLEKVFSYYGPLRSVWVARNPPGFAFVQFEDARDARDSCRELDGRLVCGSRVRVEMS 86          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Sea Lamprey
Match: srsf3a (serine and arginine rich splicing factor 3a [Source:ZFIN;Acc:ZDB-GENE-030616-631])

HSP 1 Score: 57.3806 bits (137), Expect = 4.720e-10
Identity = 31/71 (43.66%), Postives = 44/71 (61.97%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDI---KNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMA 296
            ++YVGNL     + ++++ F  YG +RSV +     G+ FVE +D RDA DAV +LDG  L G RV VE +
Sbjct:   16 KVYVGNLGNNGNKAELERSFSYYGPLRSVWVARAPPGFAFVEFEDPRDAGDAVRELDGRTLCGSRVRVEHS 86          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Yeast
Match: HRB1 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; HRB1 has a paralog, GBP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004949])

HSP 1 Score: 60.8474 bits (146), Expect = 1.896e-10
Identity = 48/192 (25.00%), Postives = 77/192 (40.10%), Query Frame = 3
Query:   96 LYVGNLPRRIEERDIKKFFREYGRIRSVDI------KNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFA----DAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKV 641
            ++VGNL       D+ +FF + G++   DI        G G VE  +  D + A+   DG+  +  ++ V                        +   +              +  R  H +IV +L + V+WQ LKD+ ++ G V  A    D   +    G V F +  D+  AIEKY+GY + G  L V
Sbjct:  163 IFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHHRGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQ---------------------DNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDV 333          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Yeast
Match: NAB3 (RNA-binding protein, subunit of Nrd1 complex (Nrd1p-Nab3p-Sen1p); complex interacts with exosome to mediate 3'-end formation of some mRNAs, snRNAs, snoRNAs, and CUTs; required for termination of non-poly(A) transcripts and efficient splicing; Nrd1-Nab3 pathway appears to have a role in rapid suppression of some genes when cells are shifted to poor growth conditions, indicating role for Nrd1-Nab3 in regulating cellular response to nutrient availability [Source:SGD;Acc:S000006111])

HSP 1 Score: 58.5362 bits (140), Expect = 1.206e-9
Identity = 24/73 (32.88%), Postives = 45/73 (61.64%), Query Frame = 3
Query:   93 RLYVGNLP-RRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNA 308
            RL++GNLP + + + D+ + F  YG I  ++IKN +GF++ D+ +   DA+         G+++ +E++ SNA
Sbjct:  331 RLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAIECESQEMNFGKKLILEVSSSNA 403          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Nematostella
Match: EDO39290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ5])

HSP 1 Score: 163.31 bits (412), Expect = 5.105e-48
Identity = 91/188 (48.40%), Postives = 118/188 (62.77%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            M R+++G LPR + E D++KF R YG+IR + +K GYGFVE DD RDAEDAVHDL+G  L+GERV VE ++               GG       +    RD   R     P+R+ + +IV +LSSR SWQDLKD  RK G+VT+ADAHK R  +GVVEF +  D+  AIEK D  EL G +++VYED
Sbjct:    1 MSRIFLGRLPRDVRESDVEKFLRGYGKIRDISLKRGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSKGR----------RSEGGGRDRRDFSGRGGRDGGRRPIYGPPVRTNYSVIVENLSSRTSWQDLKDYFRKYGKVTYADAHKKRIGEGVVEFESKDDLNTAIEKLDDTELGGRRIRVYED 178          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Nematostella
Match: EDO32443 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV28])

HSP 1 Score: 160.614 bits (405), Expect = 4.351e-47
Identity = 87/183 (47.54%), Postives = 113/183 (61.75%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKV 641
            R+Y G LPR   ERD++KF R YGR+R + +K GYGFVE DD RDA+D V+DL+G  LLGERV VE +R+ +R                  R                 PIR+EHR+ V +LSSR +WQDLK+ M KVGEVTFADAHK R  +GVVEF+   DMK A++K D  E +G ++++
Sbjct:    6 RVYFGRLPRDCRERDLEKFVRGYGRVREISMKLGYGFVEFDDYRDADDCVYDLNGRNLLGERVVVEHSRNPSRGSDYGYRRDSSSRSRSSRRGRT-------------PPIRTEHRLAVENLSSRSNWQDLKEYMGKVGEVTFADAHKRRQGEGVVEFATKDDMKTALKKLDDTEFFGKRIRL 175          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Nematostella
Match: EDO47549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM69])

HSP 1 Score: 142.124 bits (357), Expect = 2.796e-40
Identity = 80/185 (43.24%), Postives = 112/185 (60.54%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGR--IRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKV 641
            R+Y+G LP    E D+KKFF  YGR  IR + +K+GYGFVE D   DAEDAV++ +G K+LGER+ VE AR  ++ G   G  G    +                      P+R+  R+ V +LSSRVSWQDLKD  R++G+VT+ DAHK +  +GV+EF+   D+K A+ K DG EL G ++++
Sbjct:    4 RVYLGRLPYGTREDDVKKFFYTYGRFKIREIILKDGYGFVEFDYSDDAEDAVYECNGKKMLGERILVEPARGTSKGGYSSGRRGRARDKYG-------------------PPLRTPWRMTVENLSSRVSWQDLKDYCRQIGDVTYGDAHKQKQGEGVIEFATKKDLKKALRKLDGKELKGKRIRL 169          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Nematostella
Match: EDO47776 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL13])

HSP 1 Score: 130.954 bits (328), Expect = 5.089e-36
Identity = 82/185 (44.32%), Postives = 115/185 (62.16%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R++VG LP R  +RD++KFF+ +GRI  +++K G+ FVE DD RDA+DAV++L+  +LLGERV+VE A  +   GG  G G        D                   P  +E+R+IV +LS+R  WQDLKD MR+ GEVTF   HK R  +GV +FSN SDM  A++K DG EL+G ++++ E
Sbjct:    7 RVFVGRLPPRANDRDLEKFFKGFGRINDINLKQGFAFVEFDDARDADDAVYELNHKELLGERVSVEHAHPSRGGGGGGGRGFRDRSPRRDRY----------------PPYNTEYRLIVENLSTRAGWQDLKDYMRQAGEVTFTQCHKDRVGEGVCDFSNESDMLYALKKLDGTELFGKRIRLVE 175          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Nematostella
Match: EDO31620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXE8])

HSP 1 Score: 115.161 bits (287), Expect = 3.795e-30
Identity = 59/186 (31.72%), Postives = 95/186 (51.08%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            ++Y G LP    E+D++   + +G++R VD K GY +V   + +DA+ AV  L+ S+  G ++ +E A+                               +        P+RSE R+IV +LS+R  W +LK+ M   GEV +AD H+ RP +GVVEF+   DMK AI   D  E YG ++++ ++
Sbjct:    4 KVYCGRLPATATEKDLENLVKVFGKVREVDFKEGYAYVVFKENKDADRAVAALNNSEFHGAKILMEKAKE----------------MRNGVGGYTAAGGYTARTRQMGPPVRSEFRVIVENLSTRAKWLELKEFMNNAGEVCYADTHRRRPGEGVVEFTTEEDMKRAIASLDKCEFYGKRIRLRQE 173          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 184.111 bits (466), Expect = 1.394e-54
Identity = 99/186 (53.23%), Postives = 129/186 (69.35%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L  +  ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G +LL ERVT+E ARS    GG        GG    +RN                P+R+EHR+IV +LSSR+SWQDLKDLMRK GEVTF DAH+   N+GVVEF++ SD+K AI K DG EL G KLK++ED
Sbjct:    5 RVFIGRLSPQARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELLSERVTIEHARSRRGRGGGPPGMARFGGGYRQSRNTGSRYG---------PPVRTEHRLIVENLSSRISWQDLKDLMRKAGEVTFVDAHRPTKNEGVVEFASRSDLKNAISKLDGTELNGRKLKIFED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 184.111 bits (466), Expect = 3.521e-54
Identity = 99/186 (53.23%), Postives = 129/186 (69.35%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L  +  ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G +LL ERVT+E ARS    GG        GG    +RN                P+R+EHR+IV +LSSR+SWQDLKDLMRK GEVTF DAH+   N+GVVEF++ SD+K AI K DG EL G KLK++ED
Sbjct:    5 RVFIGRLSPQARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELLSERVTIEHARSRRGRGGGPPGMARFGGGYRQSRNTGSRYG---------PPVRTEHRLIVENLSSRISWQDLKDLMRKAGEVTFVDAHRPTKNEGVVEFASRSDLKNAISKLDGTELNGRKLKIFED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Medaka
Match: srsf5a (serine and arginine rich splicing factor 5 [Source:NCBI gene;Acc:101161448])

HSP 1 Score: 184.111 bits (466), Expect = 3.521e-54
Identity = 99/186 (53.23%), Postives = 129/186 (69.35%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            R+++G L  +  ERD++KFF+ YGRIR +++KNG+GFVE DD RDA+DAV++L+G +LL ERVT+E ARS    GG        GG    +RN                P+R+EHR+IV +LSSR+SWQDLKDLMRK GEVTF DAH+   N+GVVEF++ SD+K AI K DG EL G KLK++ED
Sbjct:    5 RVFIGRLSPQARERDVEKFFKGYGRIREINLKNGFGFVEFDDHRDADDAVYELNGKELLSERVTIEHARSRRGRGGGPPGMARFGGGYRQSRNTGSRYG---------PPVRTEHRLIVENLSSRISWQDLKDLMRKAGEVTFVDAHRPTKNEGVVEFASRSDLKNAISKLDGTELNGRKLKIFED 181          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Medaka
Match: srsf5b (serine/arginine-rich splicing factor 5-like [Source:NCBI gene;Acc:105357348])

HSP 1 Score: 167.162 bits (422), Expect = 1.578e-47
Identity = 88/185 (47.57%), Postives = 123/185 (66.49%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYE 647
            R+++G L     E+D+++FF+ YGRIR +D+K G+GFVE DD RDAEDAV++LDG +L  ERVT+E AR        R   G   G G         +        +  P+R+E+R++V +LSSRVSWQDLKD MR+ GEVTFADAH+ + N+GVVEF++ SD+K A++K  G E+ G K+K+ E
Sbjct:    5 RIFIGRLSPSAREKDVERFFKGYGRIRDIDLKRGFGFVEFDDPRDAEDAVYELDGKELCNERVTIEHAR-------VRLRAGRGRGGGGGGGGGGRFNDRYSRGSRNPPPMRTENRLVVKNLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYSDLKNALDKLSGKEINGRKIKLME 182          
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Medaka
Match: srsf6a (serine and arginine rich splicing factor 6 [Source:NCBI gene;Acc:101162527])

HSP 1 Score: 158.688 bits (400), Expect = 2.642e-44
Identity = 82/189 (43.39%), Postives = 116/189 (61.38%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVT-VEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPR+Y+G L   + E+DI++FF  YG++  VD+KNGYGFVE +D RDA+DAV++L+G +L G+  +   + R                                        P+R+E+R+IV +LSSR SWQDLKD MR+ GEVT+ADAHK R NQGV+EF + SDMK A++K DG ++ G K+++ ED
Sbjct:    1 MPRVYIGRLSYHVREKDIQRFFSGYGKLLEVDMKNGYGFVEFEDNRDADDAVYELNGKELCGDSSSRTRVGRDK-----------------------------------YGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNQGVIEFRSYSDMKRALDKLDGTDINGRKIRLVED 154          
BLAST of Serine/arginine-rich splicing factor 4 vs. Planmine SMEST
Match: SMESG000045501.1 (SMESG000045501.1)

HSP 1 Score: 297.36 bits (760), Expect = 3.179e-97
Identity = 188/188 (100.00%), Postives = 188/188 (100.00%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNARFGGDRGSGGDRGGRGFDNRNNRYDSRDSRDRYNSRKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED
Sbjct:    1 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNARFGGDRGSGGDRGGRGFDNRNNRYDSRDSRDRYNSRKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 188          
BLAST of Serine/arginine-rich splicing factor 4 vs. Planmine SMEST
Match: SMESG000015564.1 (SMESG000015564.1)

HSP 1 Score: 179.489 bits (454), Expect = 3.367e-52
Identity = 92/188 (48.94%), Postives = 123/188 (65.43%), Query Frame = 3
Query:   87 MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYED 650
            M R+++G L  R  ERD+++FF+ YGRI+ + +K+GYGFVE D+ RDA+DA+HDL   +L G RV +E ARS  R      S     G                       PIR+++R++V +L SRVSWQDLKDLMRK GEV FADAHK R N+G+VEF   +DMKAA++K+DGYE+ G KL++YED
Sbjct:    1 MARVFIGRLSDRASERDVERFFKGYGRIKDIRLKSGYGFVEFDNERDADDAIHDLHHKELAGGRVVLEHARSGRRSPRRFDSSRRFAGNA---------------------PIRTDYRLLVENLPSRVSWQDLKDLMRKTGEVMFADAHKRRQNEGIVEFKTRADMKAALKKFDGYEISGRKLRIYED 167          
BLAST of Serine/arginine-rich splicing factor 4 vs. Planmine SMEST
Match: SMESG000077573.1 (SMESG000077573.1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.701e-22
Identity = 68/176 (38.64%), Postives = 86/176 (48.86%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKN----GYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYD 608
            +LYVGNLP  I  RD+   F ++G+I  +DIK+     + F+E DD RDAEDAV   +G    G R+ VE  R N    G+  S      +          SR            RSE R+ V+ L    SWQDLKD MR+ G+V  AD    R   GV EF    DMK AI+  D
Sbjct:   11 KLYVGNLPPDIRHRDLDDLFYKFGKIVDIDIKDRKKPPFAFIEFDDPRDAEDAVTGRNGYNYDGYRLRVEFPRGNNENAGNFYSNRKAEEKNLTRNTTSAPSR------------RSEFRVYVSGLPPTGSWQDLKDHMREAGDVGHADV--FRDGTGVCEFLRVEDMKYAIKHLD 172          
BLAST of Serine/arginine-rich splicing factor 4 vs. Planmine SMEST
Match: SMESG000075205.1 (SMESG000075205.1)

HSP 1 Score: 92.4337 bits (228), Expect = 4.526e-21
Identity = 69/195 (35.38%), Postives = 105/195 (53.85%), Query Frame = 3
Query:   75 SHFKMPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKN----GYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMARSNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHKLRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKV 641
            S+ +  ++YVGNLP  I   +++  F++YGRI+ VD+KN     + FVE +  RDAEDA+H  +  +  G  + VEM++ +    G R   G  G RG  N      +  S +R  +   K   +E R+ V+ L    SWQDLKD M+  G+V++AD    R   GV ++ N  D+K A++  D  EL  Y+  V
Sbjct:    2 SYGRSTKVYVGNLPSDIRANEVESVFKKYGRIKDVDVKNRAESSFAFVEYESSRDAEDAIHGRNNYRYEGHTLKVEMSKGSGSDRGGRRGSGGGGYRGSYNGRYDDRNSGSGNRPKAFGTKSKSTEFRVRVSGLPQSASWQDLKDHMKAAGDVSYADV--FRDGTGVCDYLNEDDLKYALKTLDDSELKTYRGDV 194          
BLAST of Serine/arginine-rich splicing factor 4 vs. Planmine SMEST
Match: SMESG000006493.1 (SMESG000006493.1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.417e-14
Identity = 35/71 (49.30%), Postives = 51/71 (71.83%), Query Frame = 3
Query:   93 RLYVGNLPRRIEERDIKKFFREYGRIRSVDIKN---GYGFVEIDDRRDAEDAVHDLDGSKLLGERVTVEMA 296
            ++YVG+LP+   E++I+K F+++G I+SV +     G+ FV  DD RDAEDAV +LDGS + G RV VEM+
Sbjct:    9 KVYVGDLPKDANEKEIEKAFKDFGPIKSVWVARNPAGFAFVMFDDYRDAEDAVKELDGSVICGVRVRVEMS 79          
The following BLAST results are available for this feature:
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRSF61.490e-4950.00serine and arginine rich splicing factor 6 [Source... [more]
SRSF63.271e-4950.00serine and arginine rich splicing factor 6 [Source... [more]
SRSF65.031e-4950.00serine and arginine rich splicing factor 6 [Source... [more]
SRSF46.240e-4949.47serine and arginine rich splicing factor 4 [Source... [more]
SRSF63.348e-4850.00serine and arginine rich splicing factor 6 [Source... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsp-16.462e-4043.94Probable splicing factor, arginine/serine-rich 1 ... [more]
rsp-24.791e-3638.10Probable splicing factor, arginine/serine-rich 2 ... [more]
rsp-16.567e-2341.26Probable splicing factor, arginine/serine-rich 1 ... [more]
rsp-16.567e-2341.26Probable splicing factor, arginine/serine-rich 1 ... [more]
rsp-31.034e-2137.84Probable splicing factor, arginine/serine-rich 3 ... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B524.220e-5152.41gene:FBgn0004587 transcript:FBtr0082802[more]
B525.063e-5152.41gene:FBgn0004587 transcript:FBtr0308197[more]
B525.063e-5152.41gene:FBgn0004587 transcript:FBtr0308195[more]
B527.153e-5153.76gene:FBgn0004587 transcript:FBtr0082801[more]
B527.153e-5153.76gene:FBgn0004587 transcript:FBtr0308196[more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf5a4.347e-5455.91serine and arginine rich splicing factor 5a [Sourc... [more]
srsf5a4.347e-5455.91serine and arginine rich splicing factor 5a [Sourc... [more]
srsf5a9.750e-4847.93serine and arginine rich splicing factor 5a [Sourc... [more]
srsf6b1.278e-4747.34serine and arginine rich splicing factor 6b [Sourc... [more]
srsf5b1.351e-4750.27serine and arginine rich splicing factor 5b [Sourc... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fnbp1l2.431e-5053.76formin binding protein 1 like [Source:Xenbase;Acc:... [more]
fnbp1l2.436e-5053.76formin binding protein 1 like [Source:Xenbase;Acc:... [more]
srsf52.352e-4749.19serine/arginine-rich splicing factor 5 [Source:NCB... [more]
grm61.255e-4545.74glutamate receptor, metabotropic 6 [Source:Xenbase... [more]
grm61.387e-4545.74glutamate receptor, metabotropic 6 [Source:Xenbase... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srsf44.320e-4849.47serine/arginine-rich splicing factor 4 [Source:MGI... [more]
Srsf63.059e-4748.94serine/arginine-rich splicing factor 6 [Source:MGI... [more]
Srsf52.468e-4449.19serine/arginine-rich splicing factor 5 [Source:MGI... [more]
Srsf52.468e-4449.19serine/arginine-rich splicing factor 5 [Source:MGI... [more]
Srsf52.468e-4449.19serine/arginine-rich splicing factor 5 [Source:MGI... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26686|SRR55_DROME5.147e-5052.41Serine-arginine protein 55 OS=Drosophila melanogas... [more]
sp|Q13247|SRSF6_HUMAN1.608e-4750.00Serine/arginine-rich splicing factor 6 OS=Homo sap... [more]
sp|Q08170|SRSF4_HUMAN2.628e-4749.47Serine/arginine-rich splicing factor 4 OS=Homo sap... [more]
sp|Q8VE97|SRSF4_MOUSE2.683e-4749.47Serine/arginine-rich splicing factor 4 OS=Mus musc... [more]
sp|Q3B7L6|SRSF6_BOVIN5.033e-4749.47Serine/arginine-rich splicing factor 6 OS=Bos taur... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5C6NY234.056e-5353.76Serine/arginine-rich splicing factor 5 OS=Takifugu... [more]
A0A4Z2DVW63.287e-5254.21Serine/arginine-rich splicing factor 4 OS=Schistos... [more]
A0A4S2LP493.514e-5252.13Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419QAN33.514e-5252.13Serine/arginine-rich splicing factor 4 OS=Clonorch... [more]
A0A1S8WLU05.002e-5253.19Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf5a2.714e-5253.23serine and arginine rich splicing factor 5 [Source... [more]
srsf6a2.716e-4949.47serine and arginine rich splicing factor 6a [Sourc... [more]
srsf5a5.626e-4947.85serine and arginine rich splicing factor 5 [Source... [more]
srsf5b3.504e-4850.27serine/arginine-rich splicing factor 5 [Source:NCB... [more]
srsf5b3.504e-4850.27serine/arginine-rich splicing factor 5 [Source:NCB... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRSF51.716e-4444.44serine and arginine rich splicing factor 5 [Source... [more]
ENSPMAT00000010377.16.947e-4042.55pep scaffold:Pmarinus_7.0:GL481287:28:8451:-1 gene... [more]
ENSPMAT00000008861.14.132e-3340.96pep scaffold:Pmarinus_7.0:GL476733:183781:191694:-... [more]
ENSPMAT00000006373.17.835e-1143.66pep scaffold:Pmarinus_7.0:GL478975:164155:166212:-... [more]
srsf3a4.720e-1043.66serine and arginine rich splicing factor 3a [Sourc... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HRB11.896e-1025.00Poly(A+) RNA-binding protein; key surveillance fac... [more]
NAB31.206e-932.88RNA-binding protein, subunit of Nrd1 complex (Nrd1... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO392905.105e-4848.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324434.351e-4747.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475492.796e-4043.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477765.089e-3644.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316203.795e-3031.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srsf5a1.394e-5453.23serine and arginine rich splicing factor 5 [Source... [more]
srsf5a3.521e-5453.23serine and arginine rich splicing factor 5 [Source... [more]
srsf5a3.521e-5453.23serine and arginine rich splicing factor 5 [Source... [more]
srsf5b1.578e-4747.57serine/arginine-rich splicing factor 5-like [Sourc... [more]
srsf6a2.642e-4443.39serine and arginine rich splicing factor 6 [Source... [more]
back to top
BLAST of Serine/arginine-rich splicing factor 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045501.13.179e-97100.00SMESG000045501.1[more]
SMESG000015564.13.367e-5248.94SMESG000015564.1[more]
SMESG000077573.18.701e-2238.64SMESG000077573.1[more]
SMESG000075205.14.526e-2135.38SMESG000075205.1[more]
SMESG000006493.12.417e-1449.30SMESG000006493.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029555 ID=SMED30029555|Name=Serine/arginine-rich splicing factor 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1402bp
AGAAATACCAAAATCATAAAATTGTGATGTGGAATGCATTTTGTTTAAAT
TAACTTAAATTTATTTCACTTGATAGCCATTTTAAGATGCCTCGTTTATA
TGTTGGGAATTTGCCAAGAAGAATAGAAGAGCGTGATATTAAAAAGTTTT
TTAGAGAATATGGTCGAATTCGAAGTGTTGATATAAAAAATGGATATGGA
TTCGTAGAAATTGATGATCGTAGAGATGCTGAAGATGCTGTTCACGATTT
AGATGGATCAAAATTGCTTGGTGAACGTGTTACGGTTGAGATGGCTCGGT
CGAATGCTAGATTTGGTGGTGATAGAGGTAGTGGTGGCGACAGAGGTGGA
CGAGGCTTCGATAATAGAAATAATCGATATGATAGTAGGGATTCCCGTGA
CAGGTACAATTCTAGAAAACCTATAAGATCCGAGCACCGAATTATTGTTA
ATGATTTATCATCCAGAGTTAGCTGGCAAGACTTGAAAGATCTAATGCGA
AAAGTTGGTGAAGTAACTTTCGCAGATGCGCACAAGTTGAGACCAAATCA
AGGTGTTGTCGAATTTTCAAATAGTTCCGATATGAAAGCCGCTATTGAGA
AATATGACGGTTATGAGCTGTATGGATATAAATTAAAAGTATACGAAGAT
CGCGGAGGAGGAATGAAACGCAAAAGCAGAAGTCGATCTTATCATCGTCG
CCGCAGCAACAGCAGATCCAAATCTGGAAGCCGATCACGAAGCAAGTCTA
GTAGGAAACGTTCAAGAAGTCGAAGACGTTCATCGAGCCGCAAGCGTTCT
GATAGCAGAAAGCGGTCAACAAGTAAAAATTCCAGAAGCGCAAAATCTTA
TTCAAAATCAAAAAGCCCCGTTCAGAAATGGGCACAAGAAGATGAAGGTC
AATCTAAATCGAGGTCTAAATCCAAATCGGTTTCAAGAAGCCGATCGAGA
TCTGCTGAAGTGAACAAGGAAGGATCTGCGAAGTCGAGATCTAGATCAAA
GTCAAGATCAGCTTCCAAGGAAAGAGAAGAGCGCAGCGTTTCAAGAAGTC
GAAGTGTGAGTAAAAGTCGAAGCAGATCGAATTCGAGATGTGAGCGTGAA
TCTGTCAAATCGGCTTGCAGTGATGCAGAGGATCGACAGCATCCAGATGA
GGCAGCATCAATCGATAATGTAAATGACGTAAACATGGATTATAATTAAT
GTCATTTTTACTTGTATTTAATAGTTTTAATAAATATTGAGCAAGACTTT
ATTGAGTTACACATCTTTATTTTAATAAGGATTTCGATAACAGTTGCAAT
TATCAATTATATTTTTGCTATACAGCGTTTACCATGTACGTCTGGTACGG
CTGGATATTGAATTGTTCGGATTTTTGAGGATTAATGACGAATAAAGCTG
AG
back to top

protein sequence of SMED30029555-orf-1

>SMED30029555-orf-1 ID=SMED30029555-orf-1|Name=SMED30029555-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=371bp
MPRLYVGNLPRRIEERDIKKFFREYGRIRSVDIKNGYGFVEIDDRRDAED
AVHDLDGSKLLGERVTVEMARSNARFGGDRGSGGDRGGRGFDNRNNRYDS
RDSRDRYNSRKPIRSEHRIIVNDLSSRVSWQDLKDLMRKVGEVTFADAHK
LRPNQGVVEFSNSSDMKAAIEKYDGYELYGYKLKVYEDRGGGMKRKSRSR
SYHRRRSNSRSKSGSRSRSKSSRKRSRSRRRSSSRKRSDSRKRSTSKNSR
SAKSYSKSKSPVQKWAQEDEGQSKSRSKSKSVSRSRSRSAEVNKEGSAKS
RSRSKSRSASKEREERSVSRSRSVSKSRSRSNSRCERESVKSACSDAEDR
QHPDEAASIDNVNDVNMDYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 118..186
e-value: 5.6E-13
score: 59.1
coord: 3..68
e-value: 3.9E-18
score: 76.2
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 4..65
e-value: 3.7E-16
score: 58.7
coord: 119..184
e-value: 1.6E-10
score: 40.6
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 2..72
score: 18.24
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 117..190
score: 11.025
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..106
e-value: 2.7E-22
score: 81.3
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 116..189
e-value: 2.2E-20
score: 74.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 196..243
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 329..357
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 72..110
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 249..268
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 189..370
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 85..110
NoneNo IPR availablePANTHERPTHR23147:SF65coord: 3..246
NoneNo IPR availablePANTHERPTHR23147SERINE/ARGININE RICH SPLICING FACTORcoord: 3..246
NoneNo IPR availableCDDcd12600RRM2_SRSF4_likecoord: 117..188
e-value: 8.74881E-35
score: 120.551
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 3..187