Tektin 3

Overview
NameTektin 3
Smed IDSMED30029546
Uniprot Best hitTektin-3 OS=Homo sapiens OX=9606 GN=TEKT3 PE=1 SV=1 (E=1.73756e-128)
Length (bp)1768
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tektin 3 (SMED30029546) t-SNE clustered cells

Violin plots show distribution of expression levels for Tektin 3 (SMED30029546) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tektin 3 (SMED30029546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tektin 3 (SMED30029546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30029546SMESG000020792.1 Contig1106newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30029546SMESG000020792.1 Contig1106newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029546SMESG000020792.1 Contig1106newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029546SMESG000020792.1 Contig1106uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30029546SMESG000020792.1 Contig1106uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029546SMESG000020792.1 Contig1106uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029546SMESG000027124.1 Contig1106newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30029546SMESG000027124.1 Contig1106newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029546SMESG000027124.1 Contig1106newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029546SMESG000027124.1 Contig1106uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30029546SMESG000027124.1 Contig1106uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029546SMESG000027124.1 Contig1106uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30029546SMESG000020792.1 dd_Smed_v4_3187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029546SMESG000020792.1 dd_Smed_v4_3187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029546SMESG000020792.1 dd_Smed_v4_3187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30029546SMESG000020792.1 dd_Smed_v4_3187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029546SMESG000020792.1 dd_Smed_v6_3187_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029546SMESG000020792.1 dd_Smed_v4_3187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30029546SMESG000020792.1 dd_Smed_v4_3187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 389.037 bits (998), Expect = 3.618e-129
Identity = 218/486 (44.86%), Postives = 313/486 (64.40%), Query Frame = 1
Query:  103 PSKTLTDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNI--FSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            P  T T+F P+ ST+  SY             +L WRP+ YY+ +              +  S+  Y T  + +    +  F S R   +TRYTP+DW +S   NY  S+  R+N+EK+R+DTSR+ ++   +T++ Q D+ + LG+R+ DI F ++E+  E+D+M+ E+ AL++ K+  E++L ETE PL V +ECL++REKR GIDLVHD VE  LL EVD I  CQ+++   ++KA  QL  NRASQHELEKD  DK  A +ID     L+N+S G+ Y+ GVE VD  +S PE+W KFT++N+ RS +ER AS +LR++IE +L  T  +M  ++ +VN + + R  ETADA+NKIQ HL K LQEIF  E  IE IKK+I+DK A LKVAQTRL  R  RPN+E C D  + RL+ EVHE+ ++I  L ++L+ AE T+Q L+  K+ LE+DL VK NSL+ID+EKC+  RK++P  + ++
Sbjct:   15 PRPTPTNFLPAISTMASSYRDRFPHSNLTHSLSLPWRPSTYYKVA-------------SNSPSVAPYCTRSQRVSENTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLV 487          
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 389.037 bits (998), Expect = 3.618e-129
Identity = 218/486 (44.86%), Postives = 313/486 (64.40%), Query Frame = 1
Query:  103 PSKTLTDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNI--FSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            P  T T+F P+ ST+  SY             +L WRP+ YY+ +              +  S+  Y T  + +    +  F S R   +TRYTP+DW +S   NY  S+  R+N+EK+R+DTSR+ ++   +T++ Q D+ + LG+R+ DI F ++E+  E+D+M+ E+ AL++ K+  E++L ETE PL V +ECL++REKR GIDLVHD VE  LL EVD I  CQ+++   ++KA  QL  NRASQHELEKD  DK  A +ID     L+N+S G+ Y+ GVE VD  +S PE+W KFT++N+ RS +ER AS +LR++IE +L  T  +M  ++ +VN + + R  ETADA+NKIQ HL K LQEIF  E  IE IKK+I+DK A LKVAQTRL  R  RPN+E C D  + RL+ EVHE+ ++I  L ++L+ AE T+Q L+  K+ LE+DL VK NSL+ID+EKC+  RK++P  + ++
Sbjct:   15 PRPTPTNFLPAISTMASSYRDRFPHSNLTHSLSLPWRPSTYYKVA-------------SNSPSVAPYCTRSQRVSENTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLV 487          
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT5 (tektin 5 [Source:HGNC Symbol;Acc:HGNC:26554])

HSP 1 Score: 336.65 bits (862), Expect = 6.953e-109
Identity = 178/444 (40.09%), Postives = 277/444 (62.39%), Query Frame = 1
Query:  169 AWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            +WRP+++Y+ + V        ++                ++ P I  + R+AL++RY+P+DW +S ++    ++  R  A ++  D+ R+ ++ D  T + QE + + LG RL+DI F ++E++ E+D+++ E++ L   KR  E + +E   PL V  ECLY+REKR GIDLVHD VEKNL+ EVDL+K CQ+Q+ +L  + ++Q+  NR +QH LE+D  DK  A+ ID    +L+N+S  I++++G+E +D  IS PETW KF+N+N++ S   R  S +LREE E +       M +++ + N A + R  E  D +NK+Q  L K LQEIF  E  I  +++SI  KE PLKVAQTRL  R  RPNME C D P+ +L+ EV  I +++  L  +L++ + T+Q L+ +K  LEH+L +K N+L ID+EKC+G RKTFP
Sbjct:   49 SWRPSLFYKIANVQTCPDESTST----------------LRPPTILPTLRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLTENQNLETVKRRLECAANEVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMRDNRDAQHVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSNDNIKHSQNMRANSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQEIFQAENTIMLLERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTFP 476          
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT1 (tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534])

HSP 1 Score: 245.358 bits (625), Expect = 1.432e-74
Identity = 140/391 (35.81%), Postives = 239/391 (61.13%), Query Frame = 1
Query:  334 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYY-NGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            ++ P++W  + +  Y+ +D  R+ +E++  ++ R+  E +  T+++Q D  KKL  RL ++ F + E++D++++++  ++ L   K   EK+L   + PLH+T+ CL  REKR GIDLVHD VE  L+ E ++I+     +   + +A+ Q+ +NR++++ LEKD  DKF A  ID    SL N+SP I Y  N V    N +S  E WL F++ N++++  +R  S  L+  ++++L++T  D+ K+   V+ A     ++T DAR+K+ +HL KV++EI   EKNI  ++K+I D+E P KVA TRL  R  RPN+E C D  + RL++EV EI  ++  L   L QA+A ++ L   +  L+ ++ VK N+++ID   C+  RK+ P+
Sbjct:   10 KFLPSEWHIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWKKELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKEAEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSL-EDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIASQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSIPL 399          
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT4 (tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012])

HSP 1 Score: 227.639 bits (579), Expect = 1.377e-67
Identity = 142/390 (36.41%), Postives = 223/390 (57.18%), Query Frame = 1
Query:  331 TRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            ++Y   +W ++    Y+ +   R+ +E+ R ++ ++A E     +R Q+DS + +G+RL D +  ++E+  E++ + AE+  L   K+  E++L  TE P  +T + L  RE+R   +LV D VE  LL E +LI+  Q+ +   + +A  Q+ LNR  +   E D  DK +A  ID       + S  +  +          STPET  KFT +NL R+  ER AS  LR  ++ +L  T  D+  +   VN A  +R +E  DAR K+ +HL+K L+EI D E N+  +K++I+DKEAPL VAQTRL++R  RPNME C D  + RL+ EV E+  S+  L  +L +AE ++++L     +LE D+   TNSLFIDR+KC+  R  +P
Sbjct:   37 SKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYP 426          
BLAST of Tektin 3 vs. Ensembl Celegans
Match: R02E12.4 (pep chromosome:WBcel235:X:4005314:4007634:1 gene:WBGene00019828.1 transcript:R02E12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R02E12.4)

HSP 1 Score: 80.4925 bits (197), Expect = 5.893e-16
Identity = 90/389 (23.14%), Postives = 176/389 (45.24%), Query Frame = 1
Query:  421 LDTSRMAR----EFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGI-DLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPET-------------------WLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPV 1515
            ++  RMAR    E + R  R Q  + ++L  R+ D+ +   E++ E+  +  E + L    R  +  L  T       + CL  R K+  + D   D V+  L  E +L+     Q+ E+  +   QL +N++++  L +D   K +A  +D  + ++           G +     I TP+                    W++ T NNL  +A  R  SR++ +++ Q +      +  +   V A L    +   + ++ + + +N   +EI + +  IE I  S++ K  PL+VA +R + R  RP +E C D+ +  L +E+  ++ +  +L  QL +A+ + + L + +  L+  L++  ++L ID E     R ++P  I +
Sbjct:   11 IEIVRMARLAVKEANMRAARMQGQTTQQLMQRVKDLKYWSGEIDRELADVKEEHDDLLRCYRRLQLCLDITGRSSRCNESCLAVRRKKVQVGDHTSDRVDMELHKEKELMTDTMKQMKEIGERVERQLEVNQSARKNLLRDLTLKQEAISLDHKSVAI-----------GADGTKTVIRTPDGDRLDFREGAPLQRMSEYSEWIENTGNNLNYAARARVHSRKIGQKLCQSIREMAHQLRTEAIAVEALLKDSVRNWQEWKDNLHSQVNGKDKEIKNADGAIEEISFSLRQKSGPLQVALSRQNQRGLRPGIELCNDKAQHALHQELMMLKGTFLSLENQLDKAKESRKKLDNDRDKLQRKLDICDHNLTIDNEILRQIRTSYPHEIQL 388          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG32819 (gene:FBgn0052819 transcript:FBtr0070051)

HSP 1 Score: 322.398 bits (825), Expect = 3.539e-103
Identity = 180/456 (39.47%), Postives = 279/456 (61.18%), Query Frame = 1
Query:  160 TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFS--------SARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            T   WRPA+ Y+  +V +     V + ++         + +G+  PN+ +        +AR ALYTRYT N+W  +    Y+ S+  RN +E++R D  R+ RE D++    Q D+G++LG+R+ D+ F RNE+N E++K++AE   ++  +R   K+L + E PLH+ QECL++RE R G + VHD+VEK LL E++ ++  +D++  L  K + Q    R +QH LE D   K  +  IDS    L N S GI YY G+E  D  +ST E+W + ++ +++RS AER    +LR + + V+      +   W+  N A  +R+QE A+A+N++Q HL KV QE+FDMEK++  ++K+IQDK  PLKVAQTRL  R  R  +E C D  + RL++EV +I+ ++  L+ +L +AEAT Q LL ++  LE DL  K N+LFIDREKC+  R++FP+
Sbjct:   59 TKHPWRPAMAYELIQVKHMPEQPVTNQLTKQCFLPKGMKTDGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPV 514          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG32820 (gene:FBgn0052820 transcript:FBtr0070054)

HSP 1 Score: 322.398 bits (825), Expect = 3.539e-103
Identity = 180/456 (39.47%), Postives = 279/456 (61.18%), Query Frame = 1
Query:  160 TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFS--------SARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            T   WRPA+ Y+  +V +     V + ++         + +G+  PN+ +        +AR ALYTRYT N+W  +    Y+ S+  RN +E++R D  R+ RE D++    Q D+G++LG+R+ D+ F RNE+N E++K++AE   ++  +R   K+L + E PLH+ QECL++RE R G + VHD+VEK LL E++ ++  +D++  L  K + Q    R +QH LE D   K  +  IDS    L N S GI YY G+E  D  +ST E+W + ++ +++RS AER    +LR + + V+      +   W+  N A  +R+QE A+A+N++Q HL KV QE+FDMEK++  ++K+IQDK  PLKVAQTRL  R  R  +E C D  + RL++EV +I+ ++  L+ +L +AEAT Q LL ++  LE DL  K N+LFIDREKC+  R++FP+
Sbjct:   59 TKHPWRPAMAYELIQVKHMPEQPVTNQLTKQCFLPKGMKTDGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPV 514          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG17450 (gene:FBgn0040028 transcript:FBtr0345920)

HSP 1 Score: 322.398 bits (825), Expect = 3.539e-103
Identity = 180/456 (39.47%), Postives = 279/456 (61.18%), Query Frame = 1
Query:  160 TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFS--------SARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            T   WRPA+ Y+  +V +     V + ++         + +G+  PN+ +        +AR ALYTRYT N+W  +    Y+ S+  RN +E++R D  R+ RE D++    Q D+G++LG+R+ D+ F RNE+N E++K++AE   ++  +R   K+L + E PLH+ QECL++RE R G + VHD+VEK LL E++ ++  +D++  L  K + Q    R +QH LE D   K  +  IDS    L N S GI YY G+E  D  +ST E+W + ++ +++RS AER    +LR + + V+      +   W+  N A  +R+QE A+A+N++Q HL KV QE+FDMEK++  ++K+IQDK  PLKVAQTRL  R  R  +E C D  + RL++EV +I+ ++  L+ +L +AEAT Q LL ++  LE DL  K N+LFIDREKC+  R++FP+
Sbjct:   59 TKHPWRPAMAYELIQVKHMPEQPVTNQLTKQCFLPKGMKTDGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPV 514          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG17450 (gene:FBgn0040028 transcript:FBtr0070056)

HSP 1 Score: 322.398 bits (825), Expect = 3.539e-103
Identity = 180/456 (39.47%), Postives = 279/456 (61.18%), Query Frame = 1
Query:  160 TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFS--------SARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            T   WRPA+ Y+  +V +     V + ++         + +G+  PN+ +        +AR ALYTRYT N+W  +    Y+ S+  RN +E++R D  R+ RE D++    Q D+G++LG+R+ D+ F RNE+N E++K++AE   ++  +R   K+L + E PLH+ QECL++RE R G + VHD+VEK LL E++ ++  +D++  L  K + Q    R +QH LE D   K  +  IDS    L N S GI YY G+E  D  +ST E+W + ++ +++RS AER    +LR + + V+      +   W+  N A  +R+QE A+A+N++Q HL KV QE+FDMEK++  ++K+IQDK  PLKVAQTRL  R  R  +E C D  + RL++EV +I+ ++  L+ +L +AEAT Q LL ++  LE DL  K N+LFIDREKC+  R++FP+
Sbjct:   59 TKHPWRPAMAYELIQVKHMPEQPVTNQLTKQCFLPKGMKTDGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPV 514          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG17450 (gene:FBgn0040028 transcript:FBtr0070057)

HSP 1 Score: 321.627 bits (823), Expect = 5.160e-102
Identity = 180/456 (39.47%), Postives = 279/456 (61.18%), Query Frame = 1
Query:  160 TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFS--------SARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            T   WRPA+ Y+  +V +     V + ++         + +G+  PN+ +        +AR ALYTRYT N+W  +    Y+ S+  RN +E++R D  R+ RE D++    Q D+G++LG+R+ D+ F RNE+N E++K++AE   ++  +R   K+L + E PLH+ QECL++RE R G + VHD+VEK LL E++ ++  +D++  L  K + Q    R +QH LE D   K  +  IDS    L N S GI YY G+E  D  +ST E+W + ++ +++RS AER    +LR + + V+      +   W+  N A  +R+QE A+A+N++Q HL KV QE+FDMEK++  ++K+IQDK  PLKVAQTRL  R  R  +E C D  + RL++EV +I+ ++  L+ +L +AEAT Q LL ++  LE DL  K N+LFIDREKC+  R++FP+
Sbjct:  140 TKHPWRPAMAYELIQVKHMPEQPVTNQLTKQCFLPKGMKTDGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPV 595          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 384.415 bits (986), Expect = 1.007e-127
Identity = 214/460 (46.52%), Postives = 302/460 (65.65%), Query Frame = 1
Query:  124 FYPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIF-SSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            F P+ ST   + + + WR   YY+S       ++L                LE ++   +F  S R AL TRY P DW KS + NY  S++ RN+AE++R DT R+ ++ +  T+R Q+ + K +G+RL DI+F R+E+N EID M+ E  ALS+ KR  E++L+ETE PL V QECL++REKR  IDLVHD VE +L+ EVD+IK CQ+++   + +A  QL  NRA+QHELE+D  DK  A++ID     L+N+S GI+YY G++ +D  IS P++W KFT++N+  S +ER AS +LR+EIE +L  T  +M  ++  VN + + R  ETAD +N +Q HL K LQEI+  E  IE +KK+I+DKE PLKVAQTRL  R  RPN+E C D P  RLI EV EI ++I+ L  +L +AE T+Q L+ +K  LEHDL++K NSLF+D+EKC+  RK+FP
Sbjct:   20 FLPAIST---TNSNMPWRTNSYYRSGSAIPTLSALQRDN------------LELVRAKTMFYPSNRTALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFP 464          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 384.03 bits (985), Expect = 2.221e-127
Identity = 216/472 (45.76%), Postives = 303/472 (64.19%), Query Frame = 1
Query:  124 FYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIF-SSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            F P+ ST   SY            + + WR   YY+S       ++L                LE ++   +F  S R AL TRY P DW KS + NY  S++ RN+AE++R DT R+ ++ +  T+R Q+ + K +G+RL DI+F R+E+N EID M+ E  ALS+ KR  E++L+ETE PL V QECL++REKR  IDLVHD VE +L+ EVD+IK CQ+++   + +A  QL  NRA+QHELE+D  DK  A++ID     L+N+S GI+YY G++ +D  IS P++W KFT++N+  S +ER AS +LR+EIE +L  T  +M  ++  VN + + R  ETAD +N +Q HL K LQEI+  E  IE +KK+I+DKE PLKVAQTRL  R  RPN+E C D P  RLI EV EI ++I+ L  +L +AE T+Q L+ +K  LEHDL++K NSLF+D+EKC+  RK+FP
Sbjct:   20 FLPAISTTASSYRSHQPPLSLNQNSNMPWRTNSYYRSGSAIPTLSALQRDN------------LELVRAKTMFYPSNRTALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFP 479          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 384.03 bits (985), Expect = 2.221e-127
Identity = 216/472 (45.76%), Postives = 303/472 (64.19%), Query Frame = 1
Query:  124 FYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIF-SSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            F P+ ST   SY            + + WR   YY+S       ++L                LE ++   +F  S R AL TRY P DW KS + NY  S++ RN+AE++R DT R+ ++ +  T+R Q+ + K +G+RL DI+F R+E+N EID M+ E  ALS+ KR  E++L+ETE PL V QECL++REKR  IDLVHD VE +L+ EVD+IK CQ+++   + +A  QL  NRA+QHELE+D  DK  A++ID     L+N+S GI+YY G++ +D  IS P++W KFT++N+  S +ER AS +LR+EIE +L  T  +M  ++  VN + + R  ETAD +N +Q HL K LQEI+  E  IE +KK+I+DKE PLKVAQTRL  R  RPN+E C D P  RLI EV EI ++I+ L  +L +AE T+Q L+ +K  LEHDL++K NSLF+D+EKC+  RK+FP
Sbjct:   20 FLPAISTTASSYRSHQPPLSLNQNSNMPWRTNSYYRSGSAIPTLSALQRDN------------LELVRAKTMFYPSNRTALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFP 479          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt4 (tektin 4 [Source:ZFIN;Acc:ZDB-GENE-070410-98])

HSP 1 Score: 224.557 bits (571), Expect = 1.699e-66
Identity = 149/409 (36.43%), Postives = 234/409 (57.21%), Query Frame = 1
Query:  298 NIFSSARNALYT------RYTPNDWIK--SAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            N+++     L T      +YTP++W    SA +N   +D  RN AE I  ++  +  E D  T R Q +    LG RL DI+  R+E+   I+++ AE++   +++R  EK+L  TE P  +  + L  RE+R G DLV D VE+ LL EV+LI+  Q  + + +++   Q+ LNR  +H LE D  DK QA  +D +     N S     +     + + +   E W KFT +NL+ +  E  AS+ LR   E+VL  T  D+  +   V+ A +QR  E + A+ +++ HL ++L++I   E+NI  +++++ DKEAPL+VAQ+RLH R  RPNME C DQP+  L+ E  ++  +++ L +QL +A+ ++  L  S+ NLE D+  KTNSL IDREKC+  R  +P
Sbjct:   37 NVYAGTSTGLTTAGYRSAKYTPDEWFDNNSALLNRAAAD--RNQAENICHESRALKAETDAATLRTQTEGTTHLGARLQDIHLWRSELERLIERLSAETDLQISSRRRLEKALDATEIPFAIATDNLTCRERRFGPDLVKDAVEEELLKEVELIRSIQTLLKKTLDQTINQIRLNREVKHTLELDWSDKQQAYSLDDHCGRFSNRSTDTQRHPSSAVLQDQVCDEEVWRKFTVDNLRLAEREETASQALRRLTERVLQETTEDLRAQCDAVDRAFTQRCVEMSQAKTQLELHLAQILEQIGAQERNISQLQEAVHDKEAPLRVAQSRLHYRTLRPNMEQCRDQPQLSLLGEASKLSNTVSALQQQLYEAQKSLSDLEESRLNLEKDIACKTNSLLIDREKCMTHRTRYP 443          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt1 (tektin 1 [Source:ZFIN;Acc:ZDB-GENE-041114-99])

HSP 1 Score: 221.09 bits (562), Expect = 8.450e-66
Identity = 140/393 (35.62%), Postives = 222/393 (56.49%), Query Frame = 1
Query:  334 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLL-------GEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRK 1491
            R+ P++W  + + +Y  S+  R ++EK+  +  R+  E +   KR Q D+ K+L  R+ DI F R E+  + ++M+ E E L   K   EK+L     P  VT +CL  R+KR  IDLVHD VE+ LL       G + L+++  +QI       N Q+ L R+ ++ LEKD  DKFQAE ID +   L N+SP +   N          TPE W    N N+ ++  E+  S  LR  ++ +L +T RDM +++     A   R +ET  A+ +++N LN++L EI + EKN + ++ ++ +KEAPLKVAQTRL  R  RPN+E C D P+ +L+ ++ E+   +  L+  L+ +E+ ++ L  ++  LE ++ VKTNSL+ID   C   R+
Sbjct:   10 RFLPSEWKHANQEHYRSSEAGRKHSEKLTAECERLIEECNKSNKRMQHDTQKRLERRIQDIKFWRQELVQKFEQMVQEIETLIIYKSRVEKALESCSEPFQVTLQCLAERQKRVAIDLVHDEVEEELLKEKEVVEGVMVLLQRTLEQI-------NEQIRLIRSVKYYLEKDLQDKFQAEHIDDFCSLLTNTSPDLNEGNSSFKYSGAAVTPEEWESLCNLNISKAEKEKNNSLSLRALVDSLLEQTARDMRRQYETTGRAFDLRIEETKTAKEQLENQLNELLAEIANQEKNQDALRLAVAEKEAPLKVAQTRLSTRSQRPNVELCHDPPQIQLLAQIKELTNHVQRLSEALELSESELKALAYNQLRLEEEIQVKTNSLYIDEVICHQLRQ 395          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:549229])

HSP 1 Score: 419.853 bits (1078), Expect = 3.379e-141
Identity = 234/485 (48.25%), Postives = 320/485 (65.98%), Query Frame = 1
Query:   88 YKLNKPSKTLTDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNI--FSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            Y  ++P  T T+F P+ ST+  SY             TL WRP+ YY+ +    +   L  S+              G+    I  F S R AL+TRYTP+DW KS ++NY  S++ R +AE++R+DTSR+ +E D +T++ Q D+ K LG+R+ DI+F ++E+  EID+M+ E+ ALS  KR  E++L ETE PL V+QECLY+REKR  IDLVHD VEK L+ EVD IK CQ+++   + K + QL  NRA+QHELE+D  DK  A +ID   Q+L+NSS GI Y+ GVE +D  +S PETW K++++N+ RS ++R AS +LRE+ E +LA T  DM  ++  VN   + R  ETADA+NK+QNHL K LQEIF  E  IE IKK+I+DK APLKVAQTRL  R  RPN+E C D  + RLI+EV +I  +I  L  +L++AE  +Q L+ +KS LEHDL +K NSLFID+EKC+G RK+FP
Sbjct:   12 YGRHRP--TPTNFLPAISTMSASYRNRFPHYTMSHSLTLPWRPSTYYKVASANPSLAPLSKSS-------------PGLNPSQILSFPSNRTALFTRYTPDDWYKSNQVNYRDSESSRRSAERLRVDTSRLIQEKDQKTRKVQSDTNKDLGERVNDISFWKSEIIHEIDQMIGETNALSEMKRRMERALMETEGPLQVSQECLYHREKRMSIDLVHDDVEKQLIQEVDCIKSCQEKMRRHLQKISAQLASNRAAQHELERDISDKQTALRIDDKCQNLRNSSDGIGYFRGVERMDATVSIPETWAKYSDDNILRSQSDRVASTKLREDAETILASTSNDMWGQFNAVNVNFTSRISETADAKNKLQNHLAKTLQEIFQTEMTIEAIKKAIKDKSAPLKVAQTRLDERTRRPNVELCRDSVQMRLIQEVQDIDNTIQALQLRLREAEDALQMLIHTKSILEHDLAIKANSLFIDQEKCMGMRKSFP 481          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: gdf10 (growth differentiation factor 10 [Source:Xenbase;Acc:XB-GENE-5998698])

HSP 1 Score: 247.284 bits (630), Expect = 1.591e-75
Identity = 142/393 (36.13%), Postives = 231/393 (58.78%), Query Frame = 1
Query:  325 LYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            L  ++ P +W  + +  Y  +++ R+ +E++  ++ R+  E +  T+ +Q+D  KKL  RL +I F + E++ +++  + +   L   K   EK+L   + PL + Q+CL  REKR GIDLVHD  E+ L+ EV++I+     +   + +   Q+ ++R++++ LEKD  DKFQA +ID++   L N+SP I Y      ++    TP  W  +TN N+ ++  +R  +  LR  I+ +L+ T  D+ K+      AL  R QET DA+NK++ HL KV+ EI   EKNIE +KK++ DKE P+K+AQTRL  R  RPN+E C D  + RLI EV EI  ++  L   L QAEA ++ L  ++ +LE ++ VK NS++ID   C+  R+   +
Sbjct:    7 LPPKFLPKEWNIANKTCYARAESQRSRSERLVAESQRLVDEIEKTTQNSQKDVNKKLDQRLEEIQFWKKELDSKLEDTVNDIAQLLAYKIRLEKALESCKEPLSIAQQCLIEREKRVGIDLVHDEAERELIKEVEVIQGVMTLLERTIEQITEQIRMSRSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIDYSANTVRIEANSVTPIEWENYTNTNILKAEKQRNNAIALRSLIDGILSETASDICKQCDTATYALKNRIQETKDAKNKLEEHLAKVMDEISSQEKNIEILKKALADKEGPMKMAQTRLDTRTLRPNVELCRDPVQYRLINEVQEITTNVERLRETLAQAEAELKALNRNQLSLEEEIQVKENSIYIDEVICMQMREAISI 399          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: plcd1 (phospholipase C delta 1 [Source:Xenbase;Acc:XB-GENE-1013054])

HSP 1 Score: 226.483 bits (576), Expect = 5.135e-67
Identity = 137/395 (34.68%), Postives = 227/395 (57.47%), Query Frame = 1
Query:  334 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            +Y   +W +     +  + + R+ +E  R +  ++  E + R +R+Q D  K LG+RL DI+F ++E+  EI  + AE++ L   K   E++L  T+ P  +  + L  R++R G +LV D VE  LL EVDLI+  Q+ +   +++   Q+  NR ++  LE D  DK +A + D       N S  I ++      ++  STPE+W ++T+ N+ ++  ER AS  LR  I+ +L     D+  + A +     +R +E  DA+ K++ HL K L+EI   EKNI  +K++I DK  PLKVAQTRLH R  RPN+E C D  + RL+ EV E+ +S++ L  +L+ +E ++++L  ++ +LE D+  K NS+FIDREKC+  R  +P  + ++
Sbjct:   63 KYLHEEWQQGNLATFYRAFSDRDQSETGRHEAKQLVTETEARAQRSQADCTKSLGERLLDIHFWKSELAREIRDVEAETQLLVQQKGRLERALDATDIPFSIATDNLKCRDRRRGSELVRDEVELELLKEVDLIRNVQELLKRTLDQTVQQIRQNRDAKENLEMDYSDKVEAYEFDDKCGRYNNQSTDIQFHRNSSKYEDNTSTPESWAQYTHENIYKAERERMASINLRSLIDSILQDISEDLEAQSAAIAVDFEKRCREVEDAKQKLEMHLKKTLEEIGGQEKNIAALKQAINDKSPPLKVAQTRLHDRSYRPNVELCRDHVQIRLVSEVGELTDSLDALKLKLEDSEQSLRNLEDTRMSLEKDIANKANSIFIDREKCMTLRTRYPHGMKLL 457          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 151.369 bits (381), Expect = 1.201e-40
Identity = 103/290 (35.52%), Postives = 154/290 (53.10%), Query Frame = 1
Query:  424 DTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRA-SQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKW-AEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNME 1287
            ++ R+  E +  T+++Q+D  KKL  RL +I F + E++ +++  + +   L   K   EKSL   + PL + Q+CL  +EKR GIDLVHD  E+ L+  VD+I+                L  NR  S++ LEKD  DKFQA +ID++   L N+SP I Y      ++    TP  W  FTN N+                   V A  +R+ A    + ++  LS+ A +   A+NK++ HL KV+ EI   EKNIE +KK++ DKE P+K+ Q RL  R  RPN+E
Sbjct:   22 ESQRLVDESEKTTQKSQKDFNKKLDQRLEEIQFWK-ELDSKLEDTVNDIAQLLACKFRLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGVM-----------TLLEYNRTNSKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSVTPIEWEDFTNTNI-------------------VKAEKRRNNAVALRSLIDGILSETASDIY-AKNKLEEHLAKVISEISSQEKNIEILKKALADKEGPMKMEQIRLDTRTLRPNVE 279          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 149.058 bits (375), Expect = 6.152e-40
Identity = 98/276 (35.51%), Postives = 149/276 (53.99%), Query Frame = 1
Query:  460 TKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNME 1287
            T+++Q+D  KKL  RL +I F + E++ +++  + +   L   K   EKSL   + PL + Q+CL  +EKR GIDLVHD  E+ L+  VD+I+                L ++ ++++ LEKD  DKFQA +ID++   L N+SP I Y      ++    TP  W  FTN N+ ++   R  +  LR  I+ +L+ T  D+                    A+NK++ HL KV+ EI   EKNIE +KK++ DKE P+K+ Q RL  R  RPN+E
Sbjct:    1 TQKSQKDFNKKLDQRLEEIQFWK-ELDSKLEDTVNDIAQLLACKFRLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGVM-----------TLLEMSLSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSVTPIEWEDFTNTNIVKAEKRRNNAVALRSLIDGILSETASDIY-------------------AKNKLEEHLAKVISEISSQEKNIEILKKALADKEGPMKMEQIRLDTRTLRPNVE 245          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt3 (tektin 3 [Source:MGI Symbol;Acc:MGI:1918312])

HSP 1 Score: 376.711 bits (966), Expect = 1.570e-124
Identity = 207/484 (42.77%), Postives = 307/484 (63.43%), Query Frame = 1
Query:  103 PSKTLTDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            P      F P+  T+  SY             +L WRP  YY+++          + +             E   +P  F S R   +TRYTP+DW +S  +++  S++ R+N+E++R+DTSR+ ++   + ++ Q  S + LG+R+ D+ F ++E+  E+D+M+ E+ AL++ KR  E+ L ETE PL V++ECL++REKR GIDLVHD  EK LL EVD I  CQ+++ + ++KAN QL  +R++QHELEKD  DK  A +ID   Q L+N+S G++Y+ GVE VD  +S PETW KFT++N+ RS +ER AS +LREE E +L  T  +M  ++ +VN A + R  ET DA+NKI  HL K LQEIF +E  IE IKK+I++K A LKVAQTRL  R  RPN+E C D  + RL+ EV+E+ E+I  L ++L+ +E T+Q L  +K+ LEHDL VK N+L+ID+EKC+  R ++P  + ++
Sbjct:   15 PPPASASFLPAIGTITSSYKDRFPHRNLTHSLSLPWRPNTYYKTAYNYPTLAPYSSRSQRV---------CESTMLP--FVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLV 487          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt5 (tektin 5 [Source:MGI Symbol;Acc:MGI:1917676])

HSP 1 Score: 323.553 bits (828), Expect = 5.542e-103
Identity = 177/445 (39.78%), Postives = 268/445 (60.22%), Query Frame = 1
Query:  169 AWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIK-VPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            AWRP+V+++ +                        E  GI+  P I  S R+AL+ RYTP DW +S ++    ++  R  A ++  D+ R+ ++ D    + QE + + LG RL+D+ F ++E+  E+D+++ E+ ++   KR  E +  E   PL V  ECLYNREKR GIDLVHD VEKNL+ EVDL+K CQDQ+ +L  + + Q+  NR +QH LE+D  DK  A+ ID    +L+++S  I++++GVE  D  +S PETW KF+N+N++ +   R  S RLREE E +       M K++   N A + R  E  D +NK+Q  L K+LQEIF  E  I  ++++I  KE PLK+AQT L  R  RPN+E C D P+ RL+ EV  I +++  L  +L++ + T+Q L+ +KS LEH+L +K N+L ID++KC+  RK+FP
Sbjct:   50 AWRPSVFHKIATSQTIPE-----------------ECSGIRRPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSFP 477          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt5 (tektin 5 [Source:MGI Symbol;Acc:MGI:1917676])

HSP 1 Score: 267.7 bits (683), Expect = 2.594e-83
Identity = 151/383 (39.43%), Postives = 224/383 (58.49%), Query Frame = 1
Query:  169 AWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIK-VPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSR 1314
            AWRP+V+++ +                        E  GI+  P I  S R+AL+ RYTP DW +S ++    ++  R  A ++  D+ R+ ++ D    + QE + + LG RL+D+ F ++E+  E+D+++ E+ ++   KR  E +  E   PL V  ECLYNREKR GIDLVHD VEKNL+ EVDL+K CQDQ+ +L  + + Q+  NR +QH LE+D  DK  A+ ID    +L+++S  I++++GVE  D  +S PETW KF+N+N++ +   R  S RLREE E +       M K++   N A + R  E  D +NK+Q  L K+LQEIF  E  I  ++++I  KE PLK+AQT L  R  RPN+E C D P+ R
Sbjct:   50 AWRPSVFHKIATSQTIPE-----------------ECSGIRRPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFR 415          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 250.366 bits (638), Expect = 1.098e-76
Identity = 136/389 (34.96%), Postives = 235/389 (60.41%), Query Frame = 1
Query:  334 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            R+ P +W  + +  Y+ ++  R+ +E++  ++ R+  E +  T+++Q D  KKL  RL ++ F + E++D++++++ +++ L   K   E+SL   + PLH+T++CL  REKR GIDLVHD+VE+ L  E D+I    + +   + ++  Q+ LNR++++ LEKD  DKF A  ID    SL N+SP I +   V  ++    + E WL F+N N++++  +   S  L+  ++Q+L++T  D+ ++   V+ A     +ET DARNK+ +HL KV++EI   EKNI  ++ +I  +E P KVA TRL  R  RPN+E C D  + RLI+E+ EI  ++  L   L QA+  ++ L   +  L+ ++ VK N+++ID+  C+  RK+ P
Sbjct:   10 RFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIP 398          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 250.366 bits (638), Expect = 1.098e-76
Identity = 136/389 (34.96%), Postives = 235/389 (60.41%), Query Frame = 1
Query:  334 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            R+ P +W  + +  Y+ ++  R+ +E++  ++ R+  E +  T+++Q D  KKL  RL ++ F + E++D++++++ +++ L   K   E+SL   + PLH+T++CL  REKR GIDLVHD+VE+ L  E D+I    + +   + ++  Q+ LNR++++ LEKD  DKF A  ID    SL N+SP I +   V  ++    + E WL F+N N++++  +   S  L+  ++Q+L++T  D+ ++   V+ A     +ET DARNK+ +HL KV++EI   EKNI  ++ +I  +E P KVA TRL  R  RPN+E C D  + RLI+E+ EI  ++  L   L QA+  ++ L   +  L+ ++ VK N+++ID+  C+  RK+ P
Sbjct:   10 RFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIP 398          
BLAST of Tektin 3 vs. UniProt
Match: sp|Q9BXF9|TEKT3_HUMAN (Tektin-3 OS=Homo sapiens OX=9606 GN=TEKT3 PE=1 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.738e-128
Identity = 218/486 (44.86%), Postives = 313/486 (64.40%), Query Frame = 1
Query:  103 PSKTLTDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNI--FSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            P  T T+F P+ ST+  SY             +L WRP+ YY+ +              +  S+  Y T  + +    +  F S R   +TRYTP+DW +S   NY  S+  R+N+EK+R+DTSR+ ++   +T++ Q D+ + LG+R+ DI F ++E+  E+D+M+ E+ AL++ K+  E++L ETE PL V +ECL++REKR GIDLVHD VE  LL EVD I  CQ+++   ++KA  QL  NRASQHELEKD  DK  A +ID     L+N+S G+ Y+ GVE VD  +S PE+W KFT++N+ RS +ER AS +LR++IE +L  T  +M  ++ +VN + + R  ETADA+NKIQ HL K LQEIF  E  IE IKK+I+DK A LKVAQTRL  R  RPN+E C D  + RL+ EVHE+ ++I  L ++L+ AE T+Q L+  K+ LE+DL VK NSL+ID+EKC+  RK++P  + ++
Sbjct:   15 PRPTPTNFLPAISTMASSYRDRFPHSNLTHSLSLPWRPSTYYKVA-------------SNSPSVAPYCTRSQRVSENTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLV 487          
BLAST of Tektin 3 vs. UniProt
Match: sp|A6H782|TEKT3_BOVIN (Tektin-3 OS=Bos taurus OX=9913 GN=TEKT3 PE=1 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 6.703e-128
Identity = 214/486 (44.03%), Postives = 315/486 (64.81%), Query Frame = 1
Query:  103 PSKTLTDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNI--FSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            P  T T+F P+ ST+  +Y             +L WRP+ YY+++              +  ++  Y T  + +    +  F S R  L+TRYTP+DW +S   N+  S+  R+N+E++R+DTSR+ ++   +T++ Q DS + LG+R+ DI F ++E+  E+D M+ E+  L++ K+  E++L ETE PL V +ECL++REKR GIDLVHD VEK LL EVD I  CQ+++   ++KA  QL  NRA+QHELEKD  DK  A +ID     L+N+S G++Y++GVE VD  +S PE+W KFT++N+ RS +ER AS +LR++I+ VL  T  +M  ++ +VN A + R  ETADA+NKIQ HL K LQEIF  E  IE IKK+I +K A LKVAQTRL  R  RPN+E C D  + RL+ EV+E+ ++I  L ++L+ AE T+Q L  +K+ LEHDL VK NSL+ID++KC+  R++FP  + ++
Sbjct:   15 PRPTPTNFLPAISTMASTYRDRFPHYNLTHSLSLPWRPSTYYKAA-------------SNWPTLDPYCTRSQRVSESTMLPFVSNRTTLFTRYTPDDWYRSNLTNFQESNTSRHNSERLRVDTSRLIQDKYQQTRKTQADSTQNLGERVNDIGFWKSEIIHELDAMIGETNELTDIKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEKELLTEVDTILCCQERMKLYLDKAIAQLAANRAAQHELEKDLSDKQSAYRIDDKCHHLRNTSDGVSYFHGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIQNVLVVTANEMWNQFNKVNLAFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIVEKSAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVYEVDDTIQTLQQRLRDAEDTLQSLAHTKATLEHDLAVKANSLYIDQDKCMSMRRSFPSTLRLV 487          
BLAST of Tektin 3 vs. UniProt
Match: sp|Q6X6Z7|TEKT3_MOUSE (Tektin-3 OS=Mus musculus OX=10090 GN=Tekt3 PE=2 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 1.098e-123
Identity = 207/484 (42.77%), Postives = 307/484 (63.43%), Query Frame = 1
Query:  103 PSKTLTDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            P      F P+  T+  SY             +L WRP  YY+++          + +             E   +P  F S R   +TRYTP+DW +S  +++  S++ R+N+E++R+DTSR+ ++   + ++ Q  S + LG+R+ D+ F ++E+  E+D+M+ E+ AL++ KR  E+ L ETE PL V++ECL++REKR GIDLVHD  EK LL EVD I  CQ+++ + ++KAN QL  +R++QHELEKD  DK  A +ID   Q L+N+S G++Y+ GVE VD  +S PETW KFT++N+ RS +ER AS +LREE E +L  T  +M  ++ +VN A + R  ET DA+NKI  HL K LQEIF +E  IE IKK+I++K A LKVAQTRL  R  RPN+E C D  + RL+ EV+E+ E+I  L ++L+ +E T+Q L  +K+ LEHDL VK N+L+ID+EKC+  R ++P  + ++
Sbjct:   15 PPPASASFLPAIGTITSSYKDRFPHRNLTHSLSLPWRPNTYYKTAYNYPTLAPYSSRSQRV---------CESTMLP--FVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLV 487          
BLAST of Tektin 3 vs. UniProt
Match: sp|Q4V8G8|TEKT3_RAT (Tektin-3 OS=Rattus norvegicus OX=10116 GN=Tekt3 PE=1 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 8.430e-121
Identity = 206/484 (42.56%), Postives = 310/484 (64.05%), Query Frame = 1
Query:  103 PSKTLTDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            P    T+F P+  TL  SY             +L WRP+ YY+++        L +++ S           E   +P  F S R  L+TRYTP+DW +S  + +  S+  R+N+E++R+DTSR+ ++   + ++ Q DS + LG+R+ DI F ++E+  E+D+M+ E+ AL++ KR  E+ L ET+ PL V +ECL++REKR GIDLVHD  EK LL EV+ +  CQ+++   ++KA  QL  +R++QHELEKD  DK  A +ID   + L+N+S G++Y+ GVENVD  +S PE+W KFT++N+ RS +ER AS +LRE+ E +L     +M  ++ +VN A + R  ET DA+NKI  HL+K LQEIF  E  IE I+K+I++K A LKVAQTRL  R  RPN+E C D  + RL+ EV+E+ E+I  L ++L+ +E T+Q L  +K+ LEHDL VK N+L+ID+EKC+  R ++P  + ++
Sbjct:   15 PQPAATNFLPAIGTLTSSYRNRFPHRNLTHSLSLPWRPSTYYKTAYNYPTLAPLSSTSQSV---------CESTMLP--FVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQDKYQQIRKTQADSTQNLGERVNDIAFWKSEIIHELDEMIGETNALTDIKRRLERGLIETDAPLQVARECLFHREKRMGIDLVHDEAEKELLTEVETVLCCQERMRRHLDKAIAQLASDRSAQHELEKDLSDKQAALRIDDKCKHLRNTSQGVSYFRGVENVDATVSVPESWAKFTDDNVLRSQSERAASAKLREDTENLLIVIANEMWNQFNKVNVAFTNRIAETVDAKNKIHIHLSKTLQEIFQTEMAIESIRKAIKEKSAFLKVAQTRLDERTRRPNIELCRDIAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLV 487          
BLAST of Tektin 3 vs. UniProt
Match: sp|Q96M29|TEKT5_HUMAN (Tektin-5 OS=Homo sapiens OX=9606 GN=TEKT5 PE=1 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 3.339e-108
Identity = 178/444 (40.09%), Postives = 277/444 (62.39%), Query Frame = 1
Query:  169 AWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            +WRP+++Y+ + V        ++                ++ P I  + R+AL++RY+P+DW +S ++    ++  R  A ++  D+ R+ ++ D  T + QE + + LG RL+DI F ++E++ E+D+++ E++ L   KR  E + +E   PL V  ECLY+REKR GIDLVHD VEKNL+ EVDL+K CQ+Q+ +L  + ++Q+  NR +QH LE+D  DK  A+ ID    +L+N+S  I++++G+E +D  IS PETW KF+N+N++ S   R  S +LREE E +       M +++ + N A + R  E  D +NK+Q  L K LQEIF  E  I  +++SI  KE PLKVAQTRL  R  RPNME C D P+ +L+ EV  I +++  L  +L++ + T+Q L+ +K  LEH+L +K N+L ID+EKC+G RKTFP
Sbjct:   49 SWRPSLFYKIANVQTCPDESTST----------------LRPPTILPTLRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLTENQNLETVKRRLECAANEVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMRDNRDAQHVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSNDNIKHSQNMRANSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQEIFQAENTIMLLERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTFP 476          
BLAST of Tektin 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|15791191 (tr|A0A1I8GB64|A0A1I8GB64_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007106g1 PE=4 SV=1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 282/461 (61.17%), Postives = 358/461 (77.66%), Query Frame = 1
Query:  121 DFYPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            D  P PS L+RS T+L WRP+ YYQ+++V   +  + + +   S+ R  L ELEGIKVP +FS+ARNALYTRYTPNDW+ +   NY+VSD VR NAE+IR DT R+ RE +DRTKRAQE+SGK+LG+R+ DINF + E+  E D M++E  +L  AKR AEK+L ETENPLHV QECLYNREKR GIDLVHD+VEK+LL EVD+IK+CQD+I  +++KANVQLNLNRA+QHELEKD+ DKF A+ +D     L+N+S GIA++NG+E +D  +S PETW KF+N N+QRS AER AS+ LR E+++VL     DM K++  VN ALS+R QE  DARNK+Q HL+KVLQE+FDMEKNIE++KKSI+DKEAP +VAQTRL  R+ RPN+E C D  + RL+ EV EIRE++  L  +L++AE  +QHLL +KS LEHDL+VK NSLFIDREKCLG RKTFPM
Sbjct:   35 DTMPGPSPLRRSLTSLPWRPSTYYQTAKVSPTTALMQSQSGPLSA-RANLAELEGIKVPPVFSAARNALYTRYTPNDWMSANLSNYSVSDRVRGNAERIRYDTLRLCREGEDRTKRAQEESGKRLGERVTDINFWKTELQHETDNMVSEISSLQEAKRIAEKALGETENPLHVAQECLYNREKRQGIDLVHDLVEKDLLREVDVIKQCQDKIRAVIDKANVQLNLNRAAQHELEKDTADKFSAQHLDEKCHGLRNTSGGIAFHNGIEQLDRTLSVPETWAKFSNENIQRSQAERAASKNLRAELDKVLNDCANDMWKQFNCVNTALSERVQECTDARNKLQTHLDKVLQEVFDMEKNIEFLKKSIKDKEAPYQVAQTRLETRIHRPNVELCRDPAQHRLVSEVQEIRETVEQLQAKLREAENALQHLLKTKSALEHDLSVKNNSLFIDREKCLGIRKTFPM 494          
BLAST of Tektin 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18318578 (tr|A0A267GV76|A0A267GV76_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003606g3 PE=4 SV=1)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 282/461 (61.17%), Postives = 356/461 (77.22%), Query Frame = 1
Query:  121 DFYPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            D  P PS L+RS T+L WRP+ YYQ+++V   +  + + +   S+ R  L ELEGIKVP +FS+ARNALYTRYTPNDW+ +   NY+VSD VR NAE+IR DT R+ RE +DRTKRAQE+SGK+LG+R+ DINF + E+  E D M+ E  +L  AKR AEK+L ETENPLHV QECLYNREKR GIDLVHD+VEK+LL EVD+IK+CQD+I  +++KANVQLNLNRA+QHELEKD+ DKF A+ +D     L+N+S GIA++NG+E +D  +S PETW KF+N N+QRS AER AS+ LR E+++VL     DM K++  VN ALS+R QE  DARNK+Q HL KVLQE+FDMEKNIE++KKSI+DKEAP +VAQTRL  R+ RPN+E C D  + RL+ EV EIRE++  L  +L++AE  +QHLL +KS LEHDL+VK NSLFIDREKCLG RKTFPM
Sbjct:   35 DTMPGPSPLRRSLTSLPWRPSTYYQTAKVSPTTALMQSQSGPLSA-RANLAELEGIKVPPVFSAARNALYTRYTPNDWMSANLSNYSVSDRVRGNAERIRYDTLRLCREGEDRTKRAQEESGKRLGERVTDINFWKTELQHETDNMVTEISSLQEAKRIAEKALGETENPLHVAQECLYNREKRQGIDLVHDLVEKDLLREVDVIKQCQDKIRAVIDKANVQLNLNRAAQHELEKDTADKFSAQHLDEKCHGLRNASGGIAFHNGIEQLDRTLSVPETWAKFSNENIQRSQAERAASKNLRAELDKVLNDCANDMWKQFNCVNTALSERVQECTDARNKLQTHLGKVLQEVFDMEKNIEFLKKSIKDKEAPYQVAQTRLETRIHRPNVELCRDPAQHRLVSEVQEIRETVEQLQAKLREAENALQHLLKTKSALEHDLSVKNNSLFIDREKCLGIRKTFPM 494          
BLAST of Tektin 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|22627255 (tr|A0A2C9K274|A0A2C9K274_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078627 PE=4 SV=1)

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 275/471 (58.39%), Postives = 360/471 (76.43%), Query Frame = 1
Query:  106 SKTLTDFYPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            SKT TD YP+PS L+RS TTL WRP+ YYQS++         +     S  + +L+EL+ +KVP +F+SARNALYTR+TPNDW+ S + NY  SD VR+ AE++RLDT R+ RE DD+TKR Q D GK+LG+R+ DINF +NE+N E D M++E+  L  AKR  EK L+ETENPLH+ QECLY+REKR  IDLVHD  EK L+ EVD+IK+CQD++  LV+KANVQL+LNRASQHELEKDS DKF AE +D+    ++N+S G+AY++GV  +DN +S PETW KF+NNN+QRS AER AS+ +R EIE V+     +M ++W  VN AL+QRAQET DARNKIQ HL+KVLQE+F+MEKNIE +KK+IQDKEAP++VAQTRL  RL RPN+E C D  + RL+EEV+EI +++++L ++L++AE  +Q LL +K+ LE DL++K NSLFIDR+KCL  RKTFPM   V+
Sbjct:   35 SKT-TDTYPAPSPLRRSLTTLPWRPSAYYQSTKTNPTIPLTRSMPDPFSQ-KTHLSELDALKVPPVFASARNALYTRFTPNDWMASNQGNYLASDRVRSGAERLRLDTVRLCREADDKTKRTQNDVGKRLGERIGDINFWKNELNLETDNMISETNQLQEAKRVLEKFLAETENPLHLAQECLYHREKRQSIDLVHDNPEKALIREVDVIKRCQDKMRGLVDKANVQLSLNRASQHELEKDSIDKFVAEHLDNACHGMRNTSRGLAYHDGVHRIDNSLSVPETWAKFSNNNIQRSQAERAASKNMRNEIESVINACNNEMWQEWNAVNVALNQRAQETTDARNKIQTHLSKVLQEVFEMEKNIELLKKAIQDKEAPMQVAQTRLDTRLRRPNVELCRDPVQHRLVEEVYEITDTVDSLQQKLREAENALQALLRTKAALEQDLSIKNNSLFIDRDKCLAMRKTFPMAPRVV 503          
BLAST of Tektin 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|23845547 (tr|V4B8B3|V4B8B3_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_131220 PE=4 SV=1)

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 267/466 (57.30%), Postives = 352/466 (75.54%), Query Frame = 1
Query:  121 DFYPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            D YP+PS L+RS TTL WRP+ YYQ+++V   +    +     S+ RN LT+L+ I VP +F+++RNALYTRYTPNDW  S + NY  SD VR+ AE+IRLDT R+ RE DD+T+R Q D GKKLG+R+ DI+F + E+N E D M+AE+ AL+ AKR  EK+L+ETENPLH  QECLY+REKR GIDLVHD  EK L+ EVD+IK+CQD++ ++V+K+NVQL LNRA+QHELEKDS DKF A+ +D     ++N+S G+ ++NGV  +DN +S PE+W KFTN+N+QRS +ER AS+ +R EIE VL     +M ++W  VN AL+ R Q+T DARNK+Q HL+KVLQEIFDMEKNIE +KK+IQDK  P++VAQTRL  R+ RPN+E C D  + RL+ EV EI E+++ L  +L+ +E T+Q LL +KS LEHDL++K NSLFIDREKCLG RKTFPM +P +
Sbjct:   36 DTYPAPSPLRRSLTTLPWRPSTYYQTAQVNPATALTKSMNAPLSA-RNELTQLDSITVPPVFAASRNALYTRYTPNDWSSSNQTNYMSSDKVRSGAERIRLDTVRLCRETDDKTRRTQSDVGKKLGERIGDISFWKTELNHETDNMIAETNALNEAKRVLEKALAETENPLHTAQECLYHREKRQGIDLVHDAPEKELIREVDVIKRCQDKMRDIVDKSNVQLGLNRAAQHELEKDSGDKFTAQTLDETCHGMRNASRGLNFHNGVHRIDNTVSVPESWAKFTNDNIQRSQSERAASKHMRNEIESVLNACANEMWQEWNAVNVALTGRMQDTTDARNKLQTHLSKVLQEIFDMEKNIELLKKAIQDKVPPMQVAQTRLDTRIRRPNVELCRDPVQHRLVSEVSEISETVDALQAKLRHSENTLQELLRTKSALEHDLSIKNNSLFIDREKCLGMRKTFPM-VPRV 499          
BLAST of Tektin 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|17007096 (tr|A0A1S3HLM8|A0A1S3HLM8_LINUN tektin-3-like OS=Lingula unguis OX=7574 GN=LOC106156343 PE=4 SV=1)

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 261/461 (56.62%), Postives = 349/461 (75.70%), Query Frame = 1
Query:  121 DFYPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            D YP+PS L+RS TTL WRP+ YYQ+++V  +     +     S ++N L++L+ IKVP +F++ARNALYTRYTPNDW +S   NY  SD VR++AE++RLDT R+ RE DD+TKR Q D GK+LG+R+ DI F + EV  E D+M+ E  AL   KR  EK+L ETENPLH+ QECLYNREKR  IDLVHD VEK L+ EVD+IK+CQ+++ + + +AN+QL+LNRA+QHELEKD+ DKF A  +D+    +KN+S G+A++NG+E +DN +S PETW KF+N+N+QRS +ER AS+++R EIE VL +   +M ++W  VN A +QR QE+ +ARN++Q HL+KVLQEIFDMEKNIE +KK+I DK AP++VAQTRL  R  RPN+E C D  + RL+EEV+EI E++  L  +L+QAE  +QHLL +K+ LE DL+VK NSLFIDREKC+G RKTFPM
Sbjct:   44 DTYPAPSPLRRSLTTLPWRPSTYYQTAKVNPSMAVTRSLPEPLS-MQNQLSQLDAIKVPPVFAAARNALYTRYTPNDWSQSNNSNYMASDRVRSSAERLRLDTVRLCRETDDKTKRTQTDVGKRLGERIGDIQFWKTEVQHETDQMITEINALVEHKRVLEKALQETENPLHIAQECLYNREKRQAIDLVHDHVEKELIKEVDIIKRCQEKMRQTIERANMQLSLNRAAQHELEKDTGDKFMALNLDTNCHGMKNTSRGMAFHNGIERIDNTVSVPETWAKFSNDNIQRSQSERAASKQMRNEIESVLTQCSNEMWQQWNAVNNAFTQRIQESTEARNRLQTHLSKVLQEIFDMEKNIELLKKAISDKTAPMQVAQTRLETRTHRPNVELCRDPVQHRLVEEVYEITETVEQLQAKLRQAENALQHLLRTKATLEQDLSVKNNSLFIDREKCMGMRKTFPM 503          
BLAST of Tektin 3 vs. Ensembl Cavefish
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:103037718])

HSP 1 Score: 374.785 bits (961), Expect = 6.360e-124
Identity = 209/474 (44.09%), Postives = 302/474 (63.71%), Query Frame = 1
Query:  118 TDFYPSPSTLQRSY------------TTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIF-SSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            ++F P+ ST   SY              + WR   Y++S     +  S                 LE ++   +F  S R A+ TRY P+DW KS   NY  S++ RN+AE++R DT R+ ++ D  T+  QE + K LG+RL DI F R+E++ EID M++E  AL+  KR  E++L+ETE PL  +QECL++REKR  IDLVHD VEK+L+ EV++IK CQ+++   ++KA  QL  NRA+QHELE+D +DK  A++ID     ++N+S GI+YY G++ +D  +S P++W KFT++N+  S +ER  S +LR+EIE +L  T  +M  ++   N + + R  E A+A+N +Q HL K LQEIF  E  IE +KK+I+DKE PLKVAQTRL  R  RPN+E C D P  RL+ EV EI +SI  L  +L +AE T+Q+L+ +K  LEHD++VK NSLF+D+EKC+  R++FP
Sbjct:   18 SNFLPAISTTASSYRNFPPALTANQNANMPWRTNTYFRSGSAIPSILSSSQRDN-----------LELVRAKTMFYPSNRAAMSTRYMPDDWFKSNYNNYRESESSRNSAERLRRDTLRLIQDRDQITRWTQESTSKNLGERLNDITFWRSELHHEIDNMVSEIAALTEVKRRLERALAETEGPLQTSQECLFHREKRMSIDLVHDGVEKDLIKEVEVIKSCQERMRRSLDKAIAQLASNRAAQHELERDLNDKVTAQRIDDRCHQMRNTSDGISYYRGIDRLDPSLSLPDSWSKFTDDNILLSQSERSTSHKLRDEIEVLLNTTANEMWNQFNSANVSFTNRISEMAEAKNSLQTHLAKTLQEIFQTEMLIETLKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLVGEVREIEDSIYKLRERLAEAENTLQNLVKTKVTLEHDISVKANSLFLDQEKCMSMRRSFP 480          
BLAST of Tektin 3 vs. Ensembl Cavefish
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:103034475])

HSP 1 Score: 204.527 bits (519), Expect = 3.317e-59
Identity = 139/391 (35.55%), Postives = 223/391 (57.03%), Query Frame = 1
Query:  334 RYTPNDWIK--SAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            +Y+P +W +  SA +   ++D+   +A+++   +  ++ E    T+ AQ      LG RL D++  R E+    +++ AE+E L + KR  EK+L  T+ PL ++ + L  RE R G DLV D VE+ LL EV+LI+  Q  + + + +A  Q+ LNR ++  LE D  DK +A  +D       N S    ++     + + +     WLKFT  NL+ +  +   S  LRE  ++VL  T  D+  + A V+ + +QR  E + A+N+++  L +VL EI   E+NI  +++++ DK+ PL+VAQ+RLH R  RPNME C DQP+  L  EV +I  S+  L +QL +A  ++  L  S+  LE +++ KTNSLFIDR+KCL  R  +P
Sbjct:   37 KYSPREWQENNSATLQRALTDH--QHAQRVLRASRALSAEAAAGTQDAQSRGTLLLGARLQDVHSRRTELQRGAERLQAETELLQDHKRRLEKALLTTDLPLTISTDNLTCRENRFGPDLVQDPVEEELLKEVELIRNVQALLKKTLQQAVDQIRLNREAKQTLELDWSDKHEAYILDDQCGRYGNRSTDTQHHPSSARLHDQVCDERAWLKFTQVNLEEAERQYRCSVSLRELCDRVLQETAEDLRAQCAVVDQSFNQRCLELSQAKNQLELQLQRVLDEIGSQERNISTLQQAVYDKDTPLRVAQSRLHYRAQRPNMELCRDQPQISLESEVEQISGSVGVLQQQLSEARQSLAQLEESRLMLEKNISCKTNSLFIDRDKCLTHRTRYP 425          
BLAST of Tektin 3 vs. Ensembl Cavefish
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:103026688])

HSP 1 Score: 153.295 bits (386), Expect = 1.822e-40
Identity = 113/373 (30.29%), Postives = 201/373 (53.89%), Query Frame = 1
Query:  349 DWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDR 1467
            DW  S ++  + +++ R+ + +IR +   +  E  ++T   + DS ++L DR++D+   +  +   +  + AE +AL+ AK   E++L+ T  PL VT EC   RE R G +LV D VE  L  EVD+I   Q  + +L++++  QL L + + H+L  D   K +A  +D    SL  +SP I+       V    +TP+ W +F+++N+ R+  E + S +LRE I    A+ Q ++  +      AL +R      A  ++Q  L     EI +ME++I  +++ +Q K APLK+  TRL  R  RP ++ C D+ +  L+EE  ++  +I  L ++L QA  ++Q L   ++ +  DL+ K  +L +++
Sbjct:   16 DWENSNKLISDTAEHRRHVSHEIRQEGRALRNETANKTSWDEYDSSRRLNDRISDVTRWKKSLEACVQDVNAEIDALTLAKEETERALAATVLPLEVTAECQTLREGRRGSELVSDPVEAELKKEVDVIDGAQRVLQQLIDQSFEQLCLLQEAHHQLTLDLQHKTEALDVDMSCLSLTVTSPEISLKPNPIRVPPGSTTPQQWEQFSHHNVIRAKEEMQTSLQLRENISITRAQVQNELEAQRIATEFALRKRTHHMEQALQEVQWQLKTTQDEITEMERDIRGLERDMQAKMAPLKLVHTRLENRTKRPGVDLCRDEVQFGLVEEAKQLDSTIQTLKQKLAQALDSLQSLQHHEAQMLEDLSRKQEALALEQ 388          
BLAST of Tektin 3 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 93.5893 bits (231), Expect = 4.527e-22
Identity = 58/191 (30.37%), Postives = 104/191 (54.45%), Query Frame = 1
Query:  334 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAY 906
            R+T  +W  S E   + + + R+ +  +R +   +  + +++TK  Q DS  +L +R++ +      +   +D   AE  AL+  K  AE++L     PL V  ECL+ R+ R G+DLVHD VE  L  EV  I++ ++ +   +N A +Q+   + ++ +L+ D  DK +A +IDS  ++L N+S  I+ 
Sbjct:   11 RFTVGEWHDSGERVSSGAQSRRDVSRSVRQEARHLRDQSNNQTKWDQHDSNTRLEERMSSVQRWVERLQHTLDDTDAEINALAKTKDDAERALQAKAVPLQVATECLFLRDARRGVDLVHDPVEDELHREVKAIERAKEALTRSINDAFLQVCQLQEARQQLQGDVRDKEEALEIDSTCRALNNASATISL 201          
BLAST of Tektin 3 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 75.0998 bits (183), Expect = 1.289e-15
Identity = 57/184 (30.98%), Postives = 99/184 (53.80%), Query Frame = 1
Query:  940 STPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRK 1491
            S+P TW +F+  N++R+ AE  AS  LRE I   +A+T  ++  +    + A  +R+ E    + +++       QEI  +E +I +++  ++ K  PLKVA TRL  R  R  +E C D+P+  +  EVH+I  +I  L ++L  +   +  L  S   +E DL  K  +L ++R +C+  R+
Sbjct:    2 SSPRTWDEFSRRNVERAMAEMRASSALREAITATIAQTTNELEAQKNSTDFAFRKRSHELDKVKAELEWQKKNNKQEISVLEGDIAHLEADVRAKMLPLKVAHTRLETRTYRSGVELCRDEPQYGITTEVHQIEATIATLKKKLSDSYNALTGLRCSLERVERDLASKALALGLER-RCVDVRR 184          
BLAST of Tektin 3 vs. Ensembl Nematostella
Match: EDO39292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAK1])

HSP 1 Score: 268.085 bits (684), Expect = 3.854e-84
Identity = 154/386 (39.90%), Postives = 239/386 (61.92%), Query Frame = 1
Query:  334 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRK 1491
            +Y P +W  S  + Y  ++  R  AE++R ++ R+  E + RT   QED  KKL  R+ DINF ++E++    +   E   + N K   E++L++TE PL + Q+CL NREKR  IDLVHD VE  LL EV++I+  Q  +   + +A  Q+ L R++++ LEKD  DKF A +ID+   +LKN SPG+ Y      ++    TP+ W  F+N N+ ++  E+ +S  LR  I+ +L +T  D+  +   VN A  +R +ET  A+ K+++HL KV +EI  ME+NI  ++++I  K AP+KVAQTR+  R  RPN+E C D+ + RLI+EV EI  +I  L  +L +AE++++ L+  + +LE D+ VK NSLFIDR++C+  RK
Sbjct:   10 KYVPEEWHASNHLQYFTAEKERAAAERLRDESERLRVEIEVRTVETQEDVNKKLDQRITDINFWKSELDRNQSETEEEINMMLNFKARLERALADTELPLMIAQQCLMNREKRIKIDLVHDNVEMQLLKEVEVIEGVQALLKRTIEQATEQIRLLRSARYYLEKDRKDKFHANKIDNTCAALKNDSPGLVYARDAVKIEKNSVTPDEWEDFSNKNMLKAEREKNSSTSLRSIIDGLLVQTLNDLMNQCRAVNLAFEKRIEETLKAKTKLEDHLMKVKEEIAAMEENIATLQRAIALKIAPMKVAQTRVENRTFRPNIELCRDRVQYRLIDEVVEISTNIERLQEKLYEAESSLKALIRRQLSLEEDIEVKENSLFIDRDQCMELRK 395          
BLAST of Tektin 3 vs. Ensembl Nematostella
Match: EDO40681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M2])

HSP 1 Score: 235.343 bits (599), Expect = 7.088e-72
Identity = 148/374 (39.57%), Postives = 227/374 (60.70%), Query Frame = 1
Query:  370 INYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRK 1491
            +N +  +  R  AE++R + SR+  E    T R Q D  KKL  RL DIN+ + E+  +  + +AE +AL       EK+L+ TE PL+++Q+CL  RE+R  IDLVHD VE +L  EV++I+  Q  + + +++A+ QL L R+++ +LEKD  DK+ A  ID    +L N S  I +      +     TP+ W  +++ N+ ++  ER+AS  LR EI  +L +T  D+   +  VN    +R ++T  A+  ++  L++V+ E+  M+ NI  + ++I DKEAPLKVA TRL  R  RPN+E C D  + RL+ EV EI  SI+ L  +L +A+A+MQ LL +K NLE D+ VKTNSLFIDR++C+  R+
Sbjct:    2 LNVSSGEKERATAERLRDECSRLRTETSLLTHRTQMDVNKKLDHRLHDINYWKAELEKQHSETVAEIKALQAFIGRLEKALAATEKPLNISQQCLGYRERRVKIDLVHDNVETHLSKEVEMIENVQALLKKTMDQAHEQLWLLRSAKTQLEKDLGDKYGALGIDGKCSTLNNHSKDIHFAPHAVTIQQHSFTPDEWEAYSSENIAKAERERKASVALRSEINGILMQTYVDLRNIYETVNNEFHKRIEDTVGAKKSLEKELSRVMDELASMDNNIRTLTQAIADKEAPLKVAHTRLDKRSIRPNVELCRDPVQYRLVGEVGEINTSIDRLRMRLAEAQASMQALLRNKENLEDDIEVKTNSLFIDRDQCMVVRQ 375          
BLAST of Tektin 3 vs. Ensembl Nematostella
Match: EDO37357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG13])

HSP 1 Score: 176.022 bits (445), Expect = 2.283e-49
Identity = 132/387 (34.11%), Postives = 211/387 (54.52%), Query Frame = 1
Query:  334 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAY-YNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRK 1491
            R+  +DW  S +I    ++  R  + ++R ++  +  E D+ T+  Q DS  KL  R+ DIN  +  +   + +   E   L+  K   E++L   + PL +T ECL  RE R  IDLV D VE  L  EV++I+  +  + + V+++  QL L + ++H+L  D  DKF   QID    ++ N S  I Y  N    V   + TPETW  F+N N  R+ AE +AS+ LRE I   L +T  D+  +      +  +R  ET  A+++++      ++EI  +E +I+ +K++I  K AP+ VAQTRL  R  RPN+E C DQP+ +L  EV EI  S+  L  +L++A+ +++ L S+ S +  DL  K NSL +D  +C+  R+
Sbjct:   11 RFAVSDWHTSNQIIRTNAERQREASHRVRQESRFLRNETDNHTRWTQHDSNTKLEKRIDDINDWKRSLERCLAETDNEIALLTREKERTERALEAKKVPLDITLECLMLRENRQSIDLVRDEVEAQLHKEVEVIEGTKALLQQKVDESFEQLCLLQEARHQLHLDITDKFTTLQIDGDCYAMNNMSTNIGYQVNPTRTVKGSV-TPETWDSFSNYNKLRAEAEMKASKHLREAIFATLQQTANDLEAQRKASEYSFRKRIHETDQAKSELEWQQKNTMKEIATLEDDIKGLKEAIDAKNAPMMVAQTRLENRTYRPNVELCRDQPQYQLCHEVAEIAGSMRALTEKLREAQNSLEALRSNLSRINEDLAFKNNSLALD-NRCMSVRE 395          
BLAST of Tektin 3 vs. Ensembl Medaka
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:101160513])

HSP 1 Score: 364.77 bits (935), Expect = 4.727e-120
Identity = 195/404 (48.27%), Postives = 282/404 (69.80%), Query Frame = 1
Query:  298 NIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP-MP 1506
            + F S R A+  RYTP+DW KS + +Y  S++ R +AE++R DT R+ ++ D  T+R QE++ K + +RL DI F ++E++ EID M+ E  AL+  KR  E++L+ET+ PL V QECLY+REKR  IDLVHD VEK+L+ ++++IK CQ+++   +++A  QL  NRA+QHELEKD  DK  A++ID     L+N+S GI YY G++  D+ +S P++W +FT++N+ RS +ER  S +LR+EIE +L  T  +M  ++  VN A + R  ET DA++ +Q HL K +QEIF  E  IE +KK+I+DKE PLKVAQTRL  R  RPN+E C D P  RL+ EV EI ++I  L+ +L +AE T+Q L+ +K  LE+DL++K NSLF+D+EKC+  RKTFP MP
Sbjct:   78 SFFPSNRTAMTNRYTPDDWYKSNQSHYWESESSRKSAERLRKDTMRLIQDKDQLTRRTQENTSKNISERLNDIRFWKSELSHEIDNMVTEIAALTEVKRRLERALAETQGPLQVAQECLYHREKRMSIDLVHDGVEKDLI-KIEVIKSCQERMRLHLDRATSQLASNRAAQHELEKDLSDKLTAQRIDDRCHHLRNTSDGIGYYRGIDRQDHAVSLPDSWSRFTDDNILRSQSERATSHKLRDEIEILLNTTSNEMWNQFNNVNVAFTNRISETTDAKSSLQAHLAKTMQEIFQTEMLIESLKKAIRDKENPLKVAQTRLEERTRRPNIELCRDNPYHRLVTEVREIEDTIQKLHERLMEAENTLQALVKTKVKLENDLSIKANSLFLDQEKCMSMRKTFPSMP 480          
BLAST of Tektin 3 vs. Ensembl Medaka
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:101173527])

HSP 1 Score: 210.305 bits (534), Expect = 2.330e-61
Identity = 145/409 (35.45%), Postives = 229/409 (55.99%), Query Frame = 1
Query:  292 VPNIFSSARNALYTRYTPNDWIKSAEINYNV------SDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 1500
            VP+  S+A     T+Y+P +W      NY        +DN+   AE I+  +  + R+ +  T + Q +  + LG+RL +I+  R+E+   I+++ A+ EAL  A+   E++L  T+ P  +  + L  R KR G DLV D VE+ LL EV LI+  Q  +   + +   Q+  N  ++  LE D  DK +A  +D       N SP    +         +  P TW KFT +NL ++A E EASRRLR  +E++L  T  D+  + + V+ A SQR QE  +A+ ++Q  L +VLQ+I + EKNI  ++K+I  KEAPL+V Q+RLH+R  RPNME C D  +  L  E  +I  ++N+L ++L +A  ++ +L  S+  L+ D++ K+ SLFI+ EKC+  R+  P
Sbjct:   36 VPD--SAAGVGRSTKYSPAEWFS----NYQTILVRAGADNL--EAESIQQLSRTLNRDSEGVTLQTQAEGTRLLGERLQEIHHWRSELLRHIEQLQADMEALQAARTRLERALEATDTPYAIATDNLNCRAKRPGPDLVQDSVEEELLKEVGLIRNIQALLKRTIAQVASQIRRNMDAKQVLEMDWSDKQEAYNLDERGGGHSNRSPDTQLHPSSAANHEQVCNPTTWTKFTQDNLLQAAQEEEASRRLRALVEEMLRETTEDLINQRSTVDGAFSQRCQELLEAKTELQIKLTQVLQQIGEQEKNIVGLQKAIHLKEAPLRVVQSRLHLRSLRPNMELCRDPAQLSLEAEAAQIETTLNSLKQKLNEARISLSNLEESRMELQKDISCKSQSLFIEGEKCMTQRRHLP 436          
BLAST of Tektin 3 vs. Ensembl Medaka
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:101164907])

HSP 1 Score: 148.288 bits (373), Expect = 9.055e-39
Identity = 104/376 (27.66%), Postives = 206/376 (54.79%), Query Frame = 1
Query:  412 KIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTR-------KTFPMPIPVI 1518
            +IR +   +  E   +T   ++++ ++L +R+ D++  R+ ++    K+  E +AL+ +K   E++L+ T  PL V+ EC+  RE R G +LV D V++ L  EV+LI++ Q  + + +++A  QL + + ++H+L  D  +K +A  ID    +L  +SP I+       + +  STP+ W++ +N+N+ ++      S+++RE++    A+ Q ++  +      AL +R+     AR+++Q  +  +  EI +ME +I  +   +Q K APLK+A TRL  R  RP M+ C D+ +  L+ EV ++  ++  L  +L +A+ ++Q++      +  DL+ K  +L ++ ++ L TR        T  +  PV+
Sbjct:   35 EIRQECKSLRNETHCKTVWDEKETSRRLTERVWDVSRWRDLLDSCAQKVDEEMDALTLSKELTEQALAATATPLEVSTECMMLREGRRGYELVTDPVQEQLQKEVELIERVQQTLQQHIDEAFQQLCVLQEARHQLTGDLQNKMEALDIDKSCLTLTITSPNISLKTNPTRIPSGASTPQEWVQLSNHNVVQAEEAMRVSQQMREDMSLSRAQLQNELEAERRATEFALRKRSHHEEQARDELQWQIRNMEAEIAEMESDIRELDADLQAKTAPLKLAHTRLENRTHRPGMDLCRDEVQYSLVAEVEQLEATVLALQLKLSKAQHSLQNMRLHHGQMLQDLSRKQEALSLE-QRSLNTRTRLTSGSSTVGVVAPVV 409          
BLAST of Tektin 3 vs. Ensembl Medaka
Match: tekt1 (tektin-1 [Source:NCBI gene;Acc:101161072])

HSP 1 Score: 125.176 bits (313), Expect = 8.814e-31
Identity = 94/368 (25.54%), Postives = 188/368 (51.09%), Query Frame = 1
Query:  400 NNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENV--DNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTF 1497
            + +E+ R +   + +E     KR QED  ++   +L  I F++ E+  ++D++  E + L   +    K+L   + PL VT  C+  R KR   +  HD V+  LL E + +K+ +  +  +  + + QL LNR++++ +EKD  +K +A+ +D++   +   S    +     +    + + T + W   +  N+ ++  ++  SR L+  ++ VL +T  DM K+      A+    Q+  +A+N++++ L K+  EI    K  E ++ ++ + E  L + Q RL +R +RP  E   D  + +L+ +V +I E I  L +++ ++E   + LL+ K  L+  ++ K N L+ID   C+  R+  
Sbjct:   21 HQSERFRAECKELIKETKQICKRMQEDENQQFDQKLRRIQFLKKELELKLDEVNLEIDDLVVLQSRVTKALDACKEPLEVTDLCMKERLKRPNSERFHDEVDGELLKESEGLKRVESLLQRVTEQISEQLRLNRSAKYGIEKDLKEKSEAQNVDNFCTLMATLSMSHRHRPKTHSTPEPSSVLTLDQWENISYANMAKAEQQKTNSRSLQVLVQSVLDQTAADMQKQVQATTTAIQLNVQKMKNAKNQMEDELVKIQSEISSQRKTREDLRVAVAENEEFLSLTQARLALRHERPGKEQWRDPAQRKLLADVQKITEHIKQLQQEVDRSEDEERRLLNWKLRLQESIDSKANCLYIDEVVCMQRREAV 388          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000020792.1 (SMESG000020792.1)

HSP 1 Score: 921.383 bits (2380), Expect = 0.000e+0
Identity = 484/485 (99.79%), Postives = 484/485 (99.79%), Query Frame = 1
Query:   64 MIDYIDEEYKLNKPSKTLTDFYPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 1518
            MIDYIDEEYKLNKPSKTLTDFYPSPSTLQRSYTTLAWRPAVYYQSSRVPNNSTSLVNSTVSPSSIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQRSAAEREASRRLREEIEQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEAC DQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI
Sbjct:    1 MIDYIDEEYKLNKPSKTLTDFYPSPSTLQRSYTTLAWRPAVYYQSSRVPNNSTSLVNSTVSPSSIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQRSAAEREASRRLREEIEQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACRDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI 485          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 273/463 (58.96%), Postives = 350/463 (75.59%), Query Frame = 1
Query:  118 TDF-YPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            +DF +  PS L+RS TTL W  A +Y+SS +  + + L + T      +  L ELEG+KVP +FS+ARNALYTRYTP DW+ +A   +  +D VR+  E+IR DT+R+ RE DD+TKRAQED GKK+GDRL+D NF + E++DEIDKM+ E+  L+  KR AEK L ETEN LH+ +ECLY REKR GIDLVHD VEK+L+GE+D +K+ QD I  +++KAN Q++LNRA+QHE E DS DKF A+QID  A  +KNSS GI ++NGVE +DNC+STPETW K++++N++RS AERE S ++REEIE  L +   DM K+W  VN AL++R QET DARNKIQ HL K+LQEIFDMEKNIEY+KK I+DKE  +KVAQTRLH RL RP ME C DQP  RL+EEV EIRE +  L R+L++AE  +QHLL +K+ LE DLN+K N+LF+DREKCLG RKTFP+
Sbjct:   29 SDFSHGVPSQLKRSLTTLPWNAATFYKSSHISPSISLLNSQTAPLCG-KTALGELEGLKVPPVFSAARNALYTRYTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFPI 490          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 273/463 (58.96%), Postives = 350/463 (75.59%), Query Frame = 1
Query:  118 TDF-YPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            +DF +  PS L+RS TTL W  A +Y+SS +  + + L + T      +  L ELEG+KVP +FS+ARNALYTRYTP DW+ +A   +  +D VR+  E+IR DT+R+ RE DD+TKRAQED GKK+GDRL+D NF + E++DEIDKM+ E+  L+  KR AEK L ETEN LH+ +ECLY REKR GIDLVHD VEK+L+GE+D +K+ QD I  +++KAN Q++LNRA+QHE E DS DKF A+QID  A  +KNSS GI ++NGVE +DNC+STPETW K++++N++RS AERE S ++REEIE  L +   DM K+W  VN AL++R QET DARNKIQ HL K+LQEIFDMEKNIEY+KK I+DKE  +KVAQTRLH RL RP ME C DQP  RL+EEV EIRE +  L R+L++AE  +QHLL +K+ LE DLN+K N+LF+DREKCLG RKTFP+
Sbjct:   41 SDFSHGVPSQLKRSLTTLPWNAATFYKSSHISPSISLLNSQTAPLCG-KTALGELEGLKVPPVFSAARNALYTRYTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFPI 502          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000062615.1 (SMESG000062615.1)

HSP 1 Score: 510.375 bits (1313), Expect = 8.432e-177
Identity = 271/463 (58.53%), Postives = 355/463 (76.67%), Query Frame = 1
Query:  115 LTDFYPSPSTLQRSYTTLAWRPAVYYQSSRXXXXXXXXXXXXXXXXXIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            L +FYP   +++RSYTT+A     Y  + ++      L  +     S+R+ L E EG+KVP+I+SS RNALYTR+T NDWIKSA+  Y  S+ +R  +EK+R D+ R+ R+FDDRT + Q+DS  KLG+R+ DIN +++ ++ EI +++ E+  L NAK  AEK L+E+ENPLH++QECLYNREKR+GIDLVHD  EK LL E+D IK+CQD+I+ ++ KAN Q+ LNR  QHELEKD+ DK+ A +ID  A S  NSS  ++Y+NGVE ++NC+STPETW+KFT +NLQRS +EREASR+LREEIE  L + Q DM KKW EV+ +LS+R QET+DARNK Q HL  +LQEIFDMEKNIEY+KK+I DKEAPLKVAQ+RL VRLDRPNMEAC D PR+R+I+EV EI+ S  +L  QL+ AE+T+Q+LL +KS++E DLN+KTNSLFIDREKCLG RKT+ M
Sbjct:   43 LLNFYPQQGSMRRSYTTVA-STQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVRQFDDRTSQTQDDSTHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 504          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000064101.1 (SMESG000064101.1)

HSP 1 Score: 308.145 bits (788), Expect = 1.737e-98
Identity = 169/400 (42.25%), Postives = 253/400 (63.25%), Query Frame = 1
Query:  304 FSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQXXXXXXXXXXXXXXXXXQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 1503
            +++ARN LYTR++PNDW  S   ++ +S+  R  A +++ D  +  +E + +T+  Q ++ K+L +R+ +I+F R E++ EI  M  E E L    R  +++L  T+ PL +++ CL  RE R GID V D VEK+L+ EV+ IKKCQ+++   + K  +Q+ +NRA+QHE EKD  DK  + Q+D     LKN+S G+AY+ G+E  DN IS P +W KF+ +N+ RS   R +S  LR EI+ ++      M   ++ VN +L  R QE  +ARNK+++HL + +QEIFD EK+I  ++K+I DKE PLK+A+TRL  R  R N+E C D     L +E+ E+R SI  L  Q + AE     L+++KS LE D+ VK NSL ID++ CLG RK FPM
Sbjct:   58 YNTARNQLYTRFSPNDWESSNNAHFKLSEAERAQATRLKSDAWKAVKETEHKTRSRQAEATKRLNERVQNISFWRQELDQEIRSMDIEQENLKEHLRVLKENLEHTQKPLAISEHCLVKREGRQGIDQVQDEVEKSLIKEVETIKKCQEKMNRFLQKGEIQMKMNRAAQHECEKDLKDKSHSHQLDDKMYHLKNTSSGLAYHPGIELFDNTISIPVSWAKFSQDNINRSQKCRASSEALRGEIDMLIRNCANIMWNNFSNVNNSLLSRVQEITNARNKLESHLQRTVQEIFDCEKSINLLRKAIADKEEPLKLAETRLEERTKRLNVELCNDPAMRTLQKEIMELRNSIRLLKEQKRSAEIVYNRLINTKSLLEKDIAVKENSLQIDQKACLGVRKIFPM 457          
The following BLAST results are available for this feature:
BLAST of Tektin 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEKT33.618e-12944.86tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT33.618e-12944.86tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT56.953e-10940.09tektin 5 [Source:HGNC Symbol;Acc:HGNC:26554][more]
TEKT11.432e-7435.81tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534][more]
TEKT41.377e-6736.41tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012][more]
back to top
BLAST of Tektin 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R02E12.45.893e-1623.14pep chromosome:WBcel235:X:4005314:4007634:1 gene:W... [more]
back to top
BLAST of Tektin 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG328193.539e-10339.47gene:FBgn0052819 transcript:FBtr0070051[more]
CG328203.539e-10339.47gene:FBgn0052820 transcript:FBtr0070054[more]
CG174503.539e-10339.47gene:FBgn0040028 transcript:FBtr0345920[more]
CG174503.539e-10339.47gene:FBgn0040028 transcript:FBtr0070056[more]
CG174505.160e-10239.47gene:FBgn0040028 transcript:FBtr0070057[more]
back to top
BLAST of Tektin 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt31.007e-12746.52tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt32.221e-12745.76tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt32.221e-12745.76tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt41.699e-6636.43tektin 4 [Source:ZFIN;Acc:ZDB-GENE-070410-98][more]
tekt18.450e-6635.62tektin 1 [Source:ZFIN;Acc:ZDB-GENE-041114-99][more]
back to top
BLAST of Tektin 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt33.379e-14148.25tektin 3 [Source:NCBI gene;Acc:549229][more]
gdf101.591e-7536.13growth differentiation factor 10 [Source:Xenbase;A... [more]
plcd15.135e-6734.68phospholipase C delta 1 [Source:Xenbase;Acc:XB-GEN... [more]
fam168a1.201e-4035.52family with sequence similarity 168 member A [Sour... [more]
fam168a6.152e-4035.51family with sequence similarity 168 member A [Sour... [more]
back to top
BLAST of Tektin 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tekt31.570e-12442.77tektin 3 [Source:MGI Symbol;Acc:MGI:1918312][more]
Tekt55.542e-10339.78tektin 5 [Source:MGI Symbol;Acc:MGI:1917676][more]
Tekt52.594e-8339.43tektin 5 [Source:MGI Symbol;Acc:MGI:1917676][more]
Tekt11.098e-7634.96tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
Tekt11.098e-7634.96tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
back to top
BLAST of Tektin 3 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BXF9|TEKT3_HUMAN1.738e-12844.86Tektin-3 OS=Homo sapiens OX=9606 GN=TEKT3 PE=1 SV=... [more]
sp|A6H782|TEKT3_BOVIN6.703e-12844.03Tektin-3 OS=Bos taurus OX=9913 GN=TEKT3 PE=1 SV=1[more]
sp|Q6X6Z7|TEKT3_MOUSE1.098e-12342.77Tektin-3 OS=Mus musculus OX=10090 GN=Tekt3 PE=2 SV... [more]
sp|Q4V8G8|TEKT3_RAT8.430e-12142.56Tektin-3 OS=Rattus norvegicus OX=10116 GN=Tekt3 PE... [more]
sp|Q96M29|TEKT5_HUMAN3.339e-10840.09Tektin-5 OS=Homo sapiens OX=9606 GN=TEKT5 PE=1 SV=... [more]
back to top
BLAST of Tektin 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157911910.000e+061.17tr|A0A1I8GB64|A0A1I8GB64_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183185780.000e+061.17tr|A0A267GV76|A0A267GV76_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|226272550.000e+058.39tr|A0A2C9K274|A0A2C9K274_BIOGL Uncharacterized pro... [more]
gnl|BL_ORD_ID|238455470.000e+057.30tr|V4B8B3|V4B8B3_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|170070960.000e+056.62tr|A0A1S3HLM8|A0A1S3HLM8_LINUN tektin-3-like OS=Li... [more]
back to top
BLAST of Tektin 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tekt36.360e-12444.09tektin 3 [Source:NCBI gene;Acc:103037718][more]
tekt43.317e-5935.55tektin 4 [Source:NCBI gene;Acc:103034475][more]
tekt21.822e-4030.29tektin 2 [Source:NCBI gene;Acc:103026688][more]
back to top
BLAST of Tektin 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TEKT24.527e-2230.37tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
TEKT21.289e-1530.98tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
back to top
BLAST of Tektin 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tektin 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO392923.854e-8439.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406817.088e-7239.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373572.283e-4934.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tektin 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tekt34.727e-12048.27tektin 3 [Source:NCBI gene;Acc:101160513][more]
tekt42.330e-6135.45tektin 4 [Source:NCBI gene;Acc:101173527][more]
tekt29.055e-3927.66tektin 2 [Source:NCBI gene;Acc:101164907][more]
tekt18.814e-3125.54tektin-1 [Source:NCBI gene;Acc:101161072][more]
back to top
BLAST of Tektin 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020792.10.000e+099.79SMESG000020792.1[more]
SMESG000021346.10.000e+058.96SMESG000021346.1[more]
SMESG000021346.10.000e+058.96SMESG000021346.1[more]
SMESG000062615.18.432e-17758.53SMESG000062615.1[more]
SMESG000064101.11.737e-9842.25SMESG000064101.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029546 ID=SMED30029546|Name=Tektin 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1768bp
CCAATATGGTTAATATTTCAAGTTAATTTCAATTGTGAATACGGCAAGTC
ATTGTAGAAACAAATGATAGATTATATAGATGAAGAATACAAACTAAATA
AACCATCAAAGACATTAACAGATTTTTATCCAAGTCCATCAACATTGCAG
CGATCCTACACGACTCTGGCATGGCGTCCGGCGGTTTATTATCAAAGTTC
TCGAGTCCCAAATAATAGCACCAGTTTGGTCAATTCCACAGTTTCTCCCA
GTTCAATTAGAAATTATCTCACAGAATTAGAAGGCATAAAAGTACCAAAT
ATCTTCTCTTCGGCACGCAACGCTCTTTACACTCGTTACACTCCGAATGA
TTGGATCAAATCCGCCGAAATCAATTACAATGTCAGCGACAATGTCAGAA
ATAATGCTGAGAAAATCAGATTGGATACTTCGAGAATGGCTCGAGAATTT
GACGATAGAACGAAACGAGCACAAGAAGATTCTGGAAAGAAATTGGGAGA
CAGATTAGCCGATATCAATTTCATGAGAAATGAAGTGAACGATGAAATAG
ATAAAATGATGGCCGAATCTGAAGCCTTATCCAATGCCAAACGAGCTGCT
GAAAAAAGTCTGAGTGAAACCGAAAACCCTCTCCATGTGACCCAAGAATG
TCTCTACAATCGAGAGAAACGTTCCGGAATCGATCTGGTGCATGATATGG
TTGAGAAAAACTTACTTGGAGAAGTGGATTTAATCAAAAAATGTCAAGAT
CAAATTGCTGAACTTGTCAATAAAGCAAATGTTCAGTTGAACTTGAATCG
CGCTTCTCAGCATGAATTGGAAAAAGACTCTCACGACAAATTCCAAGCTG
AACAGATTGACAGTTATGCTCAAAGTCTCAAAAACTCATCCCCGGGCATT
GCGTATTATAATGGGGTAGAAAATGTTGACAATTGTATTTCCACTCCTGA
AACTTGGCTGAAATTCACAAACAATAATTTACAGCGGTCTGCTGCGGAAC
GAGAAGCTAGTCGACGATTGCGAGAAGAAATTGAACAAGTTTTAGCCAGA
ACTCAACGAGATATGGCAAAAAAATGGGCTGAAGTCAATGCAGCTTTATC
GCAGAGAGCACAAGAAACAGCGGACGCTAGGAATAAGATCCAAAACCATT
TGAATAAAGTTCTCCAAGAGATATTCGACATGGAAAAGAATATTGAGTAT
ATTAAAAAGTCAATTCAAGACAAAGAAGCTCCACTAAAAGTTGCTCAAAC
TCGCTTGCATGTCAGACTTGATAGGCCAAATATGGAAGCGTGCGGTGACC
AACCTAGAAGCCGTTTAATCGAAGAAGTCCACGAGATCCGGGAATCCATC
AACAACCTCAATAGGCAGTTGCAACAGGCGGAGGCCACCATGCAACATTT
GCTGTCTAGTAAGTCCAATCTCGAGCATGACTTGAATGTCAAGACCAACT
CCCTATTCATTGACCGAGAGAAATGTTTAGGAACTAGAAAGACATTTCCC
ATGCCTATTCCAGTAATATAAAAGCTAGAAGTCGTCGTCCTTTGTCAGAT
TGATACCCTTACATTCACGTTTGATGTTTCTCACTGAGTTTTATTTGCAG
AATTTTCTACAATAGATTATAACTTATATTTATAAATTCACATTTGACTG
TTTCTACAGTGATATAAACAAAATATAATTTGCTGTTCGTATACATTTTG
CTAATCCGTGTAGGCGCCTCACAGAAAGGAGTGTATTTGTGAATTTATTT
ATAAAATTTGTAATAGAG
back to top

protein sequence of SMED30029546-orf-1

>SMED30029546-orf-1 ID=SMED30029546-orf-1|Name=SMED30029546-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=486bp
MIDYIDEEYKLNKPSKTLTDFYPSPSTLQRSYTTLAWRPAVYYQSSRVPN
NSTSLVNSTVSPSSIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKS
AEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLAD
INFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNR
EKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQH
ELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLK
FTNNNLQRSAAEREASRRLREEIEQVLARTQRDMAKKWAEVNAALSQRAQ
ETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHV
RLDRPNMEACGDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSK
SNLEHDLNVKTNSLFIDREKCLGTRKTFPMPIPVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000435Tektin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 155..182
NoneNo IPR availableCOILSCoilCoilcoord: 415..456
NoneNo IPR availableCOILSCoilCoilcoord: 313..333
NoneNo IPR availablePFAMPF03148Tektincoord: 97..479
e-value: 7.4E-137
score: 456.2
NoneNo IPR availablePANTHERPTHR19960:SF11TEKTIN 3coord: 16..481
IPR000435TektinPRINTSPR00511TEKTINcoord: 382..398
score: 67.65
coord: 424..440
score: 41.18
coord: 455..467
score: 46.15
coord: 401..421
score: 47.62
IPR000435TektinPANTHERPTHR19960TEKTINcoord: 16..481