Protocadherin Fat 4

Overview
NameProtocadherin Fat 4
Smed IDSMED30029539
Length (bp)14371
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin Fat 4 (SMED30029539) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin Fat 4 (SMED30029539) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin Fat 4 (SMED30029539) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin Fat 4 (SMED30029539) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029539

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029539SMESG000002878.1 SmedASXL_004349SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029539SMESG000002878.1 SmedASXL_005411SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029539SMESG000002878.1 SmedASXL_018216SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029539SMESG000002878.1 SmedASXL_005780SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029539SMESG000002878.1 SmedASXL_019894SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30029539SMESG000002878.1 dd_Smed_v4_12707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029539SMESG000002878.1 dd_Smed_v4_12707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029539SMESG000002878.1 Contig54999uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029539SMESG000002878.1 Contig54999newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029539SMESG000002878.1 Contig9916uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029539SMESG000002878.1 Contig9916newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30029539SMESG000002878.1 dd_Smed_v6_12707_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30029539SMESG000002878.1 dd_Smed_v4_30149_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin Fat 4 vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 276.944 bits (707), Expect = 5.532e-73
Identity = 307/1155 (26.58%), Postives = 532/1155 (46.06%), Query Frame = 3
Query: 2871 LSGDLSV----SNTEIIIEFHPIFD-SPIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLS--IIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVD---VVEQE----FIFFITAEDHGIP---RLNSSVKVYVK-INP-SPKSKQFFDKQTFFQNISEDMKITEKIFKL---EID--HQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAE---RQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQI-TVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE-FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRV-------TVEVLINLINVNDETPLIHNPTTVYLPKINQNHNIMIKCSDQD-NLGPLSY 6203
            L+ D+ V    S+  + +  H + D SP+F +  Y   + E+   ++   K+      +  N  ++  I E +    + IF DG LY+ SELD E + +Y   V+A ++  +  S  V V + ++D NDN P+F++ +Y F      +  + +GKV A+D D G NG V YS E   V+ DF E+ + SG +      D   ++ +     F F + A D GIP   +  ++V VY+K IN  +PK    F K  +   ISE      ++ ++   ++D  +  ++ Y I K  ++  F+I+  +G + LI +LD EA   + L I A D+ +       +   L ++I+D NDN+P F    L   +L E+ ++G ++   TA D D G N  + Y +  TG  +   F I   +G+++L + +D+E +  +   ITA D G P   S +SV + + + ND  P F      + IV +N+ IGT+V  V A DPD +   ++ Y +    P  + F I+ + G +  +  I +E +  F+L V A D        RY  ++V + +   N++    ++  A+    S+     + T+ A    +  N    Y + N   D  I++RY+GD+ + S   +  + +    ++S   L  +   +  +T+L + +       F +  Y   + E +   G  +  ++A  P    + +EYYI  + C      K    +  + + TG I    I LDRE  +G+ +  V+V  I++     R +  +V + ++D NDN PVF  +       EN   G KI   T    D+  ++ + Y  I+   + F +D  SG +  +   LD E  + +   ++  DG  +S   I I + D ND    F+   Y F I E     +++  +   +  +  N  I + +  +    +F +NP  G+      +DYE   +YIL + A D   Q          T  V  +I+D+NDN P+F     + S+ E++P+ S ++    +DAD      L + I S +     TV+   GV+     LD E    + L V   D L ++       T +V I L++VND  P   +P   Y+P+      ++ K    D + GP SY
Sbjct:  967 LASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEM--VQPDF-ELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPK----FLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIP---LNSTCTLNIDILDENDNTPSFPKSTLFVDVL-ENMRIGELVSSVTATDSDSGDNADLYYSI--TGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIV-ENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDTFIVDRYSGDLRVASA--LVPSQLIYNLIVSATDLGPER--RKSTTELTIILQGLDGPVFTQPKYITILKEGEPI-GTNVISIEAASPRGSEAPVEYYIVSVRC----EEKTVGRLFTIGRHTGIIQTAAI-LDRE--QGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATRR-LDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQ--------FTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDK-NGVLKVLKALDRESQSFYNLVVQVHD-LPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSY 2084          

HSP 2 Score: 231.876 bits (590), Expect = 2.153e-59
Identity = 297/1204 (24.67%), Postives = 521/1204 (43.27%), Query Frame = 3
Query: 3183 KEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNK---LVDVVEQEFIFFITAEDHGI-PRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKC-TQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFI-LSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPI-LQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVL-TYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN-----FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPI-SDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEI--PEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCH-----------NFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD---GLHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQNHNIMIKCS---------DQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGL--LYANSINVSLSCSD------TIHNTIKNVSLIVLDRNRSSKNYTAFIKLERFEKSPLK-IQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGEFKPIEGFAPRKHEYRFTIAG 6629
            + +S+   +VIFV D ND+ P+FS Q Y  +++    P + +  + A D DSG+N  + YSI      L +  I   SG + T     L   +  + +  I+A D G+ P+++ +  V   ++ + +   F   + +  ++ E+     ++  L     ++     V + + +  T + +F ++  +G +  I+ LDRE  AF+ L ++ATD  S   S   ++  + V+++D+NDNSP+F    +  F  + E+   G+ +   +A D D G NG V+Y ++A      S F+++  SG +     +D E K  +   I A D G     +   VT+T+ +  D  P F++ +   F+V +NVA+G  VG V A   D N  + YL +       F IN ++G L+ +N I  +E SF    + V A          V + +K  N++    L    ++ + ++      I   KA    + +N   +Y LK +  +   IN   G + L     V   S  I      E L SD  +   S+ ++L +   H++N     F +  Y   + E +     + F++QA    +    ++ Y I +   G +  I  P+  + +  E          LDRE+ +  +  + VV  DR           V + +ED NDNRP+F +  + F+  E    G   +VG V A DKD     E  +  E+  P+F L   SG +T +    D E++    G   V   T  +T   I          H            F  D Y   I E+A   T + +V+  +     N +I + I+    +  F+++   G +T  G++DYE    Y L+I A D     L   C      T+ + I+D NDN P F  + L V + E++ I   +  + A+D+D  D   L + I   N+    +++P TG I  A  LD+E    + L ++  D        T+ V+I++ + ND  P    P  ++   +    NI I  S         D D  G LSY I+       +  +D + G +  N  +   +AN   +++  +D      T    +KNV+++V D N    N   FI        P   I SV   ++  + D+     ++  Y +   D + ++++  +G+ +      P +  Y   ++ 
Sbjct:  453 QARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVS-GNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQS---SMARINVSLLDINDNSPVFY--PVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDR---SRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVA-YSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSF--YQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAGSYQI------EILASDMGVPQLSSSVILTVY-VHDVNDNSPVFDQLSYEVTLSESEPV-NSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGI-FPDGQLYIKSE----------LDRELQD--RYVLMVVASDRAVE-PLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGS--FVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQ-FDRESLMRRRG-TAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTC------TLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFP-PGDIFKSIV---ENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLN---DNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIE--YEIINGDTDTFIVDRYSGDLRVASALVPSQLIYNLIVSA 1603          

HSP 3 Score: 231.876 bits (590), Expect = 2.360e-59
Identity = 161/521 (30.90%), Postives = 261/521 (50.10%), Query Frame = 3
Query:  171 FRVSENQPINTIVGQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN-NYKIESGNEDDRFALS-GVGVQYRGQLLLRVVRP-LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDL-IAVSIIGGNDENIFALERTH-GNVHILRQIKAIHNINLQSYTITVRAIDN-GNP------SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVK--LDKIKLEIIARDAGIN 1691
            F+V E QP  T+VG +  + GF+Y       LF +N  TG + T++ IDRESL SD+I + +    L         ++V + D NDN P+F    +     E+ +    + L  ATDSD    GV + +Y+I  GNE  RF L   +     G  L  V +  LDRE   +Y+L + VEDKG+P  +G L+V + V+D NDN PVF  S Y   + E  + G  V++V A+DAD G N ++ Y+ +   +     F +D ++G I + +P      +   +L V+A D G PSL+      + ++ +N   P  +  Y  +T + A ++        +A++   D D    +  I+V I+GGN++  F ++ +   N+ +++   A+    + SY +TV   DN G P      ++ +   ++I +N  N + PVF  +   V +   A   S+++   ATD D+GLN  + YSI  G+    F I + SGL+T        +    +I L I ARD G++
Sbjct:   49 FQVLEEQPPGTLVGTIQTRPGFTYRLSESHALFAINSSTGALYTTSTIDRESLPSDVINLVV----LSSAPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGT----PFQMDPETGLITVREPLDFEARR-QYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVH 560          

HSP 4 Score: 218.779 bits (556), Expect = 1.839e-55
Identity = 278/1089 (25.53%), Postives = 478/1089 (43.89%), Query Frame = 3
Query: 3207 VVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVF----AMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQN-----ISEDMKITEKIFKLEIDHQQ---------MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIA-FHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHS-NLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAII---LPKSSFYREKIATLKAQSNSKNLNSRFMY-LLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTK----LVLNIGD-PHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYP-GNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWIN--EIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD-GTF--TSTXXXXXXXXXXXXQCHNFTHDRYHFHIHET-APIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLH----RVTVEVLINLINVNDETPLI-HNPTTVYLPKINQNHNIMIKCSDQD-NLGP---LSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSD 6326
            V I V D NDN P+F +Q+   +      P+  IG V     A DPD G NG + Y I  +  + D   +D  SG L     +   +  +   ++A D G  R  S+ ++ + +       Q  D   F Q      + E   I   +  +E    +         +V+ R  + T    F+I +HTGII     LDRE  A  +++ + A + S+       A   + + + D+NDN P+F  D L+   + E+   G+ +   TA D D+G N  V Y + +   +S   F+ID  SG L   + +D E + K++ ++ A D     L S ++ + +T++++ND  P+F++     F + ++   G+ V  + A D D+  N  + Y+ +    D  F +NPI+G+ +++  +  EV   + L V A D   Q    +    +   +DN     + +Y   +   LP  S     +           +NS+  Y +    S  +  +++  G + +      E  S     ++ +  L      ++ ST     ++L++ D P      K  Y   IPE  T     +F+ QA  P   P S +EY + +   G    I   +  +RL  E          LDRE  E S  T+ VV  D+G+  S    T+V + + D NDN P+FA   +     ENT  G  I        D+  +  + Y  +N     EF +D  +G +T +  PLD E    +   +Q +D G+   T T+ + I++ D ND    F    Y  ++ E    +   I QV  ++     N  + + +      + F+++    +  TQ  +D E    ++L+ITATD    +L      T T T+ V + D+NDN+P F +     +IPED P  ++++ + ASDAD S   +  I+  N     T+NP TG I T+ +LD E  + + L V C+D         +  VL+ + +VND  P   H+P   ++P      + +   +  D ++GP   L Y +  S ++ +  ++D + G +     L  A+ +  S+   D
Sbjct: 1515 VTILVTDLNDNVPMFISQNALAA-----DPSAVIGSVLTTIMAADPDEGANGEIEYEI--INGDTDTFIVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTIIL-------QGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRA--EVEITLQDINDNPPVFPTDMLD-LTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDS---FRIDPESGDLIATRRLDRERRSKYSLLVRADD----GLQSSDMRINITVSDVNDHTPKFSRPV-YSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGS----TVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDK-NGVLKVLKALDRESQSF-YNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY---IPE-NTPIDTVVFKAQATDPDSGPNSYIEYTLLNP-LGNKFSIGTIDGEVRLTGE----------LDRE--EVSNYTLTVVATDKGQP-SLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAK-PLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQ-SLDRETKERFVLMITATDSGSPAL------TGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQF--TINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSL--SGRNSEKFHIDPLRGAIMAAGPLNGASEVTFSVHVKD 2542          

HSP 5 Score: 196.823 bits (499), Expect = 7.977e-49
Identity = 221/928 (23.81%), Postives = 383/928 (41.27%), Query Frame = 3
Query: 10608 SGHLSVDRKGIIRIRKSIDKESVDSLTVQSSIQFKGKSELL---TLTVNVNDENDSESKSRITDIFIGIAENAFQLTRIAQLLPIDPDITGDFQCRLDTLNVPLGILITPDCWLHIINTSSAIRSINNSY-MRILHHDGYHNAVVSSFRMKVNLLNNKNIQTNWIV-FKIPNL--FIT--------------SXXXXXXXXXXXXXXXNVDVALMAIETVKNYLVIWPRSPNREKALQVVEQFKDKLEVVLKIEIQEITIRLCNRKLCNSHGLCSIGIQVNYEQLFTDEDSITANIIYIYPSVNFNIKCLCDDGFLGEKCAL-LAKCRQQVCHNGGVCGVNRNGEAVCECAPGYTGYNCEYDINECEKTNLCTPHGNCNNIRGGFKCECQLNWIGNGLCTQPFNYCSSNPCSELGTERCIPILGGFKCRCHFGNFGDHCQYSAISFPAESYMEMDFQKISK----MSLEFSTILKDTPLXXXXXXXXXXXXXXXXXGSIRLSIFEDSALVS--------QRDSNKDLSNGNWWKLDXXXXXXXXXXXXXACEDWNQCDHTIDQFRTIRQRFDVSSSMGRNNVDSNSIIRVLIGSIQKLKLSGVQYFVGCARNLQF-FNGSLIRNEQ----KGVLFDSCPRYRNGILPCSNSDLECGNVGKCIDEWFASRCECPPGYQPPSCTPGYSSYALAPNTIISFVKRPKSDSTNSNSPKNFDSYLKRK--RSVSPE---YTMISIRIKTRDRNSIIFMALSSFHSYTLVQLENGLVKVVDKY--AGSYQEMLHKVVTVNDDKIHTITVTRHSTGTVSVTVDFVVAQVNWLQSHDILGHSVNEVYLAGLPDLKKIENSLSFPNFVGCISDVRFNNKTMPLRGLSENFNVSIIQGSVTSGC-SSDICRQSGVCEKYQKCLEIDGIPHAIWGQYKCV 13250
            + + S+   G++   + ID+E +    +    +  G  ++    T+ + V D+ND+ S+SR  +IF+    N F    +  + P DPD+   F C L +    L  +    C L+     S  RS + ++ + +L +DG H+ V S+ R+     +N  +  + ++   +P +  F+T              + +     L +     N    L A++   N  V      N        E  K+ L     ++++ +    C    C + G C   + V+   +    +S+   I+   P   F  KCL   G+ G  C + + +C    CH+GG C  N  G   C C  G+TG  CE DINEC ++  C     C N  G F C C+  + G  +C    NYC  NPC   G+  C   +  + C C FG FG HC+ ++  F   SY  M+F  +      + ++F+TI     L+    + +           + L I E+    S        +  + K +S+G++  +       +  ++V +C +  +  +       +   + +     R  V     IR L   +Q+        FVGC   ++F  NG  +   Q    +G+L D CPR       C+ S   C + G C+D W   +C C  G      T  Y   ++ P+T +S   + + D   S + K    YL R+  R    E      + ++ +TR  N ++     S  +YT V+++NG V        AG  +  + +V  V D   HT  + ++ T TV ++VD +  +     + D  G  V  + L G+P  +   ++ +   F GCI+ + +  +++P  G     ++S    SV  GC   +IC  S  C     C+         W  Y+CV
Sbjct: 3555 TSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFSIPGGTCDLN-----SQPRSTDGTFDLTVLSNDGVHSTVTSNIRVFFAGFSNATVDNSILLRLGVPTVKDFLTNHYLHFLRIASSQLTGLGTAVQLYSAYEENNRTFLLAAVKRNHNQYV------NPSGVATFFESIKEILLRQSGVKVESVDHDSCVHGPCQNGGSCLRRLAVS--SVLKSRESLPVIIVANEPLQPFLCKCL--PGYAGSWCEIDIDECLPSPCHSGGTCH-NLVGGFSCSCPDGFTGRACERDINECLQSP-CKNGAICQNFPGSFNCVCKTGYTGK-MCESSVNYCECNPCFNGGS--CQSGVDSYYCHCPFGVFGKHCELNSYGFEELSY--MEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQTGDRAEF-----LALEIAEERLRFSYNLGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSCSENQEPGYCTVSNVAVSDDWTLDVQPNRVTVGG---IRSLEPILQRRGHVESHDFVGCI--MEFAVNGRPLEPSQALAAQGIL-DQCPRLEGA---CTRS--PCQHGGTCMDYWSWQQCHCKEG-----LTGKYCEKSVTPDTALSLEGKGRLDYHMSQNEKR--EYLLRQSLRGAMLEPFGVNSLEVKFRTRSENGVLIHIQES-SNYTTVKIKNGKVYFTSDAGIAGKVERNIPEVY-VADGHWHTFLIGKNGTATV-LSVDRIYNRDIIHPTQDFGGLDVLTISLGGIPPNQAHRDAQT-AGFDGCIASMWYGGESLPFSGKHSLASISKTDPSVKIGCRGPNIC-ASNPCWGDLLCIN-------QWYAYRCV 4425          

HSP 6 Score: 194.897 bits (494), Expect = 3.511e-48
Identity = 341/1468 (23.23%), Postives = 632/1468 (43.05%), Query Frame = 3
Query: 2892 SNTEIIIEFHPIFDSPIFFEPFYTFVVKENSLSHTPLRKISLIQSQN----IDNYHLSI-IEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKST------KVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDM---KITEKIFKLEIDH--QQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILS--ESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGY-PA--LHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSV-HPPDHPFVINPISGILSVSNPI-LQEVS-FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDE-IQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDK-IIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTK--LVLNIGDPHNLNFQKNDYFFQIPE-CKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDG----TFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHR--VTVEVL-INLINVNDETPLIHNPTTV--YLPKINQNHNIMIKCSDQDNL--GPLSYDIMTSSKDIQNIYVDRITGKV-SFNP-----GLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYTAFIKLERFEKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGEF---KPIEGFAPRKHEYRFTIAGIKRDSLNQENQINIETILTYKEIELCYPSFLGTPYSF------QIDHRVTAPKYLGSVSVGYCSNQKILYYLSSGHSFFYVNGTSGDIFITRDLP-----------LGQYKFKLSSLIDTNPKTYLSTIVTVSTMGPLENTA---KCEFFTLRLSVDSSVELGTKVGKMSITD 7088
            S TE+ I    + D P+F +P Y  ++KE     T +  I     +     ++ Y +S+  EE   G+  +F+ G    + +      ++    +  V+    EKST      +  V I +QD NDN P+F T     ++  +    + I ++ AMD D G N  V Y+I  +    D   ID +SG L   + +D   +     +   D G+   +S +++ + ++        F +  +  +I ED     +   I   + D      +TY +++  + G F +N  TG+ +L   LD E   +++LT+ A D     G        +Y NI+DVNDN PIF   +LN++  S  E+  VG+ +  +   D DDG+N Q+ Y + A+G +S+  F +D  +G L + + +D E +  +N ++   DL   PA    S   V++ + ++ND  P F    +L +I  +N  I T V +  A DPD+    Y   ++ +P  + F I  I G + ++  +  +EVS + L V+A D  +        V V +   N++  I       + + +++     I  + A    +  N +  Y + N + ++   I+  TG +  T   P++        L    + R  T     ST   ++L+I D   + F+ + Y   +PE   T P   L  +         S L Y +F    G +E     +    L   +G + V    LDRE  E  +  + +   D G        T + + ++D NDN P FA++ +    PE+   G  + +  V A D D         I    +F+++ ++G + TS + LD E    +   +  SD       +S+ ++++ + D ND    F H  Y  HI       + +  VT+ ++   PN  + + + S      F ++P  G I   G ++   +  + + +      +     P  +T +TTV V  V+  D  P           PE+ P++S ++  I   + + + + + I S N      ++ +TG +S +  LD+EK +++ + +   DG      + E L I +++VND  P+      +   L  ++    + +   D+D+   G L Y+I+  + +  +  ++  TG++ S  P        Y  +I  S   S +   ++K V + +LD N ++  ++        E SPL     +    +   D+ +     S Y++ +    F  INPSTG+    +P+     R+   R+ I     DS      ++ +  +   +I    P F  T Y        +I  +VT    + +      SN ++ Y++ S   +F +N T+G+IF  + L            + ++ F ++S     P     T VT++ +   +N     K ++FT    V  +V++GTK+ +++  D
Sbjct: 1613 STTELTIILQGL-DGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGR--LFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTI--ISGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGL--QSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAED-----GGGQFTTIRVYFNILDVNDNPPIF---SLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSI-ASG-DSLGQFTVDK-NGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTF-LSPKLTYI-PENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAI--TVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPV-FELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLF----GGNE-----DNAFTL-SASGELGVTQ-SLDRETKE--RFVLMITATDSGSPALTGTGT-INVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLL--VNASDADASKNAVIRIIGGNSQFTINPSTGQIITSAL-LDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSL-SGRNSEKFHIDPLRGAIMAAGPLNGASEVTFSVHV------KDGGSFP--KTDSTTVTVRFVNKAD-FPKVRAKEQTFMFPENQPVSS-LVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNME-NSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVK-VMINILDENDNAPRFSQIFSAHVPENSPLG----YTVTRVTTSDEDIGINAISRYSIMDASLPF-TINPSTGDIVISRPLN----REDTDRYRIRVSAHDS---GWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQ---VFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFT---PVTKNVKVGTKLIRVTAID 3009          

HSP 7 Score: 170.629 bits (431), Expect = 6.311e-41
Identity = 292/1297 (22.51%), Postives = 543/1297 (41.87%), Query Frame = 3
Query: 2931 DSPIFFEPFYTFVVKENSLSHTPLRKISL-------IQSQNIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRK---------QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKI----NPSPKSK-QFFDKQTFFQNISEDMKITEKIFKLEIDHQQM------VTYRISKCTQKGAFSINQ----HTGIIHLINRLDREAIAFHVLTIVATDN-SSTKGSEYLA---VTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQP--VDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE---VLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIIL---PKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNT--MIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE--FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD---GTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD----LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERH------ALTVSCTD-GL-----HRVTVEVLINLINVNDETPLIHN---PTTVYLPKINQNHNIMIKCSDQD--NLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLY----ANSINVSLSCSDTIH-NTIKNVSLIVLDRNRSSKNY---TAFIK-LERFEKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTG 6566
            ++P+F +P      KE+S S    R++ L       I S  +D+    II  +  G++ +    +        +   K         QY   V   +K + ++   + V + VQD NDN P+F +  Y   +       +++ +V A D D G N  + Y ++    E    ++D ++G +   + +D    +++   + A D G+P L    +  +++    +  P  K ++F   + + ++ E+ ++   +  L +           ++ +I    ++  F +      +  +I + + LDRE I  + LT+  +DN  +  G+   A   V +L + + D+ND+ P+F         LSE    G+ +   +A D D GLN  +RY + +     +  F I   SG +       +D EL  +    I+A D G     S   + VT+ ++NDEKP F++    +  V +N   GT +  + A D D  +   V + LQ        F ++P+SG LS  + + +E    + L+V+A D     +     + V +   +DN      + Y A I    P  S+    I T+ A       N    Y +      +  +N  +G   + ST           + + + +     L   +   + + +     L+ Q N   F     +      +F   AL  G  +  +     D+   IS  I   +   M  +++ TG ++  N+ +DRE  E S   ++VV       G+    T V + ++D NDN P F       +  EN   G  I+       D+ ++  + Y  + + P+  F++++ +G ++  G PLD  A +Y I +I  SD      +S+  + + + D ND    F    Y   + E+ P+++   +V   +  +  N  I + I        F + PD G +  + E+D E  + Y+L++ A+D + + L      + T  V V + D+NDN P+F++T       E+    S + ++ A D D          FE++ P+ +L    + I+G I+     D E   R       + TV  TD G+      + TV V +   ++ND  P         T+     N    + +  SD D  N G + Y I+  +++ Q   +D  +G+V+    L Y    A S+ +    S TI  N+   +++ +LD N ++ ++   T F+  LE      L + SV        D+  +Y+ +    N     +  + I+P+TG
Sbjct:  131 NAPVFPDPSIVVTFKEDSSSG---RQVILDTATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQD---EGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVY-RVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSG--NGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSY----ITTVSATDPDLGTNGTVKYSISAGDRSRFQVNAQSG---VISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITV-----LDTQDNPPVFS----QVAYSFVVFENVAL--GYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANV-IDRE--EQSFYQLKVVA----SGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLY-SLKQNPKNLFAINEKNGTISLLG-PLDVHAGSYQI-EILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPD-GQLYIKSELDRELQDRYVLMVVASDRAVEPL------SATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFEL----HAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMK--DINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQ-FAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGEL-VSSVTATDSDSGDNADLYYSITGTNN-----HGTFSISPNTG 1370          

HSP 8 Score: 170.629 bits (431), Expect = 6.364e-41
Identity = 325/1317 (24.68%), Postives = 567/1317 (43.05%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFIT--AEDHG-IPRLNSSVK--VYVKINPSPKSKQFFDKQTFFQNISEDM-KITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNII--DVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYP-ALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPI--LQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFM--YLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTK----LVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQAL-YPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCT--KVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQD--------NHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEI--LSPNDDLL--MTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLINVNDETPLIHNP---TTVYLPKINQNHNI-----MIKCSDQDNL--GPLSYDIMTSSKDIQNIY-VDRITGKVSFNPGLLY--ANSINVSLSCSD---TIHNTIKNVSLIVLDRNRSSKNYTAFIKLERF----EKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGEFKPIEGFA--PRKHEYRFTIAGIKRDSLNQENQINIETI-LTYKEIELCYPSFLGTPYSFQIDHRVTAPKYLGSVSVGYCSNQKI-----LYYLSSGHS---FFYVNGTSGDIFIT 6884
            Y+ TV+A +K     S+   VV+ V D NDN+PIF+   Y   IN +T   T I +VFA D D G NG V Y I       +F  IDS +G +   K +D  E+   + +T  A D G  PR ++S    V + IN        F+   +  N+ E++  +   I ++     +      ++Y +    +  AF+++  +G + +   LDRE     VL I ATD+    GS  L  T   +N+I  DVNDN P F + A    I  E    GT +    A+D D   N  +R       +   S F I+  +G +  +  +D E K  +  ++   D G P  L S+ SV VT+T++ND  PRF     +  I    +  G+ V  V   D D   N  L+Y  S    +  F I+P+ G +  + P+    EV+F + V   D     + D  +V V   +  +           + P++      + T+   S    L    M  Y+   +  +   I++ TG V ++   P++F  I   +++ +E+ R      + S +     VL++ D   + F+++ +  +I E   +P  K+  + A+     P   L+Y I +     S  I      IR  +           LDRE     +++  V+ I     GS  + T  KV +NI D NDN P F+ + F  H PEN+  G  +   T    D  +++   Y  ++    F+++ ++G +  S  PL+ E    +  ++   D  +T + ++ I + D ND    F+   Y+    E   I + + QV   +     N  + + I S+     F +N   G I  +  + Y+          N +  ++T++D  + SL         TTV ++IVD NDN P F  ++    + ++V + +++I++ A D DK   L  E+     ND+ L    ++  TG IS A  L  +  +   +TV+  D G   ++ +  ++ I V +E    H P    +     I ++H+I      +   D+D    G + Y I  SS + + I+ ++  TG ++    L Y       +++S  D          +V++ V+D N    N   F+  + F    E +P     +   L   + D     ++   Y +   D + ++I+P+TG     +GF     K  Y  T   +K  ++  E + +  T+ +  K      P F+   Y F+I         +G V   + S++ +     ++YL  G+S    F +N  +G I+++
Sbjct: 2120 YTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEF-RIDSVTGAITVAKPLD-REKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDIN---DFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSA-SGELGVTQSLDRETKERFVLMITATDS----GSPALTGTGT-INVIVDDVNDNVPTFASKAYFTTI-PEDAPTGTDVLLVNASDADASKNAVIRI------IGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLP-GSFVFAVTVTDADIGPNSELHYSLSGRNSEK-FHIDPLRGAIMAAGPLNGASEVTFSVHVK--DGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSS----LRGEPMSYYIASGNLGNTFQIDQLTGQVSISQ--PLDFEKIQ-KYVVWIEA-RDGGFPPFSSYEKLDITVLDVNDNAPI-FKEDPFISEILE-NLSP-RKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRP----------LDRE-----KVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTGDIVIS-RPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQ--SEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLI------SETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAID-DKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVH-ITVTEEN--YHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSI--SSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVN---DNSPVFLSDDYFPTVLENAPSGTTVI--HLNATDADSGTNAVIA--YTVQSSDSDLFVIDPNTGVIT-TQGFLDFETKQSYHLT---VKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEV---FASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVS 3358          

HSP 9 Score: 169.859 bits (429), Expect = 1.134e-40
Identity = 268/1184 (22.64%), Postives = 484/1184 (40.88%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPR-LNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVE-----VVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQK-IYVGTVQAHDKDLDSTLEYIWINE--IPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGT--FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSC---TDGLHRVTVEVLINLINVNDETP-----LIHNPTTVYLPKINQNHNIMIKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDTIHNTIKN-------VSLIVLDRNRSSKNYTAFIKLERFEKSPLKIQ----SVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGE 6569
            ++++   + A +      +    + + V D NDN P F++++YF +I       T +  V A D D+  N      I  +     F  I+  +G++ T+ L+D   +  +   +   D G P  L+SS  V V +     +   F    +  +I         +F +     +I     + Y +S    +  F I+   G I     L+  +      ++   D  S   ++   VT  +VN  D     P  +      F+  E+  V +++   T +     L G+      A+G    + F+ID  +G + ++QP+D+E   K+   I A D G+P   S   + +T+ ++ND  P F ++  +  I++              +D   N  L Y       ++ F IN  +G +    P+ +E     V+    +++       SVKV I    +N++  +     +  +P++S     +  +        +N+   Y + ++S     IN  TGD+ ++   P+     D  + I + +  S   +    T  V +I D +   F +  Y+   PE  T  G K+ ++ A  P    +   +Y           IK  +   R++  TG I    I   + +   S + +      V   DRGK  S I  T V +NI D NDN P F    +     +N   G K I V  +   D  L+S +EY   N+  + +F LD  +G ++ +   +      +FI       G    +S A + I + + N     F+       I E+  I +++  V+ ++     N +IK+ I S   + +F++N   GI+T    +DYE    + + I+A D    +    C      +V V+++D+NDN PVF +     ++ E+ P  + +I L A+DAD     ++ + + S + DL + ++P TGVI+T G LD+E  + + LTV      D        V I L   N+  P     L +   +   PK      +     D    G + Y I  +S+  +   +++ TG++  +  L       VSL        +I+        V++ VLD N           ++  E  P+       S FD   IP+  ++ YF+       S ++   + INP TG+
Sbjct: 2327 KERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAV----IRIIGGNSQFT-INPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSE-KFHIDPLRGAIMAAGPLNGASEV--TFSVHVKDGGSFPKTDSTTVTVRFVNKADF----PKVRAKE-QTFMFPENQPVSSLVTTITGSS----LRGEPMSYYIASGNLG-NTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASL-PFTINPSTGDIVISR--PLNREDTD-RYRIRVSAHDSGWTVSTDVTIFVTDIND-NAPRFSRTSYYLDCPEL-TEIGSKVTQVFATDPDEGSNGQVFYF----------IKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKP-SLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYC------SVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFV-IDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRK-KGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFI------GSGNENGAFSINPQTGQ 3461          

HSP 10 Score: 169.474 bits (428), Expect = 1.572e-40
Identity = 206/775 (26.58%), Postives = 349/775 (45.03%), Query Frame = 3
Query: 3162 LAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLV---------DVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-EIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAV-TNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNE---DEIQVLTYGAI--ILPKSSFYREKIATLKAQSNSKNLNSRFMYLL-KNSSYDKIIINRYTGDVFLTSTTPVEFNS-IDITFLI-SLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFA-NETFIFHAPENTTYGQKIYVGTVQAHDKDL---DSTLEYIWINEIPE---FSLDKTSGIVTTSGVPLDHEAVAYF 5381
            + V+ +D   +    V IFV D NDN+P FS  SY+      T+  + + +VFA DPD G NG V Y I+    + ++  I++ +G +F  +++         +V      F +T+ D G P L S   V + I  S  +   F K  +F  +++++K+  K+ ++  ID +       V Y IS     G F ++  TG I + + L  +      +T+ A D    KG+  L+    +++ + + N ++P F    ++  I  ES  +G+I+   +A D D  +NG ++Y +++   E I  F I++ +G L L + +DYEL  K    I+A D G+ A     SVTV + ++ND  P F  +     ++ +N   GTTV  + A D D  TN V+ Y       D  FVI+P +G+++    +  E   S+ L V A +   ++R    +V + +K  NE     +  L Y  I    PK +   E  A+ +        +    YL+  NS      IN+ TG ++++     E    + +  L  +  S+R   + +      VL+  DP    F  N Y  QI E    P        + +  + I     + + I  G        N    ++ +TG I+V    LDRE +    ++  V+ +D G   S      + + +ED NDN P+   +E  +    EN   G    V T+Q+ D DL        Y  ++  P    FSL  T+G+++T+   +D E +A F
Sbjct: 2843 IRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKS---QSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKD----KGNPPLSSQATVHITVTEENYHTPEFSQSHMSATI-PESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGI--FAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVL-ENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDL-FVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDR----DLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPP--IFTLNIYSVQISEG--VPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNE------NGAFSINPQTGQITV-TAELDRETLPIYNLS--VLAVDSGTP-SATGSASLLVTLEDINDNGPMLTVSEGEVM---ENKRPG--TLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSL-STAGVLSTT-REIDREQIADF 3580          

HSP 11 Score: 159.073 bits (401), Expect = 1.937e-37
Identity = 244/1023 (23.85%), Postives = 449/1023 (43.89%), Query Frame = 3
Query: 3213 IFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVE-QEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGA---FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKP--------KWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD----TNEVLYYLQSVHPPDH--PFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQV-LTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKII-INRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIE--DCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWI----NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD-GTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFI-IKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDD----LLMTVNPITGV--ISTAGILDYEKTERHALTVSCTDGLHRVTV-EVLINLINVNDETPLIHNPTTVYLPKINQNHN 6155
            I V D NDN+PIF    +   I  +  P   +  V AMD DSG NG ++Y I    +E  F  I+  +G + + + +D  +   ++  I + D G P  ++SVKV + I     +   F  Q F  ++ E+  +   + ++    + +    IS+ +   A   F+IN  TG I +   L+RE    + + + A D      S +   T++ + + D+NDN+P F   +       E T++G+ +    A D D+G NGQV Y + +        F+I+  +G ++  Q + Y+           + +FI+T+ D G P+L S  +VT+ I + ND  P+F K S+    V +NV +GT + RV A D       +EV Y++ +    +H   F ++  +G +SV++ ++ +++  F + V A D        Q +V + +  +N    +   ++ +  +P+S      + T+ A+     +N    Y + + + + I  IN  TG + L      E         +++ ++    + +     + +N+ D ++ +  F  +DYF  + E   + G  +  L A    +  + +  Y               + +  +D  TG I+    +LD E  +   +TV+   +   +     RC+   +NI+    N+  P F ++ + F   E    G    VG V A D+DL +  E  ++    +    F ++K +G +  SG+ LD E       K+   + G+        + ++      ++   FT + Y   I E  PI T +  V+  +S + P++    + I S      FS+NP  G IT   E+D E    Y L + A D    S       T + ++LV++ DINDN P+   +   V   E+    + ++ L ++D D         L PN       L++  P T    +STAG+L            S T  + R  + +  ++++  +   P + +  TV++  I+QN N
Sbjct: 2657 ITVLDVNDNAPIFKEDPFISEILENLSPRKIL-TVSAMDKDSGPNGQLDYEIVNGNMENSF-SINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRF-SQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHD------SGWTVSTDVTIFVTDINDNAPRFSRTSYY-LDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQS----EYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLK-SKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISN---DNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQ---KHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPS-GTTVIHLNATDADSGTNAVIAYTVQ---------SSDSDLFVIDPNTGVITTQG-FLDFETKQSYHLTVKAFNVPDEE-----RCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKG--TIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGI-LDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPS------ATGSASLLVTLEDINDNGPMLTVSEGEVM--ENKRPGTLVMTLQSTDPD---------LPPNQGPFTYYLLSTGPATSYFSLSTAGVL------------STTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDN 3610          

HSP 12 Score: 156.762 bits (395), Expect = 1.114e-36
Identity = 145/480 (30.21%), Postives = 218/480 (45.42%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQP---TSCHINQGDC--TLVVEAFDHGSPS-LSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            LF +N+  G I     +D  +  S  IEI      +  Q   ++ + V + D NDN P+F     E  + E+  + +      A+D D+   G    Y I  GN  D F     G+   GQL ++    LDRE +++Y L +   D+   PL   + V +I+ED NDN P+F+ + YT    E    G  V KV A D D G N EV Y F+    +++ +F +   SG I  T      S    +G    +  V A D G P  L     V V++  IN   PKF  ++  +T   +   + +V R     V   D D+    LI  SII GN+E  FA++ T G V ++ ++         +Y++ ++A+D+G     +T  + I I   N   P F      V V  N  I   +++  ATD D+G N  + YSIT  +    F+I  ++G I L K L F      KL I A+D G
Sbjct:  939 LFAINEKNGTISLLGPLDVHA-GSYQIEILASDMGVP-QLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANG-EIAYTIAEGNTGDAF-----GIFPDGQLYIK--SELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFE----MVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLR-----VSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEAT---PAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQG 1396          

HSP 13 Score: 152.91 bits (385), Expect = 1.570e-35
Identity = 181/698 (25.93%), Postives = 310/698 (44.41%), Query Frame = 3
Query: 3144 QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAM-DPDSGINGFVNYSIEKLPVELDFVEIDSQSGRL-FTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQ-----MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRL-EFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE----VSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKA-QSNSKNLNSRFMYLLKNSSYDKII-INRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTT----PGLKLFRLQALYPGNPISD--LEYYIFDI-----YCGISERIKLPNTMIRLDKETGWISVGNIYL-----DREIIEGSQI-TVEVVVIDRGKNGSRIRCTKVFLN 5138
            ++SF V + ++      ++  V I + D NDN+P F    YF  + ++ K  T + +V A+ D D G+N  V Y I      L   ++D+ +G +   + L+  + Q F   +TA+D G P L+S   V++ +         F +      I E   I   +  +    +      ++ Y IS   ++G F+IN  TGI+ L   LD E    H +TI A D      + Y +VT   VN+IDVNDNSP+F +D     +L E+   GT +    A D D G N  + Y + ++  +   +F ID  +G +     +D+E K  ++  + AF++      S  +V + +   N+  PRF   S+L  F + +    GT VG V+A D D  T+  ++YL   +     F IN  +G + VS  + +E    VS  ++     + R    D+ +V V +   N+  I  L   ++ + +       +  + A  S+S    SRF Y + + + +    IN  TG + +T+    E   I   + +S+ ++ S T     S  L++ + D        N     + E +      PG  +  LQ+  P  P +     YY+        Y  +S    L +T   +D+E     + + YL     D  + + S   TV + VID+  N S+ R  ++F+N
Sbjct: 2948 RHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISN-DNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVT---VNVIDVNDNSPVFLSDDYFPTVL-ENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSD---LFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRF--VSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPI---YNLSVLAVDSGTPSATGSASLLVTLED-----INDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVL-STTREIDRE----QIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVN 3622          

HSP 14 Score: 152.525 bits (384), Expect = 2.159e-35
Identity = 157/541 (29.02%), Postives = 243/541 (44.92%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLI---KFGFSYEFFH------KEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPP---LKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY-IEIGKVTRKPLAIVH--CQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRN-ASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDL 1721
            KF    Y+F + E+    ++V  +L      G + E  +      ++G+F LN +TGV   + ++D E     ++ +    +   GQF  TI +   I+D NDNPPIF  N     ++EN+ + + + +   TD+D D       Y I SG+   +F +   GV       L+V++ LDRE++  Y L + V D  Q P        +V II+ D NDN P F   K T  + E+      V K  A+D DSG N  +EY        L N+FSI    G +RLT          + TL V A D G PSLS+   V V V+ IN   P F         +A Y +EI + T     I+     D D+     +   I+ GN    F ++   G + +    K +      +Y +TV+A D G+  +  T  + I +   N + PVF     SV V  N  ++   I    A D D G N K+ Y +  G+  + F +   SG + + + L     ++  L I A D+G  +L  TG +++
Sbjct: 1840 KFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTV--RAEDGGGQFT-TIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDAD-DGINSQLTYSIASGDSLGQFTVDKNGV-------LKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNP---LGNKFSIGTIDGEVRLTGELDRE-EVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFA--------QALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITV---AKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSA-SGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINV 2352          

HSP 15 Score: 149.058 bits (375), Expect = 2.347e-34
Identity = 132/483 (27.33%), Postives = 230/483 (47.62%), Query Frame = 3
Query:  261 GLFNLNKLTGVILTSNIIDRESLA--SDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTD-----EFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            G F ++K  GV+     +DRES +  + ++++    +    +F  T  + + ++D NDNPP F   KL   I EN  + T +    ATD D+      E+ + N      GN   +F++  +  +      +R+   LDRE    Y LT+   DKGQP L    EV ++V D NDN+P+F+ + Y V +NE+ L G ++++V+A+D D G N +V Y      +    EF ID  +G+I + +P           L V+A D GS   +    V++ ++ IN F P F ++ Y  +  +     +G + R  L +V  +DDD+     ++  + GGN++N F L  + G + +    +++     + + + + A D+G+P+   T  + + ++  N   P F ++    T+  +A   + +    A+D DA  N  I   I  G+   +F I   +G I     L     D   L ++  DAG
Sbjct: 1990 GQFTVDK-NGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPL----GN---KFSIGTIDGE------VRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNT--NQEFRIDSVTGAITVAKPLDRE-KTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPE----NLGTLPRTILQVV-ARDDDRGSNSKLSYVLFGGNEDNAFTLSAS-GELGV---TQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVI--RIIGGN--SQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAG 2441          

HSP 16 Score: 148.673 bits (374), Expect = 3.067e-34
Identity = 154/632 (24.37%), Postives = 307/632 (48.58%), Query Frame = 3
Query: 7773 IYNGTIYQTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSI-SVYDNVCKCTNHGYFTGSVEENSDSEI-SVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAV-ALNWISDNETVDV-----IITASDRGQPPLFHSITVHFLFITA-ECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYG---EITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWF-SLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            I +G +  TF  I++ +GQ+S+++PL  + +  Y + I A           Y+  D+++  V DN        + +  +E  S  +I +VS        N ++ + +     ++    N  T EIR+  +P+DRE  ++  +++  +D GS     S   +I ++D NDN+P F+   F   V EN+ +G  +  +   D D  +  + ++S+  + +  F+INP  G + +++ ++RE   +Y ++V+  D    +   + I VTD NDN P+ S+     ++ ++  E       V  + ATD D  + +N Q+ Y + S+++       F +N  +G +  K +     ++    V++     I+T+SDRG+P L    TV    + + +   + LKS +  P  V    + G+++  +    D  +G   E+ +FI + N    F + +  G IS + ++ S +   +F ++  +  G   LSS      + T+ + +++ N ++P+   S  + +I E   +GS +  V   D DA + G++K +I +  ++      F  N ++  L +   LDYE+  ++ +T+ A D G+  ++    V + V+D +DNSP F+S ++  ++ E
Sbjct: 2603 IASGNLGNTF-QIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGF-PPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSV-RPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIM-DASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSR----TSYYLDCPELTEIGSKVTQVFATDPD--EGSNGQVFYFIKSQSE------YFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTP--VTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSS------QATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGI----FAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLE 3205          

HSP 17 Score: 147.902 bits (372), Expect = 5.112e-34
Identity = 146/507 (28.80%), Postives = 238/507 (46.94%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKV--RIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYR-----GQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSI---------RLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            E  F++N  TG I +   +DRE ++  ++ I   K + +G   ++ S+KV   I+DENDN P F        + EN  L    ++T  T SD D  G+         N   R+++    + +      G +++   RPL+RE  ++Y++ +S  D G        +V I V D NDN+P FS + Y +   E    G +V +V+A+D D G N +V Y F K++S     F I+  +G I          +T  ++ +IN+   + +V + D G PSL +   VT++++  N   P+F +  Y     K       KV  K + +    D D      +   I   N    F L+   G + +   +  I ++N Q++ ITV A D GNP   +   + I + + N + P F   + S T+  + SI S +    A D DA +NG I YSI+ G+    FAI   +G++TL K L +    K ++ I A D G   +  TGY  + +
Sbjct: 2713 ENSFSINHATGEIRSVRPLDREKVSHYVLTI---KSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPL--GYTVTRVTTSDED-IGI---------NAISRYSIMDASLPFTINPSTGDIVIS--RPLNREDTDRYRIRVSAHDSG---WTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFY-FIKSQS---EYFRINATTGEIFNKQILKYQNVTGFSNVNINR--HSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNV-----KVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSL--ISDLN-QNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGW--VARTGYCSVTV 3182          

HSP 18 Score: 137.502 bits (345), Expect = 7.078e-31
Identity = 126/463 (27.21%), Postives = 215/463 (46.44%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVD-VVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQT---FFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAI------AFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNED 4493
            Y   +LA +    + S+ V + ++V D NDNSP+F   SY  +++     N+   KV A D DSG NG + Y+I +      F       G+L+    +D  ++  ++  + A D  +  L+++V V V +     ++  F+      +F+          K+  ++ D       R S    +  F ++  +G I   ++ DRE++      A    T++ATD    +  +  A  ++Y+   D+NDN+P F  D      +SES    T +   +A+D+D+G NG + Y +     E    F ID+ SG + L   +DYE  P ++ +I A D G   L+S  ++ + I + ND  P F K S L   V +N+ IG  V  V A D D+  N  LYY  +       F I+P +G + ++  +  E    + L + A D  R  R    SV +H++  N++
Sbjct:  962 YQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIF--PDGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMK--DINDNAPKFLKD-FYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEE--RQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPK-STLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDN 1416          

HSP 19 Score: 134.42 bits (337), Expect = 5.458e-30
Identity = 148/533 (27.77%), Postives = 248/533 (46.53%), Query Frame = 3
Query: 2889 VSNTEIIIEFHPIFDS-PIFFEP-FYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSI-IEESLYGKWSIFXXXXXXXXXXXXXXXRKQ---YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKI-------NPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAER 4436
            VS  ++++    + D  P+F +P  Y   V EN+ + T L  +        DN  +   ++E+   + S   D     LS +   +R++   YS  VLA +     +S+   + + + D NDNSP+F    YF  I  +    + I  V A DPD G NG V YSI     +    ++++QSG + T   +D  E+  +   I A D G   L S  +  V I       NP P   Q       F+N++    +   +    +D    ++Y I+   QKG F+INQ TG +   N +DRE  +F+ L +VA+      G      T + + + D+NDNSP F   A+ +  + E+ + G  +    A D D+G+NG V Y L        ++F I+  +G + L  P+D      +   I A D+G P L S++ +TV + ++ND  P F++ S  E  + ++  + +   +V A D D+    E+ Y +   +  D  F I P  G L + + + +E+    V+M V ++R
Sbjct:  563 VSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISA--GDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGG--NLQSPNQAIVTITVLDTQDNP-PVFSQVAYSFVVFENVALGYHVG-SVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVAS------GGTVTGDTMVNITVKDLNDNSPHFLQ-AIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLK---QNPKNLFAINEKNGTISLLGPLDVHAG-SYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLS-YEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDA-FGIFP-DGQLYIKSELDRELQDRYVLMVVASDR 1075          

HSP 20 Score: 134.035 bits (336), Expect = 6.957e-30
Identity = 151/536 (28.17%), Postives = 249/536 (46.46%), Query Frame = 3
Query: 8061 NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVI--DLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG----MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAE--CELRILKSTFQYP----IAVLYTSQEGSRVANIAVNHDNLYGE-ITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGS--NLLQVDVIDPDAGLAGIVKLTIITST-DDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            NSK+S+ L    ++D  +  + + E+      +DRE      + +I A  SG    +  G I VI  D+NDN P F    +   + E+A  G+ ++ +   DAD+    +   + G  N+ F+INP  G +  +  +DRE K  Y + V  SD  +   +     +L+TVTD NDN P+      +  +V +         FV  +T TDAD     NS++ YSLS  N        F ++   G++ + A  LN  S+   V   +   D G  P   S TV   F+      ++R  + TF +P    ++ L T+  GS          +L GE ++++I SGN  + F I    GQ+S S+ ++   + ++   I    G          S  E + + + D N  +P   I +    ISE+++  S   +L V  +D D+G  G +   I+    ++ FS+     N  + +++ V PLD E    Y LT+ + D G P +S +  V+I +LDE+DN+P F S+ F A + E
Sbjct: 2292 NSKLSYVLF-GGNEDNAFTLSASGELGVTQS-LDRETKERF-VLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGG--NSQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQ----HHPYVTHIPSPTLPGSFVFAVTVTDADIGP--NSELHYSLSGRNSE-----KFHIDPLRGAI-MAAGPLNGASE---VTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGS----------SLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDG-----GFPPFSSYEKLDITVLDVNDNAP---IFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSI-----NHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRF-SQIFSAHVPE 2783          

HSP 21 Score: 130.954 bits (328), Expect = 6.558e-29
Identity = 157/551 (28.49%), Postives = 240/551 (43.56%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVL-----IKFGFSY--EFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSI-IGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSK---QTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL-QSDQLHARIKST 1766
            F    Y+F V EN  +   VG V      +    SY      ++G+F +N++TG + T+N+IDRE  +   +++     T+ G  +  I++K    D NDN P F        ++EN      I    A D D    G+   Y ++  N  + FA++    +  G + L  + PLD      Y++ I   D G P L   + + + V D NDNSPVF    Y V L+ES        KV ASD DSG N E+ Y   +  +   + F I    G + +       + Q    L+V A D     LSA   VTV +  +N   P F      ST+   Y E  +     +  V   D D  P   +  S  +   D  + A+     N H   +   +       ++ TV A D G P     Q TV + ++    N   P F   +   T+  +A+  + +    A+D+D G NG I YSI KG+   +FAI+  SG +TL+  L +       L I A D+G   L +T  L+++IL ++D   +  KST
Sbjct:  793 FSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVK----DLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVL-YSLKQ-NPKNLFAIN----EKNGTISL--LGPLDVHAG-SYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNT--GDAFGI-FPDGQLYIKSELDREL-QDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFN-----STNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMK--DINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKST 1319          

HSP 22 Score: 125.946 bits (315), Expect = 1.963e-27
Identity = 141/544 (25.92%), Postives = 243/544 (44.67%), Query Frame = 3
Query: 8058 GNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSG----GIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVL--EIGMLITVTDSNDNRPQISKEIINKTF-VINTSEFAHGNIFVVNITATDADDSQSN-NSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETV---DVIITASDR-GQPP-----LFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDN--LYGEITFFIISGNGSSYFSIGSKNGQISTSRNVN-SAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISET-TVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            G  ++  TL+P     +L+  ++          +DREV    ++ V + D       G ++     + V D+NDN P+F  +++   V E+A++GS ++ +   DAD      +++ LQ +E   F ++P+ G + + + +D E + +Y + V   D G+  L      LI + D NDN P +       T    +  E A     V  +T TDAD   +N N  ++    +E +   V+S  + N    SL   A AL    D E +   ++ ++ SD  G PP        S+    +F+    +   + S   Y + +   +  GS V+ I+    +  L   + + I+SGNG  +F I   +G ++T  +      L     L + A    +   VS+      + + + D N   P     E   VS+ E    G+ LL +   D D G  G V+ ++  +  DR S    P +G   +L  ++ LD E Q  YSL +LA DLG P +S  + + + +LD +DNSP F    + A ++E
Sbjct:  183 GRFRLDITLNPSGEGAFLHLVSKGG--------LDREVTPQYQLLVEVEDKGEPKRRGYLQVN---VTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQ-DEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNL---SLIKVASAL----DRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQ----LVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSG---RLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKE 700          

HSP 23 Score: 121.324 bits (303), Expect = 5.312e-26
Identity = 154/549 (28.05%), Postives = 237/549 (43.17%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLI---KFG------FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLA---SDLIEIFLYKKTLEG---QFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDE-NIFALERTHGNVHILRQI-KAIHNINLQSYTITVRAIDNGNP---SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQS 1736
            F S+ Y F   E Q   + VG+V      FG      +S+E    +  F L+ ++G I  ++  DRESL       +  F    T +G      +  ++ V + D NDN P F  +  +  I E+ A LT +   +A+D D    G+ + Y I  GNE+ +FA+        GQ+ L  +  LD E    Y L I   D G  PL     + I + D NDN+P F  S   V + E+   G  V  V A+D+DSG N ++ Y    T +     FSI   +GSI L +       Q    L + A D G P  S+   V +HV   N   P F    +  +     I IG      +  V   D D D    ++ +II      N F ++   G ++   +I +   N+    + +TV+A D   P    +    ++ I +   N   P+F ++  ++    +A I S +    A D D G NG+I Y I  GD  D F +++ SG + +   L   +L    L + A D G    ++T  L + ILQ 
Sbjct: 1100 FNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD--FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIH-YSIIKGNEERQFAIDST----SGQVTL--IGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNN--HGTFSISPNTGSIFLAKKLDFE-TQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKS-IVENIPIGTS----VISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANL----FELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQ-NALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGD-TDTFIVDRYSGDLRVASALVPSQL-IYNLIVSATDLGPERRKSTTELTI-ILQG 1623          

HSP 24 Score: 119.398 bits (298), Expect = 2.044e-25
Identity = 112/451 (24.83%), Postives = 214/451 (47.45%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVA--NIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            I + D+NDN P+F  +     V EN   GS I+ +  +DAD     L  +++    +++F I+P++G +   + +DRE +SKY + V   DG+   ++ + ITV+D ND+ P+ S+ +    +  +  E       V  I AT  DD    N +I Y ++ +++      +F LN  +G   +  + L++      +  +      GQ   F +I V+F  +       I  S   Y  +++     GS V   N+    D +  ++T+ I SG+    F++  KNG +   + ++      +++L+VQ      + +  F S  + +++++ D N   P   +S     I E   + + + +    DPD+G    ++ T++    ++FS+          ++++   LD E    Y+LT++A D G P  S ++ V++ VLD +DN+P F
Sbjct: 1728 ITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPV----YSFDIPEDTIPGSLVAAILAT--DDDSGVNGEITYIVNEDDE----DGIFFLNPITGVFNLTRL-LDYEVQQYYILTVRAEDGGGQ---FTTIRVYFNILDVNDNPPIF-SLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTV-DKNGVLKVLKALDRESQ-SFYNLVVQVHDLPQIPASRFTSTAQ-VSIILLDVNDNPPTF-LSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTI-----DGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIF 2154          

HSP 25 Score: 118.242 bits (295), Expect = 4.343e-25
Identity = 135/513 (26.32%), Postives = 212/513 (41.33%), Query Frame = 3
Query:  234 FSYEFF--HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRI---NYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHAR 1754
             SY  F  +++  F L+  +G +  +  +DRE+     + +     +       T +I V + D NDN P F        I E+    TD+ L  A+D+D  +  V    +I  GN   +F ++       GQ++   +  LDRETK+ Y L +   D G P PL     V + V D NDN P F    Y   +    LPG  V  V  +DAD G N E+ Y      S    +F ID   G+I    P +      + T  V   D GS   +    VTV  +   + FPK R     ++   ++     +  +T   L             + ++  I  GN  N F +++  G V I + +       +Q Y + + A D G P   +   + I +   N   P+F+       +  N S    I    A D D+G NG++ Y I  G+  + F+I   +G I  ++PL   K+    L I + D G  S  T+  + +NIL  +    R
Sbjct: 2295 LSYVLFGGNEDNAFTLSA-SGELGVTQSLDRET-KERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAV---IRIIGGNS--QFTIN----PSTGQIITSAL--LDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNS---EKFHIDPLRGAIMAAGPLN---GASEVTFSVHVKDGGSFPKTDSTTVTVRFVN-KADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLR-----------GEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDF---EKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRK-ILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPR 2772          

HSP 26 Score: 117.472 bits (293), Expect = 7.609e-25
Identity = 139/538 (25.84%), Postives = 229/538 (42.57%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFGFS-------YEFFHKEGL--FNLNKLTGVILT--SNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIF-YPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDR-FALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCT---LVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFR---INYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETT 1706
            F    Y   +SE  P  + V  +    G S       Y      GL  F++++ +G++ T  S  +DRE LAS ++     +       +    + V ++D ND  P+F  P   +  ++EN    T++ +  ATD D  + G    + ++    D R F L  V  +      L  +  LDRE +  Y L +   D G PP   +  + + + D NDNSPVF P +Y   + E+   G  +  V A+D D G N  V+Y          + F ++ +SG I     T   +++ + T   L + A D G+        VT+ V+      P F     ++V   + A    +G V+   +          D    I+  I  G+ + +FA+ +  G    L     I       Y + V A   G  +  T V++ ++    N   P F    +SV V  N      I    A D D G+NG ++YS+ K + ++ FAI + +G I+LL PL  V     ++EI+A D G+  L ++
Sbjct:  475 FSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRE-LASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVR-FSLQEAETDRRSFRLDPVSGR------LSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGD---RSRFQVNAQSGVIS----TRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTM----------DLNSNISYLITTGDQKGMFAINQVTGQ---LTTANVIDREEQSFYQLKVVA-SGGTVTGDTMVNITVK--DLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSL-KQNPKNLFAINEKNGTISLLGPL-DVHAGSYQIEILASDMGVPQLSSS 979          

HSP 27 Score: 117.087 bits (292), Expect = 9.700e-25
Identity = 126/473 (26.64%), Postives = 217/473 (45.88%), Query Frame = 3
Query: 3141 KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLN--SSVKVYVKINPSPKSKQFFDKQTFFQNISEDMK---ITEKIFKLEID--HQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALN--NFILSESTKVGTILGFYTANDIDDGLNGQVRYR-LTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD----TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLT 4511
            +++  T+ A++     ++    V + V D NDNSP+F +  YF ++  +    TT+  + A D DSG N  + Y+++    + D   ID  +G + T   +D  E +  + +T +   +P     S   V +++  + +    F  + ++  ISE      I  ++F  + D      V Y I   ++K  F IN+ TG I++   LDRE      L ++A +  S +G++   VT + V ++D ND  PIF    LN  +  +SE   +GT + F +A D  D +    R+     +G E+   F I+  +G + +   +D E  P +N  + A D G P+   + S+ VT+ +IND  P        E  V +N   GT V  + + DPD         YYL S  P    F ++  +G+LS +  I +E    F L V+  D+         +V + +   N++  Q  T
Sbjct: 3158 QKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQS--SDSDLFVIDPNTGVITTQGFLD-FETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVT-VNVTVLDAND-PPIF---TLNIYSVQISEGVPIGTHVTFVSAFD-SDSIPSWSRFSYFIGSGNEN-GAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVS---EGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLS-TAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRT 3616          

HSP 28 Score: 112.849 bits (281), Expect = 2.094e-23
Identity = 126/485 (25.98%), Postives = 218/485 (44.95%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLAS-DLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGN-PSKQ--TTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETT 1706
            LF + + TG+I T+ I+DRE  A   L++++  +K+      +   +++ + D NDNPP+F  + L+  + ENI   + I    A D+D     +   Y I SG  DD F +        G L+    R LDRE + KY L +  +D  Q      + + I V D ND++P FS   Y+  + E  +PG  V  + A+D DSGVN E+ Y   +     +  F ++  +G   LT+     + Q    L V A D G    +   Y   +++ +N   P F +N   ST     + +G      + + +  D D      +  SI  G+    F +++      +L+ +KA+   +   Y + V+  D    P+ +  +T  + I +   N   P F +  +   +  N  I++ +    ATD D+G N  I Y++      ++F+I    G + L   L   ++    L ++A D G  SL ++
Sbjct: 1680 LFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALV-TYTIISG-ADDSFRID----PESGDLI--ATRRLDRERRSKYSLLVRADDGLQ---SSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDE--DGIFFLNPITGVFNLTRLLDYEVQQY-YILTVRAEDGGGQFTTIRVY--FNILDVNDNPPIFSLNSY-STSLMENLPVGST----VLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKN----GVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSP-KLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLN-PLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSS 2137          

HSP 29 Score: 112.464 bits (280), Expect = 2.258e-23
Identity = 167/632 (26.42%), Postives = 279/632 (44.15%), Query Frame = 3
Query: 7794 QTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEE-NSDSEISVSNNILSCNG-------NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLEIGMLITV--TDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLT----IKAVALNWISDNETVDVIITASDRGQP-PLFHSITVH-FLFITAECELRILKSTFQYPIAVLYTS-QEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTII-TSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +  F+IN+ +GQ++    +  +  S Y L++ AS   V        DT V+I+V D      N  +F  ++E  N        ++I            N  V ++L  K +   L+   E N   +   P+D     + +I ++ +D G   +  S    + V D+NDNSP+F    +   +SE+  + S    +   D DS     + +++ +G   +AF I P +G +++   +DREL+ +Y + V  SD  +  L   + +TV   D NDNRP  +    N TF     + A    FV  ++A D D     N ++RYS         V+  F L+  SG +T        +L            + A+D+G P PL    TVH ++    +   + LK  +Q  I+    +  +  RV+   V+  N  G I + II GN    F+I S +GQ++    ++       +SL++QA  +  +   S C    T+ + I D N  +P    S   V + E +++G  +  V   D D+G    +  +I  T+    FS+ P     N+  + +   LD+E Q  Y L + A D G P +S T  V+I V D +DN P F   +   S+ E
Sbjct:  836 KGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTG------DTMVNITVKD---LNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSL--KQNPKNLFAINEKNGTISLLGPLDVHA-GSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFP-DGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNS--TNYTFYFEEEQRAGS--FVGKVSAVDKDFGP--NGEVRYSFEM------VQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGN-NGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEAT-PAYSLVIQAVDSGTIPLNSTC----TLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISP-----NTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVE 1431          

HSP 30 Score: 110.923 bits (276), Expect = 7.793e-23
Identity = 124/483 (25.67%), Postives = 212/483 (43.89%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN--NYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVY-ASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCY-----VTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIG--GNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            F ++  +G ++ +  +DRE  +    +  L  +  +G     + I + + D ND+ P F        I E+    + ++   ATD D+   GV+    Y +   +ED  F L+ +        +  + R LD E ++ Y LT+  ED G       + V   + D NDN P+FS + Y+  L E NLP    V V+  +DAD G+N ++ Y      S+   +F++D K+G +++ +      +Q    LVV+   H  P + A  +     V++ ++ +N   P F       + K  YI         +      D D  P   I  +++   GN    F++    G V +  ++       + +YT+TV A D G PS  ++ ++++ +   N   P+F      V +  N    + I   FA D D G NG++ Y I  G+    F I+  +G IT+ KPL   K     L + A D G
Sbjct: 1787 FRIDPESGDLIATRRLDRERRS----KYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDS---GVNGEITYIVNEDDEDGIFFLNPI------TGVFNLTRLLDYEVQQYYILTVRAEDGGG--QFTTIRVYFNILDVNDNPPIFSLNSYSTSLME-NLPVGSTVLVFNVTDADDGINSQLTYSIASGDSL--GQFTVD-KNGVLKVLKALDRE-SQSFYNLVVQV--HDLPQIPASRFTSTAQVSIILLDVNDNPPTFL------SPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNK---FSIGTIDGEVRLTGELD---REEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRG 2235          

HSP 31 Score: 110.923 bits (276), Expect = 8.058e-23
Identity = 118/451 (26.16%), Postives = 204/451 (45.23%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKINP-SPKSKQFFDKQTFFQNISEDMKI-TEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLN-GQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSV-----------SNPILQEVSFDLVVMAVDA 4430
            ++ Y  TV A N  D+E+ +   V I ++  N+  P F ++ Y+F I+      T +G+VFA D D G +G V+Y I     +  F +I+ ++G+++ + ++D  ++E +   + A++ G  R     +V V +          F    +   ISE + I T   F    D   +      +Y I    + GAFSIN  TG I +   LDRE +  + L+++A D+ +   +      +L V + D+NDN P+     ++   + E+ + GT++    + D D   N G   Y L +TG  + S F + T +G L   + +D E    +   +   D G P + S  +V +T+ + ND  P  ++   +      N+  G  +G V  QDPD       L S H        +  SG+ S+           S P   + +FDL V++ D 
Sbjct: 3261 KQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGF-QINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSAT---GSASLLVTLEDINDNGPML---TVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTG-PATSYFSLST-AGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQND-NPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDV------LDSFH-------CSLTSGVTSLFSIPGGTCDLNSQPRSTDGTFDLTVLSNDG 3688          

HSP 32 Score: 103.99 bits (258), Expect = 8.322e-21
Identity = 103/353 (29.18%), Postives = 155/353 (43.91%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIK---FGFSYEFFH-------KEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYK-KTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQ------------EVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFR-----INYVG 1121
            +F+S  Y F +SE  P  TIVG+V       G   E  +       K+G F +NK TG I  S I+DRE      +++      ++ G  ++ +++ V ++D ND PPIF  N    +I E + + T ++  +A DSD+       +Y I SGNE+  F+++       GQ+   V   LDRET   Y L++   D G P   G   + + +ED NDN P+ + S+  V   E+  PG  V+ + ++D D   NQ               Y    T  VL     IDR+                 D  L V   D G P +S+   V + VI  N    + R     +NY G
Sbjct: 3297 RFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKG-FQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSIN----PQTGQIT--VTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVM--ENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDRE--------------QIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYG 3625          

HSP 33 Score: 101.679 bits (252), Expect = 4.402e-20
Identity = 127/502 (25.30%), Postives = 224/502 (44.62%), Query Frame = 3
Query: 8157 VDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE------IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI--AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQAC--GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISE-LIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDR-FSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +D EV     ++V   DG GG   +      ++D+NDN PIF+LN +   + EN  +GS ++   V DAD  +   L +S+  G+    F+++ +NG + + + +DRE +S Y + V V D   +          + I + D NDN P      +  T++   +     +  V    ATD D     NS I Y+L +     P+ + F +    G + +          N T+ V+  A+D+GQP L  S  V  + +       I      Y + +   +  G+ +  +  A   +   G++ + I++GN +  F I S  G I+ ++ ++       + L VQA   G+   +  S      T+++V+ D N + P   +S  +V++ E L  +   +LQV   D D G    +   +    +D  F+L        S +L V   LD E + ++ L + A D G P  + T  + + V D +DN P F S+ +  ++ E
Sbjct: 1904 LDYEVQQYYILTVRAEDG-GGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVD-KNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKL--TYIPENTPI---DTVVFKAQATDPDSGP--NSYIEYTLLN-----PLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVV--ATDKGQPSLSSSTEVVVMVLDINDNNPIFAQAL-YKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKT-PTYHLTVQATDRGSTPRTDTS------TVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTL------SASGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPE 2375          

HSP 34 Score: 100.138 bits (248), Expect = 1.253e-19
Identity = 137/558 (24.55%), Postives = 228/558 (40.86%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLI----KFGFS--YEFF----HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETIS----IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFAL-SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAI--VHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHI-----------------LRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLN-GKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYL 1715
            +FL S+Y   V++N  + T + +V       FG +   E+F    +  G F L+  TG I  ++     SL SDL + F    T + +    +S    + + + +EN + P F  + +   I E+ ++ + +   +A D D    G+   Y I SGNE+  FA+ S  G+       L + + LD E  +K+++TIS  D G     G   V + V D NDNSPVF    Y   + E+   G  V+ + A+DADSG N  + Y  + + S L   F ID  +G I  TQ       +    L V+AF+       ++  V + +   N + P+F         K  Y EI +   K   +  V   D D      +   I G + +  F + +  G +++                  +   +I   ++   T+ V  +D  +P                   P+F     SV +     I + +    A D D+  +  +  Y I  G+    F+I   +G IT+   L    L    L ++A D+G  S   +  L
Sbjct: 2982 QFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVAS-----SLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIK-YSISSGNEEGIFAINSSTGI-------LTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDL---FVIDPNTGVI-TTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRF-------VSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDP-------------------PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASL 3496          

HSP 35 Score: 99.7525 bits (247), Expect = 1.680e-19
Identity = 147/656 (22.41%), Postives = 276/656 (42.07%), Query Frame = 3
Query: 5034 LDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN--------FTHDRYHFHIHETAPIHTVIGQVTLKNS-TTNPNFIIKFDIVSEWGKHLFSVN----PDHGIITTQGEIDYEQDNHYILLITATD--VSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVIST--AGILDYEKTERHALTVSCTD-GLH-RVT-VEVLINLINVNDETPLIHNP----TTVYLPKINQNHNIMIKCSDQD--NLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGL-----LYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSK-----NYTAFIKLERFEKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGEFKPIEGF-APRKHEYRFTIAGIKRDSLNQENQINIETILTYKEIELCYPSFLGTPYSFQIDHRVTAPKYLGSVSVGYCS-NQKILYYLSSG--HSFFYVNGTSGDI 6875
            LDRE+    Q+ VEV   D+G+   R    +V + ++D NDN PVF +  +    PE+   G  +        D+  ++ + Y   +E   F +D  +G++T    PLD EA   +   +Q  D    S       +    D   N        F     +  + E A + TV+  +T+ ++ +   N  I   I+    +  F V     P+  +I     +D E+   Y L ++ +D   +     +    +V + V+  + DIND+ PVF      V++ E+ P  S +  + A+D D      L + I+S N      ++  +G+++T  +G LD E   +  L +S  D G+H +V+  ++++ L++VNDE P+   P     +V          +M++ +D D  + G + + +  +  D ++  +D ++G++S    L      + + + ++        +++  +++ +LD N +S       Y A IK      S +   S  D  +  N            Y++S  D + + +N  +G            K  Y+  I      +L   NQ  +   +T  + +   P F    YSF +   V    ++GSVS      N  I Y +++G     F +N  +G +
Sbjct:  208 LDREVTPQYQLLVEVE--DKGEPKRR-GYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLITVR-EPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIF-VNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNG--------TVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIV--TITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTGQL 848          

HSP 36 Score: 98.2117 bits (243), Expect = 4.743e-19
Identity = 128/540 (23.70%), Postives = 235/540 (43.52%), Query Frame = 3
Query: 8025 ISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI--IKVIDLNDNSPIFTLNYFMGFVSENALIGSWI--IDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDN--LYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTN-GNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRK-SQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +S ++  L  NG  K S +      +     NA++  I T    +DRE     ++ ++  DG G +      I  I V+D  DN P+F+   +   V EN  +G  +  +    +D +S +  L  +  G++   F+IN   G +  A  +DRE +S Y++KV  S G    +  + ITV D NDN P    + I    V+   +  H +IF     A   D  +  N  + YSL         K+LF +NE +G++++    L+  + +  ++++  ASD G P L  S+ +  +++    +   +     Y + +  +    SR   +  +  +    GEI + I  GN    F I   +GQ+     ++  +  ++  ++V +       +V   S    +T+++ D N   P    +  T    E  + GS + +V  +D D G  G V+ +      D F L        N++Q    + +       +S T++A D G P+     + V + + D +DN+P F+   + A++ E
Sbjct:  711 VSATDPDLGTNGTVKYSIS---AGDRSRFQVNAQSGVIST-RMALDREEKTAYQLQIVATDG-GNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITT--GDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHF-LQAIESVNVVENWQAGH-SIF----QAKAVDPDEGVNGMVLYSLKQN-----PKNLFAINEKNGTISLLG-PLDVHAGSYQIEIL--ASDMGVPQLSSSV-ILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGI-FPDGQLYIKSELDRELQDRYVLMVVASD-----RAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD-FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISE 1221          

HSP 37 Score: 94.3597 bits (233), Expect = 7.324e-18
Identity = 123/502 (24.50%), Postives = 221/502 (44.02%), Query Frame = 3
Query: 8136 IRTAHKPVDREVYNNLEISVIIADGSGGIIES--CPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP-LKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVA---VSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDAD---DSQ------SNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWIS----DNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNL--YGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDN 9575
            I T  K +D E+    E+++   DG G +  +  C   + VID+NDNSP+F  + +   V ENA  G+ +I +   DADS     + +++Q  +++ F I+P  G +     +D E K  Y + V    V D        + I +  +N+  P+     ++K +    SE A     V  + A+D D   D +       N+ +  + ++ +  +I V  + L  E    +++K +A N+ S    D + V V +T  D   PP+F ++ ++ + I+    +                   G+ V  + A + D++  +   ++FI SGN +  FSI  + GQI+ +  ++   L   ++L V A  +   S+    S    + + + D N   P + +SE  V   E  + G+ ++ +   DPD           + ST    S     T G    L     +D E    + L+++  D G P+ S T  V I V+D++DN
Sbjct: 3145 ILTLAKALDYELCQKHEMTISAIDG-GWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPR----FVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGI-LDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIF-TLNIYSVQISEGVPI-------------------GTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETL-PIYNLSVLAVDSGTPSATGSAS----LLVTLEDINDNGPMLTVSEGEV--MENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAG---VLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDN 3610          

HSP 38 Score: 90.1225 bits (222), Expect = 1.371e-16
Identity = 124/546 (22.71%), Postives = 230/546 (42.12%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQV-----------LIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETI---SIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQ-FKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPR-DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGK--IIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL 1730
            +F  S  +  + E+  I +IV  V           LIK+  S    ++EG+F +N  TG++  +  +D E      + I      ++G ++      S+ V +ID NDN P+F  +     ++EN    T +    ATD+D+    V   Y ++S + D        GV       +     LD ETK+ Y LT+   +           V I ++  N+  P F    Y   ++E+   G  V +V+ASD D G + EV Y  F  +R   +  F I++K+G I ++        +   +L V A + GS   +    VTV+V  +++  P      + S   +  + IG      +  V   D D  P     +  I  GN+   F++    G + +  ++       L  Y ++V A+D+G PS   +  +L+ +   N   P+         V  N    + +    +TD D   N      Y ++ G     F++   +G+++  + +   ++    L ++ +D+G+  + +TG + + ++
Sbjct: 3088 EFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSG--NEEGIFAINSSTGILTLAKALDYELCQKHEMTI----SAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIA-YTVQSSDSDLFVIDPNTGV-------ITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSR---KKGFQINKKTGQIYVSGILDREKEE-RVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTH----VTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELD---RETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPML--TVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLST-AGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVI 3605          

HSP 39 Score: 88.5817 bits (218), Expect = 4.538e-16
Identity = 129/540 (23.89%), Postives = 235/540 (43.52%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQ-GEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG---MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHF-LFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLY--GEITFFIISGNGSSYFSIGSKNGQISTS--------RNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF-ISRNFVASLRELDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILDV 9812
            I V + N ++P F+ ++    + E+  IGS +  +   D D+ +  L K+S+  G E   F+IN   G + LA+ +D EL  K+EM ++  DG  V   G   + + V D NDN P      ++  +     E A     V+++ ATDAD     N+ I Y++ S +       LF+++ ++G +T +   L++ +  ++  + + A +          TV+  L  T E   R +   + + I+    + +G+ V  +  +  +L   GE+ + I   +    F I  K GQI  S          V+  +L + F  I  A   ++  +V+     +     +   N+YS         V ISE + +G+++  V   D D+  +       I S ++  +   F  N  + Q+ V   LD E    Y+L++LA D G P  + ++ +L+ + D +DN P   +S   V   +    L++  +  D D +  ++   +Y L S T      F   T   L   +    E + +  L V
Sbjct: 3077 ITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVF----LSDDYFPTVLENAPSGTTVIHLNATDAD--SGTNAVIAYTVQSSD-----SDLFVIDPNTGVITTQGF-LDFET-KQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEIS--EAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTL---NIYS---------VQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGA---FSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPD-LPPNQGPFTYYLLS-TGPATSYFSLSTAGVLSTTREIDREQIADFYLSV 3584          

HSP 40 Score: 87.8113 bits (216), Expect = 7.951e-16
Identity = 80/272 (29.41%), Postives = 135/272 (49.63%), Query Frame = 3
Query: 3657 TYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNG--QVRYRLTATGMESISVFKID-----TFSGA---LYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TN-EVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVD 4427
            TYR+S+      F+IN  TG ++  + +DRE++   V+ +V   ++ T  +E      + V + D+NDN+P+F + ++      E +  G  +   TA D D G NG     YR+   G E+   F++D     +  GA   L     +D E+ P++  ++   D G P     L V VT+ +IND  P F   S  +  V ++  +G++V +V A D D  TN ++ Y LQ       PF ++P +G+++V  P+  E    + L V A+D
Sbjct:   71 TYRLSE--SHALFAINSSTGALYTTSTIDRESLPSDVINLVVLSSAPTYPTE------VRVLVRDLNDNAPVFPDPSI-VVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRII-RGNEA-GRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGS-SHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQD---EGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMD 327          

HSP 41 Score: 86.2705 bits (212), Expect = 1.867e-15
Identity = 155/658 (23.56%), Postives = 275/658 (41.79%), Query Frame = 3
Query: 7794 QTFFSINRESGQISLNEPLPQLVSVYTLRIRAS----LKMVNSKIL--WYKDTDVSISVYDNVC--------KCTNHGYF-TGSVEENSDSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVI----DLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGML----------ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHF-LFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKN--GQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRE-------TITLVI--SDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVN-------PLDYEIQHQYSLTLLAHDLGFP---RKSQTSIVLIKVLDEDDNSPYFISRNFVAS 9611
            +  F+IN ++G ISL  PL      Y + I AS     ++ +S IL  +  D + +  V+D +         +  N  +F   + +++S +   ++  I    GN+  +F + P      LY  +E          +DRE+ +   + V+ +D +   +E     + V     D+NDN P+F    +  +  E    GS++  +  +D D      +++S +  + + F ++  +G +      DRE   +       S  +   + G+           + + D NDN P+  K+    T     SE A     V+ ++A+D D  + NN  I YS+   N+    +  F ++  SG +T+    L++ +      ++I A D G  PL  + T++  +    +      KST    + VL   + G  V+++    D+  G+        N   Y+SI   N  G  S S N  S  L +      Q+     L  ++  +K +       T+++VI   DFN   P     +   SI E I +G++++ V   DPDA + G +  TII               GN + +  V         +D E  + + LT+ A+D   P   R+     V I V D +DN P FIS+N +A+
Sbjct:  937 KNLFAINEKNGTISLLGPLDVHAGSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTI--AEGNTGDAFGIFPDGQ---LYIKSE----------LDRELQDRYVLMVVASDRA---VEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD-FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATI----SESAANLTQVLRVSASDVD--EGNNGLIHYSIIKGNE----ERQFAIDSTSGQVTLIG-KLDYEA-TPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLF--VDVLENMRIGELVSSVTAT-DSDSGD--------NADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQS-----LYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQM----------PRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAA 1537          

HSP 42 Score: 86.2705 bits (212), Expect = 2.341e-15
Identity = 117/468 (25.00%), Postives = 199/468 (42.52%), Query Frame = 3
Query: 8241 IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL--QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEI------GMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP--IAVLYTSQE-GSRVANI-AVNHDNLYGEITFFIIS-----GNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFC-SKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            +I V D NDN P F        + EN  IG+ +I +   D D+ +   L +++  Q    N F+I+   G+++    +DRE  + +E+ V  +D    +E        + I VTD NDN P      I++  +        G++    I A D D+    N +I Y + + +        F+++  SG L    VA   +      ++I++A+D G  P     T     I    +  +    F  P  I +L   +  G+ V +I A +       + ++I+S           F+IG   G I T+  ++       + + V A    I  S +F  ++R  + + + D N   P        +++ E I  GS ++Q+  +D D G   +V  TII+  DD F + P      S  L     LD E + +YSL + A D G   +S    + I V D +D++P F
Sbjct: 1407 VIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMF----ISQNALAADPSAVIGSVLTT-IMAADPDEGA--NGEIEYEIINGD-----TDTFIVDRYSGDLR---VASALVPSQLIYNLIVSATDLG--PERRKSTTELTIILQGLDGPV----FTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYA----IEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDP-----ESGDLIATRRLDRERRSKYSLLVRADD-GL--QSSDMRINITVSDVNDHTPKF 1841          

HSP 43 Score: 83.9593 bits (206), Expect = 1.168e-14
Identity = 178/783 (22.73%), Postives = 320/783 (40.87%), Query Frame = 3
Query: 4950 GISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDS------TLEYIWINEIPEFSLDKT---SG------IVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPV-----FDTTRLAVSIPEDVPINSEIIQLIASDADKSDL---LLFEILSPNDDLLMTVN----PITGVISTAGILDYEKTERHALTVSCTDGL---------HRVTVEVLINLIN-VNDETPLIHNPTTVYLPKINQ-----NHNIMIKCSDQDNL--GPLSYDIMTSSKDIQNIYVDRITGKVSF-NPGLL---YANSINVSLSCSDT-IHNTIKNVSLIV--LDRNRSSKNYTAFIKLERFEKSPLKIQSVFDKLII-------PNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGEFKPIEGFAPRKHEYRFTIAGIKRDSLNQENQINIETI-LTYKEIELCYPSFLGTPYSFQIDHRVTAPKYLGSVSV---GYCSNQKILYYLSSG-HSFFYVNGTSGDIFITRDLPLGQ---YKFKLSSLIDTNPKTYLSTIVTVSTMGPLENTAKCEFFTLRLSVDSSVELGTKVGKMSITDL 7091
            G + R+   + +  ++  TG +   +  +DRE +    I + V+      + +    T+V + + D NDN PVF + + +    E+++ G+++ + T  A D D+ S      +   I  NE   F LD T   SG      +V+  G  LD E    +   ++V D         + +     D   N   F    Y   + E A + + + QV   ++    N  I++ +  E     F ++P+ G+IT +  +D+E    Y L + A D    SL      T     L+ ++D+NDN PV     F  T    S+ E+  + + +  L  +DAD       +  +IL  N+     V     P   +I  A  LD E+   + LTVS +D            R +V  L+  +N +ND  P+      VY   +++     ++   I  +D D+     L Y I+ S   +   ++   +G V+  + G L    A+ I +++S  D  +H  +    L+V  LD N        F + E ++ S ++      +L++         D+  V F LQ     +E D   + ++P +G    I     R+ +  +++  +  D L    Q ++  I ++  +I    P F    Y   I        Y+ +VS       +N  + Y +S+G  S F VN  SG I     L   +   Y+ ++ +    N ++    IVT++ +   +N            V  +V LG  VG +S + +
Sbjct:   69 GFTYRLSESHALFAINSSTGALYTTST-IDRESLPSDVINLVVL------SSAPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDT--ATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGG--LDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTP--FQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSL------TGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQ--QVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIV-SGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKP---VFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQE----AETDRRSFRLDPVSGRLSTISSLD-REEQAFYSLLVLATD-LGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTM 820          

HSP 44 Score: 80.4925 bits (197), Expect = 1.186e-13
Identity = 126/549 (22.95%), Postives = 227/549 (41.35%), Query Frame = 3
Query: 8064 SKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVI--DLNDNSPIFTLNYFMGFVSENALIGSWII-------DIGVIDADSKLFPLKFSLQGEENNAF----SINPQNGSVFL----AQTVDRELKSKYEMKVAVSDGINVLEIGML---ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAE-----CELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDN---LYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW---FSLIVQAC---GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITST-------DDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            ++  FT     S      N+ T  + T    +DRE   +  I++++   +     + P  ++V+  DLNDN+P+F     +    E++  G  +I       DIG    D + + +   ++G E   F    ++NP     FL       +DRE+  +Y++ V V D       G L   +TV D NDN P       +  +     E A     V+ + A DAD  +  N+ IRY L  E       + F ++ ++G +T++   L++ +  +   + + A DRG P L          +         + R   +T +Y  +V   +Q G+ VA + V   +     G I+  I+ GN   +F + S      +   V SA+  +    ++L V      G    ++V   S   ++ + ++D N + P        V++SE    GS +  +   D D+GL   ++ +I++          +   LV   ++G          LD E+  Q  L + A D G   K   + +++ +LD +D  P F
Sbjct:   66 TRPGFTYRLSESHALFAINSSTGALYTTST-IDRESLPSDVINLVVLSSA----PTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRI---IRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFG----SSHYQAGVPEDAVVGSSVLQVAAADAD--EGTNADIRYRLQDEG------TPFQMDPETGLITVRE-PLDFEARRQ-YSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRY-ASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGG---------LDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVF 582          

HSP 45 Score: 78.9518 bits (193), Expect = 3.434e-13
Identity = 113/462 (24.46%), Postives = 201/462 (43.51%), Query Frame = 3
Query: 3141 KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGA----FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT----NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNED 4493
            + +  TV A +K +   S++  V I V + N ++P FS      +I       + +  V A D D+ +NG + YSI     E  F  I+S +G L   K +D  + Q+    I+A D G         V V +     +   F    +F  + E+      +  L        T  +   T + +    F I+ +TG+I     LD E    + LT+ A +       E  +   + + +   N+  P F +  L  F +SE+   GTI+G   A+D D G +G+V Y +   G      F+I+  +G +Y++  +D E + + +  + A + G         VTV +T ++   P     +     + + V IGT V  V A D D+    +   Y++ S +  +  F INP +G ++V+  + +E    ++L V+AVD+         S+ V ++  N++
Sbjct: 3053 QNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFA-INSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFN---VPDEERCSFATVNIQLKGTNEYVPRFVS-KLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLI--FGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGN-ENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDN 3506          

HSP 46 Score: 72.7886 bits (177), Expect = 2.163e-11
Identity = 90/401 (22.44%), Postives = 158/401 (39.40%), Query Frame = 3
Query: 3207 VVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSI------EKLPVELDFVEIDSQSGRLF----TNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL---EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDN---SSTKGSEYLAVTNLYVNIIDVNDNSPIFK---NDALNNFI-LSESTKVGTILGFYTANDIDD------------GLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFD-LGYP------ALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN 4292
            V + V+D NDN+P+F   S   +    +     +    A D D G NG  + S       E     LD     S  G          L   V  ++   +  ED G P+    ++V V +     +   F    +   + ED  +   + ++   + D       R     +   F ++  TG+I +   LD EA   + LT+ A D    S T  +E L      + ++DVNDN P+ K     A + +  + E+ +VGT++   T  D D             G N Q  + + ++ + ++S+ K+ +          +D E  P +N  ++  D  G P      A  S  S+ + + +IND  P F+++      + +    G+ V  + A D D+ 
Sbjct:  121 VRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEAL------IQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVAS---------ALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQV-YRVNLSEEAPPGSYVSGISATDGDSG 505          

HSP 47 Score: 68.5514 bits (166), Expect = 4.826e-10
Identity = 52/168 (30.95%), Postives = 77/168 (45.83%), Query Frame = 3
Query: 9216 ITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSL----VPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLR--------ELDQLIVLPEVRDEDSIMASRN 9683
            + + + D N   P    S     + E   VGS++LQV   D D G          T+ D R+ L     PF  +  +  + V  PLD+E + QYSLT+ A D G P  +  +  LI++LD +DN P    R F A+ R        ++  ++ L  V D DS  A+ N
Sbjct:  236 VNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEG----------TNADIRYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGN 393          
BLAST of Protocadherin Fat 4 vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 226.868 bits (577), Expect = 5.731e-58
Identity = 295/1257 (23.47%), Postives = 535/1257 (42.56%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV----------VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDH-----QQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYR-LTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLK-------AQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE-FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD-GTFTSTXXXXXXXXXXXXQCHNFTHDRYH---FHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLP--CLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDV-PINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQ-NHNIM-IKCSDQD-NLGPLS-YDIMTSSKDIQNIYVDRITGKVSFNPGLLYANS--INVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYTA---FIKLERFEKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGE--------FKPIEGFAP---RKHEYRFTIAGIKRDSLNQENQINIETILTYKEIELCYPSFLGTPY 6734
            R +YS   L V  +D  +S+ + + I V D ND++P FS   Y F I   T P + +  + A D DSG+NG + Y           V  D + G  F N +  V          V+Q +I  + AED G     ++++VY  I     +   F   ++  ++ E++ +   +    +          +TY I+     G F+++++ G++ ++  LDRE+ +F+ L +   D      S + +   + + ++DVNDN P F +  L    + E+T + T++    A D D G N  + Y  L   G +    F I T  G + L   +D E    +   + A D G P+L S+  V V + +IND  P F  ++  +  + +N   GT + +V+A D D  TN  + Y       +  F I+ ++G ++V+ P+ +E   ++ L V A D     R D  +V + +  D  D + V      + P S    E + TL        A+ + +  NS+  Y+L   + D       +G++ +T +   E        +I+     S  L    +  ++++  + +   F    YF  IPE   T G  +  + A       SD +     +      RI   N+   ++  TG I + +  LDRE  +    T+ VV  D G        T V + + D NDN P F +  ++ H P  T  G  ++  TV   D   +S L Y       E F +D   G +  +G PL+  +   F   + V D G+F  T +  + +   N    +F   R     F   E  P+ +++  +T  +    P   + + I S    + F ++   G ++    +D+E+   Y++ I A D      F P    E +  TVL    D+NDN P+F        I E++ P     +  +  D+  +  L +EI++ N +   ++N  TG I +   LD EK   + LT+  +D        +V+V+IN+++ ND  P      + ++P+ +   + +  +  SD+D  +  +S Y IM +S       ++  TG +  +  L   ++    + +S  D+      +V++ V D N ++  ++    ++      +   K+  VF        +  V++ ++S          ++ IN +TGE        ++ + GF+     +H +  T +   + SL  E  + I  + +        P FL + Y
Sbjct:  105 RSKYS---LLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITY----------IVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGG--GQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKN-GVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLT--YIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNK----FSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIF-AQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSI-VLLDINDFVPVFE----LSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSLDRETKE-RFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPT-GTDVLLVNA-------SDADASKNAVI-----RIIGGNSQFTINPSTGQI-ITSALLDRETKD--NYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRGAIMAAG-PLNGASEVTF--SVHVKDGGSFPKTDSTTVTVRFVNKA--DFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEP---MSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGG----FPPFSSYEKLDITVL----DVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFT---INPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKS-------QSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNA----PQFLKSKY 1286          

HSP 2 Score: 191.815 bits (486), Expect = 2.407e-47
Identity = 322/1372 (23.47%), Postives = 596/1372 (43.44%), Query Frame = 3
Query: 3156 TVLAVNKNDKE--KSTKVFVV-IFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDM---KITEKIFKLEIDH--QQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILS--ESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGY-PA--LHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQS-VHPPDHPFVINPISGILSVSNPI-LQEVS-FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDE-IQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDK-IIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTK--LVLNIGDPHNLNFQKNDYFFQIPE-CKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDG----TFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHR--VTVEVL-INLINVNDETPLIHNPTTV--YLPKINQNHNIMIKCSDQDNL--GPLSYDIMTSSKDIQNIYVDRITGKV-SFNP-----GLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYTAFIKLERFEKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGEF---KPIEGFAPRKHEYRFTIAGIKRDSLNQENQINIETILTYKEIELCYPSFLGTPYSF------QIDHRVTAPKYLGSVSVGYCSNQKILYYLSSGHSFFYVNGTSGDIFITRDLP-----------LGQYKFKLSSLIDTNPKTYLSTIVTVSTMGPLENTA---KCEFFTLRLSVDSSVELGTKVGKMSITD 7088
            TV+AV     +   + +VF+V I +QD NDN P+F T     ++  +    + I ++ AMD D G N  V Y+I  +    D   ID +SG L   + +D   +     +   D G+   +S +++ + ++        F +  +  +I ED     +   I   + D      +TY +++  + G F +N  TG+ +L   LD E   +++LT+ A D     G        +Y NI+DVNDN PIF   +LN++  S  E+  VG+ +  +   D DDG+N Q+ Y + A+G +S+  F +D  +G L + + +D E +  +N ++   DL   PA    S   V++ + ++ND  P F    +L +I  +N  I T V +  A DPD+    Y   + ++P  + F I  I G + ++  +  +EVS + L V+A D  +        V V +   N++  I       + + +++     I  + A    +  N +  Y + N + ++   I+  TG +  T   P++        L    + R  T     ST   ++L+I D   + F+ + Y   +PE   T P   L  +         S L Y +F    G +E     +    L   +G + V    LDRE  E  +  + +   D G        T + + ++D NDN P FA++ +    PE+   G  + +  V A D D         I    +F+++ ++G + TS + LD E    +   +  SD       +S+ ++++ + D ND    F H  Y  HI       + +  VT+ ++   PN  + + + S      F ++P  G I   G ++   +  + + +      +     P  +T +TTV V  V+  D  P           PE+ P++S ++  I   + + + + + I S N      ++ +TG +S +  LD+EK +++ + +   DG      + E L I +++VND  P+      +   L  ++    + +   D+D+   G L Y+I+  + +  +  ++  TG++ S  P        Y  +I  S   S +   ++K V + +LD N ++  ++        E SPL     +    +   D+ +     S Y++ +    F  INPSTG+    +P+     R+   R+ I     DS      ++ +  +   +I    P F  T Y        +I  +VT    + +      SN ++ Y++ S   +F +N T+G+IF  + L            + ++ F ++S     P     T VT++ +   +N     K ++FT    V  +V++GTK+ +++  D
Sbjct:    4 TVVAVGDTLAQPLAAAEVFIVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTI--ISGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGL--QSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAED-----GGGQFTTIRVYFNILDVNDNPPIF---SLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSI-ASG-DSLGQFTVDK-NGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTF-LSPKLTYI-PENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAI--TVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPV-FELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLF----GGNE-----DNAFTL-SASGELGVTQ-SLDRETKE--RFVLMITATDSGSPALTGTGT-INVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLL--VNASDADASKNAVIRIIGGNSQFTINPSTGQIITSAL-LDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSL-SGRNSEKFHIDPLRGAIMAAGPLNGASEVTFSVHV------KDGGSFP--KTDSTTVTVRFVNKAD-FPKVRAKEQTFMFPENQPVSS-LVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNME-NSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVK-VMINILDENDNAPRFSQIFSAHVPENSPLG----YTVTRVTTSDEDIGINAISRYSIMDASLPF-TINPSTGDIVISRPLN----REDTDRYRIRVSAHDS---GWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQ---VFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFT---PVTKNVKVGTKLIRVTAID 1307          

HSP 3 Score: 177.178 bits (448), Expect = 6.773e-43
Identity = 225/884 (25.45%), Postives = 395/884 (44.68%), Query Frame = 3
Query: 3765 VLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALH-SNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAII---LPKSSFYREKIATLKAQSNSKNLNSRFMY-LLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTK----LVLNIGD-PHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYP-GNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWI--NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD-GTF--TSTXXXXXXXXXXXXQCHNFTHDRYHFHIHET-APIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLH----RVTVEVLINLINVNDETPLI-HNPTTVYLPKINQNHNIMIKCSDQD-NLGP---LSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSD 6326
            V T+VA  ++  +      V  + + + D+NDN P+F  D L +  + E+   G+ +   TA D D+G N  V Y + +   +S   F+ID  SG L   + +D E + K++ ++ A D     L  S++ + +T++++ND  P+F++     F + ++   G+ V  + A D D+  N  + Y+ +    D  F +NPI+G+ +++  +  EV   + L V A D   Q    +    +   +DN     + +Y   +   LP  S     +           +NS+  Y +    S  +  +++  G + +      E  S     ++ +  L      ++ ST     ++L++ D P      K  Y   IPE  T     +F+ QA  P   P S +EY + +   G    I   +  +RL  E          LDRE  E S  T+ VV  D+G+  S    T+V + + D NDN P+FA   +     ENT  G  I        D+  +  + Y  +  N   EF +D  +G +T +  PLD E    +   +Q +D G+   T T+ + I++ D ND    F    Y  ++ E    +   I QV  ++     N  + + +      + F+++    +  TQ  +D E    ++L+ITATD    +L      T T T+ V + D+NDN+P F +     +IPED P  ++++ + ASDAD S   +  I+  N     T+NP TG I T+ +LD E  + + L V C+D         +  VL+ + +VND  P   H+P   ++P      + +   +  D ++GP   L Y +  S ++ +  ++D + G +     L  A+ +  S+   D
Sbjct:    2 VTTVVAVGDTLAQPLAAAEVFIVEITLQDINDNPPVFPTDML-DLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDS---FRIDPESGDLIATRRLDRERRSKYSLLVRADD----GLQSSDMRINITVSDVNDHTPKFSRPV-YSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGS----TVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDK-NGVLKVLKALDRESQSF-YNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY---IPE-NTPIDTVVFKAQATDPDSGPNSYIEYTLLNPL-GNKFSIGTIDGEVRLTGE----------LDRE--EVSNYTLTVVATDKGQP-SLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAK-PLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQ-SLDRETKERFVLMITATDSGSPAL------TGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQF--TINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSL--SGRNSEKFHIDPLRGAIMAAGPLNGASEVTFSVHVKD 840          

HSP 4 Score: 170.244 bits (430), Expect = 7.531e-41
Identity = 206/775 (26.58%), Postives = 349/775 (45.03%), Query Frame = 3
Query: 3162 LAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLV---------DVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-EIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAV-TNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNE---DEIQVLTYGAI--ILPKSSFYREKIATLKAQSNSKNLNSRFMYLL-KNSSYDKIIINRYTGDVFLTSTTPVEFNS-IDITFLI-SLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFA-NETFIFHAPENTTYGQKIYVGTVQAHDKDL---DSTLEYIWINEIPE---FSLDKTSGIVTTSGVPLDHEAVAYF 5381
            + V+ +D   +    V IFV D NDN+P FS  SY+      T+  + + +VFA DPD G NG V Y I+    + ++  I++ +G +F  +++         +V      F +T+ D G P L S   V + I  S  +   F K  +F  +++++K+  K+ ++  ID +       V Y IS     G F ++  TG I + + L  +      +T+ A D    KG+  L+    +++ + + N ++P F    ++  I  ES  +G+I+   +A D D  +NG ++Y +++   E I  F I++ +G L L + +DYEL  K    I+A D G+ A     SVTV + ++ND  P F  +     ++ +N   GTTV  + A D D  TN V+ Y       D  FVI+P +G+++    +  E   S+ L V A +   ++R    +V + +K  NE     +  L Y  I    PK +   E  A+ +        +    YL+  NS      IN+ TG ++++     E    + +  L  +  S+R   + +      VL+  DP    F  N Y  QI E    P        + +  + I     + + I  G        N    ++ +TG I+V    LDRE +    ++  V+ +D G   S      + + +ED NDN P+   +E  +    EN   G    V T+Q+ D DL        Y  ++  P    FSL  T+G+++T+   +D E +A F
Sbjct: 1141 IRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKS---QSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKD----KGNPPLSSQATVHITVTEENYHTPEFSQSHMSATI-PESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGI--FAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVL-ENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDL-FVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDR----DLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPP--IFTLNIYSVQISE--GVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNE------NGAFSINPQTGQITV-TAELDRETLPIYNLS--VLAVDSGTP-SATGSASLLVTLEDINDNGPMLTVSEGEVM---ENKRPG--TLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSL-STAGVLSTT-REIDREQIADF 1878          

HSP 5 Score: 157.918 bits (398), Expect = 4.376e-37
Identity = 333/1411 (23.60%), Postives = 582/1411 (41.25%), Query Frame = 3
Query: 2892 SNTEIIIEFHPIFDS-PIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHL--SIIEESLYGKWSIFXXXXXXXXXXXXXXXR-KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSI--NRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL---EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVA--IGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQ-----DRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYD-KIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTP-GLKLFRLQALYPGNPISDL-EYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD----------LDSTLEYIWIN----EIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVT-LKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG--LHRVT-VEVLINLINVNDETPLIHNPTTVYLPKINQNHN-----IMIKCSDQDNL--GPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSS--------KNYTAFI-----KLERFEKSPLKIQSVFDKLIIPND-----DKYVYFLLQSLYNLSEDDYNFYLINPSTGEFKPIEGFAPRKHEYRFTIA------GIKRDSLNQENQINIETILTYKEIELCYPSFLGTPYSFQIDHRVTAPKYLGSVSV----GYCSNQKILYYLSSG--HSFFYVNGTSGDIFITRDL 6893
            S+TE+++    I D+ PIF +  Y   + EN+L+ T + ++         N  +   I+  +   ++ I S      +++    E+   Y  TV A ++    ++    V I + D ND  P+F    Y  ++  N  T P T + +V A D D G N  ++Y +       D     S SG L   + +D   +E F+  ITA D G P L  +  + V ++    +   F  + +F  I ED      +  +   + D  +    RI     +  F+IN  TG I     LDRE    + L +V +D  S +     + T++ V + DVNDN P F++      I S  T  G+ +   T  D D G N ++ Y L+    E    F ID   GA+    P++     +  F +   D G      + +VTV   N  D      KE    F   Q V+  + T  G     +P    + YY+ S +   + F I+ ++G +S+S P+  E      V+ ++A          Y++  + V   +DN    +   + + IL   +    KI T+ A       N +  Y + N + +    IN  TG++   S  P++   +   ++++++S    +  +  S K+++NI D  N N  +    F     + +P G  + R+        I+ +  Y I D          LP T   ++  TG I +    L+RE  +  +  + V   D G   S    T V + + D NDN P F+  ++    PE T  G K  V  V A D D          + S  EY  IN    EI    + K   +   S V ++  +  + +        +  S   + I I D+ND    F   +Y   + +   + T + +VT + +     N  +++ I ++     F ++ D G I+    +  + + ++ + +TA D     L      +   TV +++ + N + P F  + ++ +IPE   I S +  + A D D +   L+ + I S N++ +  +N  TG+++ A  LDYE  ++H +T+S  DG  + R     V +N+I+VND +P+    +  Y P + +N       I +  +D D+     ++Y + +S  D+    +D  TG ++   G L             + H T+K  +  V D  R S        K    ++     KL  FE S    +      +  +D     D  V++L+             + IN  TG+   + G   R+ E R ++       G  R +   E  +N+ T+L   +     P F    YS QI   V    ++  VS        S  +  Y++ SG  +  F +N  +G I +T +L
Sbjct:  434 SSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTIL-QVVARDDDRGSNSKLSYVL--FGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQ--FTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPE--PLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSP-TLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEK---FHIDPLRGAIMAAGPLNG--ASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEP----MSYYIASGNL-GNTFQIDQLTGQVSISQPLDFE-KIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEIL--ENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEI--RSVRPLDREKVS-HYVLTIKSSDKGSPSQSTSVKVMINILD-ENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDA--------SLPFT---INPSTGDIVISRP-LNRE--DTDRYRIRVSAHDSGWTVS----TDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSK--VTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHS--FIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPL------SSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFL--SDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDL--FVIDPNTGVITTQ-GFL-------DFETKQSYHLTVK--AFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLI-----FGNSRKKGFQINKKTGQIY-VSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNV-TVLDANDP----PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAEL 1766          

HSP 6 Score: 153.68 bits (387), Expect = 7.253e-36
Identity = 181/698 (25.93%), Postives = 310/698 (44.41%), Query Frame = 3
Query: 3144 QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMD-PDSGINGFVNYSIEKLPVELDFVEIDSQSGRL-FTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQ-----MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLE-FIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE----VSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKA-QSNSKNLNSRFMYLLKNSSYDKII-INRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTT----PGLKLFRLQALYPGNPISD--LEYYIFDI-----YCGISERIKLPNTMIRLDKETGWISVGNIYL-----DREIIEGSQI-TVEVVVIDRGKNGSRIRCTKVFLN 5138
            ++SF V + ++      ++  V I + D NDN+P F    YF  + ++ K  T + +V A+D  D G+N  V Y I      L   ++D+ +G +   + L+  + Q F   +TA+D G P L+S   V++ +         F +      I E   I   +  +    +      ++ Y IS   ++G F+IN  TGI+ L   LD E    H +TI A D      + Y +VT   VN+IDVNDNSP+F +D     +L E+   GT +    A D D G N  + Y + ++  +   +F ID  +G +     +D+E K  ++  + AF++      S  +V + +   N+  PRF   S+L  F + +    GT VG V+A D D  T+  ++YL   +     F IN  +G + VS  + +E    VS  ++     + R    D+ +V V +   N+  I  L   ++ + +       +  + A  S+S    SRF Y + + + +    IN  TG + +T+    E   I   + +S+ ++ S T     S  L++ + D        N     + E +      PG  +  LQ+  P  P +     YY+        Y  +S    L +T   +D+E     + + YL     D  + + S   TV + VID+  N S+ R  ++F+N
Sbjct: 1246 RHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISN-DNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVT---VNVIDVNDNSPVFLSDDYFPTVL-ENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSD---LFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRF--VSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPI---YNLSVLAVDSGTPSATGSASLLVTLED-----INDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVL-STTREIDRE----QIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVN 1920          

HSP 7 Score: 152.91 bits (385), Expect = 1.349e-35
Identity = 157/541 (29.02%), Postives = 243/541 (44.92%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLI---KFGFSYEFFH------KEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPP---LKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY-IEIGKVTRKPLAIVH--CQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRN-ASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDL 1721
            KF    Y+F + E+    ++V  +L      G + E  +      ++G+F LN +TGV   + ++D E     ++ +    +   GQF  TI +   I+D NDNPPIF  N     ++EN+ + + + +   TD+D D       Y I SG+   +F +   GV       L+V++ LDRE++  Y L + V D  Q P        +V II+ D NDN P F   K T  + E+      V K  A+D DSG N  +EY        L N+FSI    G +RLT          + TL V A D G PSLS+   V V V+ IN   P F         +A Y +EI + T     I+     D D+     +   I+ GN    F ++   G + +    K +      +Y +TV+A D G+  +  T  + I +   N + PVF     SV V  N  ++   I    A D D G N K+ Y +  G+  + F +   SG + + + L     ++  L I A D+G  +L  TG +++
Sbjct:  138 KFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTV--RAEDGGGQFT-TIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDAD-DGINSQLTYSIASGDSLGQFTVDKNGV-------LKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNP---LGNKFSIGTIDGEVRLTGELD-REEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFA--------QALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITV---AKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSA-SGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINV 650          

HSP 8 Score: 149.443 bits (376), Expect = 1.445e-34
Identity = 132/483 (27.33%), Postives = 230/483 (47.62%), Query Frame = 3
Query:  261 GLFNLNKLTGVILTSNIIDRESLA--SDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTD-----EFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            G F ++K  GV+     +DRES +  + ++++    +    +F  T  + + ++D NDNPP F   KL   I EN  + T +    ATD D+      E+ + N      GN   +F++  +  +      +R+   LDRE    Y LT+   DKGQP L    EV ++V D NDN+P+F+ + Y V +NE+ L G ++++V+A+D D G N +V Y      +    EF ID  +G+I + +P           L V+A D GS   +    V++ ++ IN F P F ++ Y  +  +     +G + R  L +V  +DDD+     ++  + GGN++N F L  + G + +    +++     + + + + A D+G+P+   T  + + ++  N   P F ++    T+  +A   + +    A+D DA  N  I   I  G+   +F I   +G I     L     D   L ++  DAG
Sbjct:  288 GQFTVDK-NGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPL----GN---KFSIGTIDGE------VRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNT--NQEFRIDSVTGAITVAKPLD-REKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPE----NLGTLPRTILQVV-ARDDDRGSNSKLSYVLFGGNEDNAFTLSAS-GELGV---TQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVI--RIIGGN--SQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAG 739          

HSP 9 Score: 149.443 bits (376), Expect = 1.458e-34
Identity = 154/632 (24.37%), Postives = 307/632 (48.58%), Query Frame = 3
Query: 7773 IYNGTIYQTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSI-SVYDNVCKCTNHGYFTGSVEENSDSEI-SVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAV-ALNWISDNETVDV-----IITASDRGQPPLFHSITVHFLFITA-ECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYG---EITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWF-SLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            I +G +  TF  I++ +GQ+S+++PL  + +  Y + I A           Y+  D+++  V DN        + +  +E  S  +I +VS        N ++ + +     ++    N  T EIR+  +P+DRE  ++  +++  +D GS     S   +I ++D NDN+P F+   F   V EN+ +G  +  +   D D  +  + ++S+  + +  F+INP  G + +++ ++RE   +Y ++V+  D    +   + I VTD NDN P+ S+     ++ ++  E       V  + ATD D  + +N Q+ Y + S+++       F +N  +G +  K +     ++    V++     I+T+SDRG+P L    TV    + + +   + LKS +  P  V    + G+++  +    D  +G   E+ +FI + N    F + +  G IS + ++ S +   +F ++  +  G   LSS      + T+ + +++ N ++P+   S  + +I E   +GS +  V   D DA + G++K +I +  ++      F  N ++  L +   LDYE+  ++ +T+ A D G+  ++    V + V+D +DNSP F+S ++  ++ E
Sbjct:  901 IASGNLGNTF-QIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGF-PPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSV-RPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIM-DASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSR----TSYYLDCPELTEIGSKVTQVFATDPD--EGSNGQVFYFIKSQSE------YFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTP--VTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSS------QATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGI----FAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLE 1503          

HSP 10 Score: 148.673 bits (374), Expect = 2.390e-34
Identity = 146/507 (28.80%), Postives = 238/507 (46.94%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKV--RIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYR-----GQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSI---------RLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            E  F++N  TG I +   +DRE ++  ++ I   K + +G   ++ S+KV   I+DENDN P F        + EN  L    ++T  T SD D  G+         N   R+++    + +      G +++   RPL+RE  ++Y++ +S  D G        +V I V D NDN+P FS + Y +   E    G +V +V+A+D D G N +V Y F K++S     F I+  +G I          +T  ++ +IN+   + +V + D G PSL +   VT++++  N   P+F +  Y     K       KV  K + +    D D      +   I   N    F L+   G + +   +  I ++N Q++ ITV A D GNP   +   + I + + N + P F   + S T+  + SI S +    A D DA +NG I YSI+ G+    FAI   +G++TL K L +    K ++ I A D G   +  TGY  + +
Sbjct: 1011 ENSFSINHATGEIRSVRPLDREKVSHYVLTI---KSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPL--GYTVTRVTTSDED-IGI---------NAISRYSIMDASLPFTINPSTGDIVIS--RPLNREDTDRYRIRVSAHDSG---WTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFY-FIKSQS---EYFRINATTGEIFNKQILKYQNVTGFSNVNINRH--SFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNV-----KVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSL--ISDLN-QNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGW--VARTGYCSVTV 1480          

HSP 11 Score: 134.806 bits (338), Expect = 3.791e-30
Identity = 151/536 (28.17%), Postives = 249/536 (46.46%), Query Frame = 3
Query: 8061 NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVI--DLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG----MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAE--CELRILKSTFQYP----IAVLYTSQEGSRVANIAVNHDNLYGE-ITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGS--NLLQVDVIDPDAGLAGIVKLTIITST-DDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            NSK+S+ L    ++D  +  + + E+      +DRE      + +I A  SG    +  G I VI  D+NDN P F    +   + E+A  G+ ++ +   DAD+    +   + G  N+ F+INP  G +  +  +DRE K  Y + V  SD  +   +     +L+TVTD NDN P+      +  +V +         FV  +T TDAD     NS++ YSLS  N        F ++   G++ + A  LN  S+   V   +   D G  P   S TV   F+      ++R  + TF +P    ++ L T+  GS          +L GE ++++I SGN  + F I    GQ+S S+ ++   + ++   I    G          S  E + + + D N  +P   I +    ISE+++  S   +L V  +D D+G  G +   I+    ++ FS+     N  + +++ V PLD E    Y LT+ + D G P +S +  V+I +LDE+DN+P F S+ F A + E
Sbjct:  590 NSKLSYVLF-GGNEDNAFTLSASGELGVTQS-LDRETKERF-VLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGG--NSQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQ----HHPYVTHIPSPTLPGSFVFAVTVTDADIGP--NSELHYSLSGRNSE-----KFHIDPLRGAI-MAAGPLNGASE---VTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGS----------SLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDG-----GFPPFSSYEKLDITVLDVNDNAP---IFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSI-----NHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRF-SQIFSAHVPE 1081          

HSP 12 Score: 120.168 bits (300), Expect = 1.019e-25
Identity = 113/462 (24.46%), Postives = 217/462 (46.97%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVA--NIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            I + D+NDN P+F  +     V EN   GS I+ +  +DAD     L  +++    +++F I+P++G +   + +DRE +SKY + V   DG+   ++ + ITV+D ND+ P+ S+ +    +  +  E       V  I AT  DD    N +I Y ++ +++      +F LN  +G   +  + L++      +  +      GQ   F +I V+F  +       I  S   Y  +++     GS V   N+    D +  ++T+ I SG+    F++  KNG +   + ++      +++L+VQ      + +  F S  + +++++ D N   P   +S     I E   + + + +    DPD+G    ++ T++    ++FS+          ++++   LD E    Y+LT++A D G P  S ++ V++ VLD +DN+P F    +   + E
Sbjct:   26 ITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPV----YSFDIPEDTIPGSLVAAILAT--DDDSGVNGEITYIVNEDDE----DGIFFLNPITGVFNLTRL-LDYEVQQYYILTVRAEDGGGQ---FTTIRVYFNILDVNDNPPIF-SLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTV-DKNGVLKVLKALDRESQ-SFYNLVVQVHDLPQIPASRFTSTAQ-VSIILLDVNDNPPTF-LSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTI-----DGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINE 463          

HSP 13 Score: 119.398 bits (298), Expect = 1.698e-25
Identity = 135/513 (26.32%), Postives = 212/513 (41.33%), Query Frame = 3
Query:  234 FSYEFF--HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRI---NYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHAR 1754
             SY  F  +++  F L+  +G +  +  +DRE+     + +     +       T +I V + D NDN P F        I E+    TD+ L  A+D+D  +  V    +I  GN   +F ++       GQ++   +  LDRETK+ Y L +   D G P PL     V + V D NDN P F    Y   +    LPG  V  V  +DAD G N E+ Y      S    +F ID   G+I    P +      + T  V   D GS   +    VTV  +   + FPK R     ++   ++     +  +T   L             + ++  I  GN  N F +++  G V I + +       +Q Y + + A D G P   +   + I +   N   P+F+       +  N S    I    A D D+G NG++ Y I  G+  + F+I   +G I  ++PL   K+    L I + D G  S  T+  + +NIL  +    R
Sbjct:  593 LSYVLFGGNEDNAFTLSA-SGELGVTQSLDRET-KERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAV---IRIIGGNS--QFTIN----PSTGQIITSAL--LDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNS---EKFHIDPLRGAIMAAGPLN---GASEVTFSVHVKDGGSFPKTDSTTVTVRFVN-KADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLR-----------GEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDF---EKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRK-ILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPR 1070          

HSP 14 Score: 117.857 bits (294), Expect = 5.264e-25
Identity = 126/473 (26.64%), Postives = 217/473 (45.88%), Query Frame = 3
Query: 3141 KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIP--RLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMK---ITEKIFKLEID--HQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALN--NFILSESTKVGTILGFYTANDIDDGLNGQVRYR-LTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD----TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLT 4511
            +++  T+ A++     ++    V + V D NDNSP+F +  YF ++  +    TT+  + A D DSG N  + Y+++    + D   ID  +G + T   +D  E +  + +T +   +P     S   V +++  + +    F  + ++  ISE      I  ++F  + D      V Y I   ++K  F IN+ TG I++   LDRE      L ++A +  S +G++   VT + V ++D ND  PIF    LN  +  +SE   +GT + F +A D  D +    R+     +G E+   F I+  +G + +   +D E  P +N  + A D G P+   + S+ VT+ +IND  P        E  V +N   GT V  + + DPD         YYL S  P    F ++  +G+LS +  I +E    F L V+  D+         +V + +   N++  Q  T
Sbjct: 1456 QKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQS--SDSDLFVIDPNTGVITTQGFLD-FETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVT-VNVTVLDAND-PPIF---TLNIYSVQISEGVPIGTHVTFVSAFD-SDSIPSWSRFSYFIGSGNEN-GAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVS---EGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLS-TAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRT 1914          

HSP 15 Score: 111.694 bits (278), Expect = 4.543e-23
Identity = 124/483 (25.67%), Postives = 212/483 (43.89%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN--NYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVY-ASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCY-----VTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIG--GNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            F ++  +G ++ +  +DRE  +    +  L  +  +G     + I + + D ND+ P F        I E+    + ++   ATD D+   GV+    Y +   +ED  F L+ +        +  + R LD E ++ Y LT+  ED G       + V   + D NDN P+FS + Y+  L E NLP    V V+  +DAD G+N ++ Y      S+   +F++D K+G +++ +      +Q    LVV+   H  P + A  +     V++ ++ +N   P F       + K  YI         +      D D  P   I  +++   GN    F++    G V +  ++       + +YT+TV A D G PS  ++ ++++ +   N   P+F      V +  N    + I   FA D D G NG++ Y I  G+    F I+  +G IT+ KPL   K     L + A D G
Sbjct:   85 FRIDPESGDLIATRRLDRERRS----KYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDS---GVNGEITYIVNEDDEDGIFFLNPI------TGVFNLTRLLDYEVQQYYILTVRAEDGGG--QFTTIRVYFNILDVNDNPPIFSLNSYSTSLME-NLPVGSTVLVFNVTDADDGINSQLTYSIASGDSL--GQFTVD-KNGVLKVLKALD-RESQSFYNLVVQV--HDLPQIPASRFTSTAQVSIILLDVNDNPPTFL------SPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNK---FSIGTIDGEVRLTGELD---REEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRG 533          

HSP 16 Score: 111.309 bits (277), Expect = 4.698e-23
Identity = 118/451 (26.16%), Postives = 204/451 (45.23%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKINP-SPKSKQFFDKQTFFQNISEDMKI-TEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLN-GQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSV-----------SNPILQEVSFDLVVMAVDA 4430
            ++ Y  TV A N  D+E+ +   V I ++  N+  P F ++ Y+F I+      T +G+VFA D D G +G V+Y I     +  F +I+ ++G+++ + ++D  ++E +   + A++ G  R     +V V +          F    +   ISE + I T   F    D   +      +Y I    + GAFSIN  TG I +   LDRE +  + L+++A D+ +   +      +L V + D+NDN P+     ++   + E+ + GT++    + D D   N G   Y L +TG  + S F + T +G L   + +D E    +   +   D G P + S  +V +T+ + ND  P  ++   +      N+  G  +G V  QDPD       L S H        +  SG+ S+           S P   + +FDL V++ D 
Sbjct: 1559 KQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGF-QINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSAT---GSASLLVTLEDINDNGPML---TVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTG-PATSYFSLST-AGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQND-NPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDV------LDSFH-------CSLTSGVTSLFSIPGGTCDLNSQPRSTDGTFDLTVLSNDG 1986          

HSP 17 Score: 107.071 bits (266), Expect = 9.512e-22
Identity = 104/454 (22.91%), Postives = 177/454 (38.99%), Query Frame = 3
Query: 10608 SGHLSVDRKGIIRIRKSIDKESVDSLTVQSSIQFKGKSELL---TLTVNVNDENDSESKSRITDIFIGIAENAFQLTRIAQLLPIDPDITGDFQCRLDTLNVPLGILITPDCWLHIINTSSAIRSINNSY-MRILHHDGYHNAVVSSFRMKVNLLNNKNIQTNWIV-FKIPNL--FIT--------------SXXXXXXXXXXXXXXXNVDVALMAIETVKNYLVIWPRSPNREKALQVVEQFKDKLEVVLKIEIQEITIRLCNRKLCNSHGLCSIGIQVNYEQLFTDEDSITANIIYIYPSVNFNIKCLCDDGFLGEKCAL-LAKCRQQVCHNGGVCGVNRNGEAVCECAPGYTGYNCEYDINECEKTNLCTPHGNCNNIRGGFKCECQLNWIGNGLCTQPFNYCSSNPCSELGTERCIPILGGFKCRCHFGNFGDHCQYSAISFPAESYMEM 11903
            + + S+   G++   + ID+E +    +    +  G  ++    T+ + V D+ND+ S+SR  +IF+    N F    +  + P DPD+   F C L +    L  +    C L+     S  RS + ++ + +L +DG H+ V S+ R+     +N  +  + ++   +P +  F+T              + +     L +     N    L A++   N  V      N        E  K+ L     ++++ +    C    C + G C   + V+   +    +S+   I+   P   F  KCL   G+ G  C + + +C    CH+GG C  N  G   C C  G+TG  CE DINEC ++  C     C N  G F C C+  +                                       G FG HC+ ++  F   SYME 
Sbjct: 1853 TSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFSIPGGTCDLN-----SQPRSTDGTFDLTVLSNDGVHSTVTSNIRVFFAGFSNATVDNSILLRLGVPTVKDFLTNHYLHFLRIASSQLTGLGTAVQLYSAYEENNRTFLLAAVKRNHNQYV------NPSGVATFFESIKEILLRQSGVKVESVDHDSCVHGPCQNGGSCLRRLAVS--SVLKSRESLPVIIVANEPLQPFLCKCL--PGYAGSWCEIDIDECLPSPCHSGGTCH-NLVGGFSCSCPDGFTGRACERDINECLQSP-CKNGAICQNFPGSFNCVCKTGYT--------------------------------------GVFGKHCELNSYGFEELSYMEF 2251          

HSP 18 Score: 104.375 bits (259), Expect = 6.988e-21
Identity = 103/353 (29.18%), Postives = 155/353 (43.91%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIK---FGFSYEFFH-------KEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYK-KTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQ------------EVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFR-----INYVG 1121
            +F+S  Y F +SE  P  TIVG+V       G   E  +       K+G F +NK TG I  S I+DRE      +++      ++ G  ++ +++ V ++D ND PPIF  N    +I E + + T ++  +A DSD+       +Y I SGNE+  F+++       GQ+   V   LDRET   Y L++   D G P   G   + + +ED NDN P+ + S+  V   E+  PG  V+ + ++D D   NQ               Y    T  VL     IDR+                 D  L V   D G P +S+   V + VI  N    + R     +NY G
Sbjct: 1595 RFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKG-FQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSIN----PQTGQIT--VTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVM--ENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDRE--------------QIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYG 1923          

HSP 19 Score: 102.834 bits (255), Expect = 1.910e-20
Identity = 127/502 (25.30%), Postives = 224/502 (44.62%), Query Frame = 3
Query: 8157 VDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE------IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI--AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQAC--GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISE-LIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDR-FSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +D EV     ++V   DG GG   +      ++D+NDN PIF+LN +   + EN  +GS ++   V DAD  +   L +S+  G+    F+++ +NG + + + +DRE +S Y + V V D   +          + I + D NDN P      +  T++   +     +  V    ATD D     NS I Y+L +     P+ + F +    G + +          N T+ V+  A+D+GQP L  S  V  + +       I      Y + +   +  G+ +  +  A   +   G++ + I++GN +  F I S  G I+ ++ ++       + L VQA   G+   +  S      T+++V+ D N + P   +S  +V++ E L  +   +LQV   D D G    +   +    +D  F+L        S +L V   LD E + ++ L + A D G P  + T  + + V D +DN P F S+ +  ++ E
Sbjct:  202 LDYEVQQYYILTVRAEDG-GGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVD-KNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKL--TYIPENTPI---DTVVFKAQATDPDSGP--NSYIEYTLLN-----PLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVV--ATDKGQPSLSSSTEVVVMVLDINDNNPIFAQAL-YKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKT-PTYHLTVQATDRGSTPRTDTS------TVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTL------SASGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPE 673          

HSP 20 Score: 101.293 bits (251), Expect = 6.436e-20
Identity = 137/558 (24.55%), Postives = 228/558 (40.86%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLI----KFGFS--YEFF----HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETIS----IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFAL-SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAI--VHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHI-----------------LRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLN-GKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYL 1715
            +FL S+Y   V++N  + T + +V       FG +   E+F    +  G F L+  TG I  ++     SL SDL + F    T + +    +S    + + + +EN + P F  + +   I E+ ++ + +   +A D D    G+   Y I SGNE+  FA+ S  G+       L + + LD E  +K+++TIS  D G     G   V + V D NDNSPVF    Y   + E+   G  V+ + A+DADSG N  + Y  + + S L   F ID  +G I  TQ       +    L V+AF+       ++  V + +   N + P+F         K  Y EI +   K   +  V   D D      +   I G + +  F + +  G +++                  +   +I   ++   T+ V  +D  +P                   P+F     SV +     I + +    A D D+  +  +  Y I  G+    F+I   +G IT+   L    L    L ++A D+G  S   +  L
Sbjct: 1280 QFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVAS-----SLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIK-YSISSGNEEGIFAINSSTGI-------LTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDL---FVIDPNTGVI-TTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRF-------VSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDP-------------------PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASL 1794          

HSP 21 Score: 95.5153 bits (236), Expect = 3.561e-18
Identity = 123/502 (24.50%), Postives = 221/502 (44.02%), Query Frame = 3
Query: 8136 IRTAHKPVDREVYNNLEISVIIADGSGGIIES--CPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP-LKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVA---VSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDAD---DSQ------SNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWIS----DNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNL--YGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDN 9575
            I T  K +D E+    E+++   DG G +  +  C   + VID+NDNSP+F  + +   V ENA  G+ +I +   DADS     + +++Q  +++ F I+P  G +     +D E K  Y + V    V D        + I +  +N+  P+     ++K +    SE A     V  + A+D D   D +       N+ +  + ++ +  +I V  + L  E    +++K +A N+ S    D + V V +T  D   PP+F ++ ++ + I+    +                   G+ V  + A + D++  +   ++FI SGN +  FSI  + GQI+ +  ++   L   ++L V A  +   S+    S    + + + D N   P + +SE  V   E  + G+ ++ +   DPD           + ST    S     T G    L     +D E    + L+++  D G P+ S T  V I V+D++DN
Sbjct: 1443 ILTLAKALDYELCQKHEMTISAIDG-GWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPR----FVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGI-LDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIF-TLNIYSVQISEGVPI-------------------GTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETL-PIYNLSVLAVDSGTPSATGSAS----LLVTLEDINDNGPMLTVSEGEV--MENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAG---VLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDN 1908          

HSP 22 Score: 95.1301 bits (235), Expect = 4.696e-18
Identity = 114/443 (25.73%), Postives = 194/443 (43.79%), Query Frame = 3
Query:  387 ETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGN-PSKQ--TTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETT 1706
            E   +++ + D NDNPP+F  + L+  + ENI   + I    A D+D     +   Y I SG  DD F +        G L+    R LDRE + KY L +  +D  Q      + + I V D ND++P FS   Y+  + E  +PG  V  + A+D DSGVN E+ Y   +     +  F ++  +G   LT+     + Q    L V A D G    +   Y   +++ +N   P F +N   ST     + +G      + + +  D D      +  SI  G+    F +++      +L+ +KA+   +   Y + V+  D    P+ +  +T  + I +   N   P F +  +   +  N  I++ +    ATD D+G N  I Y++      ++F+I    G + L   L   ++    L ++A D G  SL ++
Sbjct:   20 EVFIVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALV-TYTIISG-ADDSFRID----PESGDLI--ATRRLDRERRSKYSLLVRADDGLQ---SSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDE--DGIFFLNPITGVFNLTRLLDYEVQQ-YYILTVRAEDGGGQFTTIRVY--FNILDVNDNPPIFSLNSY-STSLMENLPVGST----VLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKN----GVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSP-KLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLN-PLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSS 435          

HSP 23 Score: 91.2781 bits (225), Expect = 6.305e-17
Identity = 124/546 (22.71%), Postives = 230/546 (42.12%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQV-----------LIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETI---SIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQ-FKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPR-DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGK--IIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL 1730
            +F  S  +  + E+  I +IV  V           LIK+  S    ++EG+F +N  TG++  +  +D E      + I      ++G ++      S+ V +ID NDN P+F  +     ++EN    T +    ATD+D+    V   Y ++S + D        GV       +     LD ETK+ Y LT+   +           V I ++  N+  P F    Y   ++E+   G  V +V+ASD D G + EV Y  F  +R   +  F I++K+G I ++        +   +L V A + GS   +    VTV+V  +++  P      + S   +  + IG      +  V   D D  P     +  I  GN+   F++    G + +  ++       L  Y ++V A+D+G PS   +  +L+ +   N   P+         V  N    + +    +TD D   N      Y ++ G     F++   +G+++  + +   ++    L ++ +D+G+  + +TG + + ++
Sbjct: 1386 EFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSG--NEEGIFAINSSTGILTLAKALDYELCQKHEMTI----SAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIA-YTVQSSDSDLFVIDPNTGV-------ITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSR---KKGFQINKKTGQIYVSGILDREKEE-RVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTH----VTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELD---RETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPML--TVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLST-AGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVI 1903          

HSP 24 Score: 89.7373 bits (221), Expect = 1.812e-16
Identity = 129/540 (23.89%), Postives = 235/540 (43.52%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQ-GEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG---MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHF-LFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLY--GEITFFIISGNGSSYFSIGSKNGQISTS--------RNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF-ISRNFVASLRELDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILDV 9812
            I V + N ++P F+ ++    + E+  IGS +  +   D D+ +  L K+S+  G E   F+IN   G + LA+ +D EL  K+EM ++  DG  V   G   + + V D NDN P      ++  +     E A     V+++ ATDAD     N+ I Y++ S +       LF+++ ++G +T +   L++ +  ++  + + A +          TV+  L  T E   R +   + + I+    + +G+ V  +  +  +L   GE+ + I   +    F I  K GQI  S          V+  +L + F  I  A   ++  +V+     +     +   N+YS         V ISE + +G+++  V   D D+  +       I S ++  +   F  N  + Q+ V   LD E    Y+L++LA D G P  + ++ +L+ + D +DN P   +S   V   +    L++  +  D D +  ++   +Y L S T      F   T   L   +    E + +  L V
Sbjct: 1375 ITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVF----LSDDYFPTVLENAPSGTTVIHLNATDAD--SGTNAVIAYTVQSSD-----SDLFVIDPNTGVITTQGF-LDFET-KQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEIS--EAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTL---NIYS---------VQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGA---FSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPD-LPPNQGPFTYYLLS-TGPATSYFSLSTAGVLSTTREIDREQIADFYLSV 1882          

HSP 25 Score: 82.8037 bits (203), Expect = 2.316e-14
Identity = 90/317 (28.39%), Postives = 145/317 (45.74%), Query Frame = 3
Query:  687 ISVEDKGQPPLKG--VLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPL 1631
            ++V D    PL    V  VEI ++D NDN PVF      + + E+   G +++++ A DAD G N  V Y      S  ++ F ID +SG +  T+       +   +L+V A D      S+   + + V  +N   PKF    V S D    I    +    +A +   DDD      I   +   +++ IF L    G  ++ R +   + +  Q Y +TVRA D G   + TT+ +   I   N   P+F     S ++  N  + S +  F  TD D G+N ++ YSI  GD   +F ++K+ G++ +LK L
Sbjct:    6 VAVGDTLAQPLAAAEVFIVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTII---SGADDSFRIDPESGDLIATRRLD-RERRSKYSLLVRADDG---LQSSDMRINITVSDVNDHTPKFS-RPVYSFD----IPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLD--YEVQ-QYYILTVRAEDGG--GQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKN-GVLKVLKAL 304          

HSP 26 Score: 69.3218 bits (168), Expect = 2.574e-10
Identity = 45/143 (31.47%), Postives = 74/143 (51.75%), Query Frame = 3
Query: 5694 LITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETPLIHNP 6116
            ++T       +L  P        V +++ DINDN PVF T  L +++ E++   S+I+QL A DAD+    L+ + I+S  DD    ++P +G +     LD E+  +++L V   DGL    + + I + +VND TP    P
Sbjct:    1 MVTTVVAVGDTLAQPLAAAEVFIVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFR-IDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRP 142          
BLAST of Protocadherin Fat 4 vs. Ensembl Human
Match: FAT3 (FAT atypical cadherin 3 [Source:HGNC Symbol;Acc:HGNC:23112])

HSP 1 Score: 226.098 bits (575), Expect = 1.150e-57
Identity = 268/1016 (26.38%), Postives = 452/1016 (44.49%), Query Frame = 3
Query: 3189 KSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSI--EKLPVELDFVEIDSQSGRLFT----NKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRI-----SKCTQKGAFSINQHTGIIHLINRLDRE---AIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMES--ISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYP-ALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN----EVLYYLQSVHPPDHPFVINPISGILSV--SNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWI----NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDG---TFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADK---SDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETPLIHNPTTVYL 6131
            ++T   V + V D NDN+P F T  Y  S+         + +V A+DPD G N  + YS+  E      D +EID  +G + T    N+L + V     FF+ A D GIP  +S + VY+ + P       F +  +   I+ED  I   +  L I   Q V +        +  + G F I Q TG I L  RLDRE   A  F V   +  D       + +   ++ + ++D+NDN P+F+  + +  I+ E   VGT L    A D+D G NGQV Y L +       +  F ID+ +G +   + +D+E  P + F + A DLG   +L S   V+V +T+IND  P F +E      V+++   G  V  +   D DT+    +V Y++   +P    F +  +     V    P+ +E   D+  + + A       Q  V+V +   +DN      + Y A+ LP+     + I  + A+      N    Y L  S   +  ++  +G+  L +   ++   I +  L++  +       + +   ++ ++ D   + F  + Y   + E   T  L L R+QA+ P   I+    Y      G    I   + +I L++           LDRE  + S   + V   D+    S    T V + + D NDN PVF    ++   PE+T+ G ++    V A  KD+ +  E  ++    NE  +F ++  +G ++ S V LD+E    F   ++  DG     ++ A + I + D ND    F+ D Y   I E A +   +  +  ++  + PN  I F IV+    + F+V+P  G++  + ++D E+ + Y LL+ A D       +P + + T TV + I D+NDN PVF        I E+ P+ + I+QL+ +D D         F ILS N++    ++P  G++ +A +  + ++  + L V   D      V      + V +E+   H PT + L
Sbjct: 2430 RTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTV---LSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKV-----DIVFTVDVDIKVLDLNDNKPVFETSSYDTIIM-EGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEV-YRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGR-FALGLVQSEWKVYVKRPLDREEQ-DIYFLNITATDGLFVTQAMVEVSVSDVNDNSPVCDQVAYTAL-LPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFFLDPESGE--LKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPV-FSSDHYNTCVYENTATKAL-LTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIILEQP----------LDRE--QQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLA--VFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEV-LDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSG-----IPAMSS-TATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDP-HGILRSAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEES--THKPTAIPL 3404          

HSP 2 Score: 168.703 bits (426), Expect = 2.903e-40
Identity = 254/1007 (25.22%), Postives = 442/1007 (43.89%), Query Frame = 3
Query: 3186 EKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIP--RLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPIL---QEVSFDLVVMAVDAERQDRYDQQSVKVHI--KHDNEDEIQVLTYGAIILPKSSFYR--EKIATLKAQSNSKNLNSRFMYLLKNSSYD-KIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLR--SDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGN-PISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIY----LDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIP-----EFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFT---STXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVT-VEVLINLINVNDETPL 6104
            +KS+   + I V+D NDNSP+F   SY  +I   +   T I +V A D D G NG V YS+     +     I+S +G ++    +D   +  +   I A D      +L S V + V ++        F   ++   + ED+ +   I  LE     +     V Y +      G F I++ +G I L   LD E   F+ LT+ A D         ++   + V  ++ N ++P F + A+   +  E++++GT +   TA D D G +G+++Y +       +  F ID  SG +     +D E    +   + A D G   L+S + V + + ++ND  P    E     +V +N     +V ++ A+DPD  +NE L Y  +   P + F IN  +G+++ ++  L   Q+    L V   D     +     V V +  ++DN+ +     Y  I LP+    +  E I    A    +  N+   Y + + + D K  I+  TG   ++S       S DI  + ++++ R    +  + H   +      P  L F +  Y F + E       ++  + ++ P N P+       FDI  G        N     D E G   VG I     LD E      ++VEV       +G+ +  T+VF+ + D NDN P F+   +     E+     +I    ++A D+D    L Y   + I      +F +D ++G++ T+   LDHEA    I  I V D  F    + A +I+ ++DAND    FT+  Y   + E+A + + + QVT  +     N  + + I +    ++F + P  GIIT   E D      ++L I  TD     +      + T  V +S+   +++ P F        + E+V I + +I LI++ +  +  L++E+   + + + T+NP +GVI+T   LDYE+T  + L +  T+     +   V I +++ ND  P+
Sbjct:  660 QKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVL---TDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVN-DYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSV-KENSRIGTSVLQVTARDEDSGRDGEIQYSIRDG--SGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAP-LTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVY-QIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTG--MVSSRKQFTAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRV--TEIVGVVSVQPANTPL------WFDIVGG--------NFDSAFDAEKG---VGTIVIAKPLDAEQRSIYNMSVEVT------DGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEIL--QIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAER-LDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPM------SATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVI-LISAISQST--LIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPV 1618          

HSP 3 Score: 157.918 bits (398), Expect = 4.063e-37
Identity = 248/1035 (23.96%), Postives = 446/1035 (43.09%), Query Frame = 3
Query: 3207 VVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILG-------FYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPAL--HSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQ-VLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQAL-YPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIR-CTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINE-IPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEW--GKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDL--LLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQN-----HNIMIKCSDQD--NLGPLSYDIM 6212
            V++ V+D ND+SP F+   Y  S+       + + +V A+D D G N  + Y+IE      +  +I+   G +   K  D+    +F+  I   D G P ++++  V + +  S  S   F  + +   ++E++ I   +  +    Q  + Y +      G F+IN ++G+I     LD E  + + L I AT+     G    A  N  + I+D NDN+P+F     +   LSE+  + +I+           A D D   N  + Y++  +  +    F +D+ +GA+     +D+E    ++F +   D G P L   S + V + +T++ND  P F  ++  E I+     +G  V +V A DPD+    E+ Y L      DH F+I+  SG+L++ N  L +  + L+V   D +    Y    V + +K   +  +    ++ +  + +++    K+A + A  N   LN    Y + N   +K  I   +G V  T+  P +    ++  L+ +E+ R    ++     + +NI D ++ +  F    Y+  + +    PG  ++++ A+     P  ++ Y + D Y         PN+             GN+ L +E        +E  V    K+G +    T V L I   N   PVF    +     E+      I   ++ A   +    +  I   +   +F++D  +G++     PLD+E  + +   I+ SD   T     + +    ND   N   F    Y+  + E + I T + QV   ++ +  N ++ + IV +       F ++   G+I T   +D+E   H  L + + D    SL    L      V + I D+NDN PVF+       + E  P    +  + ASDAD SD   L + ILS ND     ++  +GVI+ +          ++L VS +DGL   T +V I ++  N  +P     T  Y+ ++ +N       I ++ +D D    G +SY I+
Sbjct: 1402 VIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTG-NMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATN---MAGMASNATVN--IQIVDENDNAPVFLFSQYSGS-LSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKF--FTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFT-QAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLME-GSLDH-FLIDSNSGVLTIKNNNLSKDHYMLIVKVSDGKF---YSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGN--RLNEPLKYSILNPG-NKFKIKSTSG-VIQTTGVPFDREEQELYELV-VEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAV-QVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEIN---PNS-------------GNVIL-KEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPIL--SINATSPEGQGIIYIIIDGDPFKQFNIDFDTGVLKVVS-PLDYEVTSAYKLTIRASDA-LTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVL------VHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQST--YVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAII 2386          

HSP 4 Score: 156.377 bits (394), Expect = 1.248e-36
Identity = 268/1143 (23.45%), Postives = 489/1143 (42.78%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDK-----EKSTKVFVVIFVQDFNDNSPIFSTQSYF-FSINRHTKPNTTIGKVFAMDPDSGINGFVNYS--IEKLPVELDFVEIDSQ---SGRLFTNKLVDVVEQEFIFFIT--AEDHGIPRLNSSVKVYVKINPSPKSKQF-FDKQTFFQNISE--DMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGII---HLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPK-WNFIITAFDLGYPALH-SNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGIL----SVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSK-NLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPH-----NLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNP-----------ISDLE----YYIFDIY-CGISERIKLPNTMIRL---DKETGW------------------ISVGNIY----LDREIIEGSQITVEVVVIDRGKNGSR---IRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEYIWINEI-PEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYH------FHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAG-ILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPLIHNPTTVY---LPKINQNHN---IMIKCSDQDNLGP---LSYDIMTSSKDIQNIYVDRITGKVS 6269
            + +Y   +LAV++  K       S+   + + ++  N+++P     ++  FS+ +      T   V   D D G NG +     +   P++  F+  + +     ++   K +D     + + +T  A+D G P+  S++K     NP+  +    F+K+ +  +ISE     +   I KL  +    V Y++S       F IN  +G+I     +N + +E     V        ++ +G     VT   ++I D ND++P F+    + ++ +ES  VGT +   +A+D D G NG + Y + +  +     F I+ F+G +   + +D+E  P+ + FI+ A D G P  H S ++VT+ I N+ND  P F K +  + ++  +  +G  +  V A D D  E++ Y          F +NP SG+L    S++N  ++  +F L + A D E  +  D  S+ + + H    ++   ++       +    EK+  +KA++N K NL   F+     +         +  DV +    PV  N      ++ +++  +D+     + K++  I D +     N++ +       +P  +    L L  +     GNP           + D       +I D Y   I E   +   +I++   DK+ G                    S G +Y    LDRE    +  ++++   D+ ++G +   +   KVFL  +D ND  P F   ++     E+   G  I    ++ HD D  L   + Y  +N+    F +DK SG +  S   LD+E   ++   ++  D     + + +  ++      +   H  Y         + E + I T + QVT ++  +  +  I++ I    G   FS++ + G+IT    +D E    Y L + ATD     L+       T  V + + D+NDN P+         + E+ P +  +IQ+ A D D S  + L + I S N      +N  TG+I+T    LD E+   H L V+ TDG     + T+ V++ +++ ND  P    P  VY   LP+ ++      I    +   + GP   +SY I+  + D    ++D  TG VS
Sbjct:   74 KNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEP----TYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPID-VEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEV--------TNKEGDLKAQVT---ISIEDANDHTPEFQQPLYDAYV-NESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLP---FVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVA-CQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGE--NLADPMSINISVLH---GKVSSKSFSCRETRVAQKLAEKL-LIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGAN------ILKIKAYDADSGF---NGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRE--SKANYSLKIEARDKAESGQQLFSVVTLKVFL--DDVNDCSPAFIPSSYSVKVLEDLPVGTVI--AWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSK-ELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLY------STIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQF--PEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDD-GKFFIDPKTGMVS 1164          

HSP 5 Score: 152.525 bits (384), Expect = 2.151e-35
Identity = 256/1035 (24.73%), Postives = 450/1035 (43.48%), Query Frame = 3
Query: 3267 FFSINRH-------------TKPNTTIG----KVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE----FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPA---LHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILP---KSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDI-TFLISLESLRSDTLIKY-HSTKLVLNIGDPHNLN---------FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIR-------------LDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGK--NGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQV--TLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINL---INVNDETPLIHNPTTVYLPKINQNHNI 6158
            F+SINR               K +  +G    K+ A D DSG NG V ++I     +  F  ID ++G+L   K++  +++E    ++  IT  D G P+ +S   + + +  +  +   F + ++  NI E   I  +I ++E   + +     VTY +   TQ+  F+IN  TGI+++ ++LDRE+ A + L I A D + + G +  +V  L V + DVND SP F   + +  +L E   VGT++ +   +D D GL GQVRY L     +    F+ID  SGA+ L++ +DYE +  +N  + A D G P      S + V V   N N   P F  +  +   V++N  IGT+V +V A+D D+    E+ Y ++        F I+  SG+++ ++ + +E   S+ L V A D      Y   +++V+I+ ++ ++   LT   I  P   ++S     +  ++A+    + N +  Y                    +TS  P  F +I+I T LI+  S + D   +  H  ++ +  G P               +ND   Q PE      +KL        G PI     + FD       R + PN  I              +D +TG +S       ++   GS   + +  +D G+    S  R    ++     +     F    + F   E+    + + V +VQ  +  L    + +  N    F  +K  G +  +  PLD E  + +   ++V+DGT  +   + I + D ND    F+   Y   I E     T I Q+  T ++     ++ +   I S      F ++P  G++ T   +D+E  + +IL I   D  Q+  +   L      V+V++ D ND+ P F       S+ E   + S ++Q+ A D DK +   L++ I + N   +  + P+ G+I+     D     +  L++  TD G   ++   ++ +   ++ N     IH     Y  ++N+N +I
Sbjct:  565 FYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCF-NIDMETGQL---KVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQ--FAINSSTGIVYVADQLDRESKANYSLKIEARDKAES-GQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVL-EDLPVGTVIAWLETHDPDLGLGGQVRYSLVN---DYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYF-PDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGR-FSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLY--STIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYR-------------------ITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPE--KVYQIKLPERDRKKRGEPI--YRAFAFD-------RDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSS-----RKQFTAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANTPL--WFDIVGGNFDSAFDAEKGVGTIVIAK-PLDAEQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDS-ISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRD--QEFPYRRNL----ARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKD---YQAEVNENVDI 1536          

HSP 6 Score: 138.658 bits (348), Expect = 3.035e-31
Identity = 121/449 (26.95%), Postives = 207/449 (46.10%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDK--GQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCT---LVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKII-YSITKGDYRDRFAIE 1595
            F L+  +G + T  ++DRE +    +   + K T  G      +I + + D NDNPP+F  +     + EN A    ++   A D D     +  N K+     D   +  GV        ++ + +PLDRE +  Y +++   D+  GQ  L  +  V I V D NDN PVF    Y V + E   PG +V+ V+A+  D G N E+ Y  +      + +F I+ K+G I +++     +    C    LVVEA D G+P+LSA   V +++  +N   PKF  +       +A I    +    + ++  +D D  P   I  SI+ G+ +N F ++   G   +++  K +    +  Y++ V+A+D+G P+  +T  + I I+  N   PVF     +  +  N  + + I     TD D+  NG    +SI  G+  + F ++
Sbjct: 2926 FFLDPESGELKTLALLDRERIP---VYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPD-----IGINRKVVYSLAD---SAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQS-LSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNE--QGKFKINPKTGGISVSEVLDYEL----CKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVY-----SAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLG---LVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLD 3348          

HSP 7 Score: 128.257 bits (321), Expect = 3.870e-28
Identity = 159/619 (25.69%), Postives = 264/619 (42.65%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVL---IKFGFSYEF---FHKEG-------LFNLNKLTGVILTSNIIDRES--------LASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVV-KVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDC---TLVVEAFDHGSPSLSAYCYVTVHVI--RINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQI-------KAIHNINLQSYTITVRAIDNG-NPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHARIKSTCPTQFILDDSNLLHSFSHIFIEDFSKQLELSDSNRITEIEFKIIN 1901
            F +S Y+  + E  P+ T + QV    + +G + +     H +         FN++  TG I T   +D E+        +ASDL E F            T  + VR+ D NDN P+F        + E+      +++ +  D DT +     +Y I  GN   RFAL  V  +++    + V RPLDRE ++ Y L I+  D G    + ++EV   V D NDNSPV     YT  L E ++P  +++ KV A DAD G N  + Y    + +   +EF +D +SG ++    T   +++      +L+ +A D G      +C   +H+I   +N   P F  ++  +      +     T+  L  V   D D           IG N + +++L  + G V  +          + +      SY I+VRA D     S  +   + I +   N   PVF  R   VTV  + S  + +   FAT  D G N +I Y I  G+ + +F I   +G I++ + L +    +  L + A+D G  +L     +++N+   +    +      +  I +D+ +  S   +  ED        DS    +I F I+N
Sbjct: 2664 FETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAF--------SLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWK----VYVKRPLDREEQDIYFLNITATD-GLFVTQAMVEVS--VSDVNDNSPVCDQVAYTALLPE-DIPSNKIILKVSAKDADIGSNGYIRYSLYGSGN---SEFFLDPESGELK----TLALLDRERIPVYSLMAKATDGGG----RFCQSNIHLILEDVNDNPPVFSSDHYNTC-----VYENTATKALLTRVQAVDPD-----------IGINRKVVYSLADSAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDV-------DSQPNGQIHFSIVN 3232          

HSP 8 Score: 124.79 bits (312), Expect = 4.139e-27
Identity = 142/553 (25.68%), Postives = 261/553 (47.20%), Query Frame = 3
Query: 2931 DSPIFFEPFYTFVVKENSLSHTPLRKISLIQSQNID--------NYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVE-QEFIFFITAEDHGIPRLNSSVKVY---VKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIF-KNDALNNFILSESTKVGT--ILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAII 4526
            ++P+F +  Y   VKE   S  P   ++++ + + D        +YH  I   +  G++++    S + +      +R++     L +   D    T+  V + V D NDNSP+    +Y   +      N  I KV A D D G NG++ YS+        F  +D +SG L T  L+D      +     A D G     S++ +    V  NP   S   ++   +    ++ +    +    +I   + V Y ++  +  G FSI+  +GII L   LDRE  + + +++ ATD S   G    ++T + + ++D+NDN P+F + D L    + E T  GT  +  F T+ DI  G N ++ Y L  +G E    FKI+  +G + +++ +DYEL  ++  ++ A D G PAL +  +V + +T++ND  P+F+++     ++ ++  +G +V  + A+D D+  N  +++       D+ F ++P+ G++ V   + +E    + L+V AVD+         +V + I   +DN        Y A+I
Sbjct: 2770 NAPVFAQEVYRGNVKE---SDPPGEVVAVLSTWDRDTSDVNRQVSYH--ITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFF--LDPESGELKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLAD-SAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQS--PGQSLSSLTTVTITVLDINDNPPVFERRDYL--VTVPEDTSPGTQVLAVFATSKDI--GTNAEITY-LIRSGNEQ-GKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDV-YSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVI 3305          

HSP 9 Score: 121.324 bits (303), Expect = 5.102e-26
Identity = 100/337 (29.67%), Postives = 157/337 (46.59%), Query Frame = 3
Query:  630 LLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRI----NYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNV----HILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLIT 1616
            +L+VV PLD E    YKLTI   D      +  + V+++V D NDN P+F    Y   L+E++L G  V++V + DADS  N+ V YQ  +      + F ID  SG I LT     H     CTL V + D G PSLS+   V +++  +N   P F      +YV       +          +  V   D D    D +  SI+ GND   F ++   G +    H  ++++ ++++N+        ++ +G     +T  + IR+  AN+Y P F        V  N +  + + +  ATD D G  G+I Y+I     +DRF I+ +  +IT
Sbjct: 2089 VLKVVSPLDYEVTSAYKLTIRASD-ALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLI-LTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHF---------VTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNV--------SVSDG--LFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVIT 2404          

HSP 10 Score: 116.701 bits (291), Expect = 1.314e-24
Identity = 141/497 (28.37%), Postives = 227/497 (45.67%), Query Frame = 3
Query:  270 NLNKLTGVILTSNIIDRES-LASDLIEIFLYKK------TLEGQFLETISIKVRIIDENDNPPIF---YPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLEN--EFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVI--RINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDEN-IFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNP---SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETT 1706
            N++ L G + + +   RE+ +A  L E  L K        LE  FL+  SI       N   P F   +P+ +   + E++ +  +I    A D+D+  F     + I  GN D  F +        GQL  +V+ P+DRE  + Y L I++ D G P       + I VED NDNSPVF    Y+V + ES+  G E+++V A D D G N EV Y      SVL +  +F+I+  +G + +        ++ + +L +EA D        +  VT+ V    +N   P F I    S      + +G V    +A +   D D      +  S++  ND N  F +++  G + + +++        Q Y +TVRA D G P   S  + V++ +     N++ P F +     +V  N+ I + +    A D D+G +G+I YSI  G    RF+I+ +SG+IT    L    +    L + A D G+  L +T
Sbjct:  518 NISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSI-------NRQGPYFDKSFPSDVA--VKEDLPVGANILKIKAYDADSG-FNGKVLFTISDGNTDSCFNID----METGQL--KVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTY------SVLTDTQQFAINSSTGIVYVADQLDRE-SKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAF-IPSSYSVKVLEDLPVGTV----IAWLETHDPDLGLGGQVRYSLV--NDYNGRFEIDKASGAIRLSKELDYEKQ---QFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYST 981          

HSP 11 Score: 112.849 bits (281), Expect = 1.703e-23
Identity = 144/549 (26.23%), Postives = 247/549 (44.99%), Query Frame = 3
Query: 8355 IDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEI----INKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHS---ITVHF--------LFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNV-NSAILGQWFSLIVQACGTKIL---------------SSVSFCSKRETITLVIS--------------------DF---NLYSPQIRIS-ETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL---IVLPEVRDEDSIMASRNEPSYTLKSKT------SSKVQLF-------QSKTNFTLKILKRSTNES 9788
            ID + KL P      GE+   F INP++G +  A+ ++   K  Y+++V   +G   L+  + I++ D+ND+ P+  + +    +N++  + TS        V+ ++A+D D  +  N  I YS++S N  +P    F++N+ +G ++     L++ S  E    I+ ASD G P    S   +T+          LF    C+  I   ++ +P+        G   A  A++ D L   + + IISGN   +F +   +G +   +++ NS I    F+L + A   + L               SS SF  +   +   ++                    DF   N   P    S  + V++ E + VG+N+L++   D D+G  G V  TI     D      F  +  + QLKV+ P+D E    Y L +  +DLG P+KS   ++ I V D +DNSP FI  ++  ++ E   +   I+  E RD+D  + S  E +Y++ + T      SS   ++       +SK N++LKI  R   ES
Sbjct:  255 IDVEYKLSP------GEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGD--LKAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTS--------VLTVSASDKD--KGENGYITYSIASLN-LLP----FVINQFTGVISTTE-ELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVI---SYDFPVG-------GHITAVSAIDIDELE-LVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSC----FNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKD--LGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAES 762          

HSP 12 Score: 111.694 bits (278), Expect = 4.243e-23
Identity = 261/1145 (22.79%), Postives = 478/1145 (41.75%), Query Frame = 3
Query: 3141 KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSG--INGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFK---LEIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNS-PIFKNDALNNFILSESTKVGTILGFYTA-------NDIDDG-LNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRF---------NKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISG-ILSVSNPILQEVS-FDLVVMAVDAERQDRYDQQSVKVHIK-HDNEDEIQVLTYGAI--ILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLV---LNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISD-LEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSG-IVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGK-HLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSP--NDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLI--NVNDETPLIHNPTTVYLPKINQ----NHNI-MIKCSDQD--NLGPLSYDIMTSSKDIQNIYVDRITG--------KVSFNPGLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYT 6398
            +Q S   ++V   D        V I V D NDN P FS  +Y  +I+    P+T I ++ A D D    ++  V+ SI+   + +    ID  +G L+T + +D   Q+  I  I   D   P   +  +V V +  +     +F    +  ++ E   +   + +   L+ D  +   + Y I        F I    GII +    D   +   VL+I  TD    +GS  ++ T +    + ++DNS P F +      + +E+  +GT +   +A        ++ DG +NG               +F I+ +SG +   + +DYE    +  II A ++    + SN +V + I + ND  P F         ++ + +  IV+ ++     V R    D + N +L Y          F ++  +G I +++N   + ++ F   V   D+       +  V+V+I+  D  D   V T      IL   ++   ++  + A      +     Y L   S D  +I+  +G   LT    ++ N++     + +  +      K++ST +V   +       L+F ++ Y   I E  T    K+  + A+  GN +++ L+Y I +           P    ++   +G I    +  DRE  E  ++ VE     R  +  R+    V +NIED NDN PVF    +      +   G  IY  T    DK  +  + Y+  ++   F ++  SG ++       D   + Y +  +    G  + + ++ + I   N     F    Y   ++E   ++T I    L  + T+P       I+ +      F+++ D G++     +DYE  + Y L I A+D             VT  +LV+  D+NDN P+FD      ++ E   I + ++Q+++ DAD  +  ++ ++I+    N      ++  +G+I TA +LD+E  +   L V   D G   ++ EVL+++   +VND  P+ +    +Y   +++     H +  ++ SD D  +   L Y I+ S  D  +  +D  +G        K    P  LY  S+NVS+  SD +  +   V + VL  N  S  ++
Sbjct: 1274 EQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDS--ISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTD----QGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEV-NENVDIGTSVILISAISQSTLIYEVKDGDING---------------IFTINPYSGVITTQKALDYERTSSYQLIIQATNMA--GMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVR-SLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSG--VLT----IKNNNLSKDHYMLIVKVSDG---KFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNI-TKVAIVNAV--GNRLNEPLKYSILN-----------PGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEA---SRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPI----LSINATSPEGQGIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDA-----LTGARAEVTVDLLVN--DVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQ--LIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSIL-SGNDRTSFLMDSKSGVITLSNHRKQRMEP--LY--SLNVSV--SDGLFTSTAQVHIRVLGANLYSPAFS 2347          

HSP 13 Score: 111.694 bits (278), Expect = 4.424e-23
Identity = 139/520 (26.73%), Postives = 217/520 (41.73%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIV-------------GQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDN--PPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFAL---SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRK----PLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTI-TVRAIDNGNPSKQTTVDMLIRINKANIYFP---VFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPL 1631
            F+ S Y+ +V E+ P+ T++             GQV       Y      G F ++K +G I  S  +D E      + +    K           ++V ++D N+N   P F    +   + EN  + T +    A D D+   G    Y I  G+   RF++   SGV         +     LDRET   Y LT+   D+G  PL   +EV I VED NDN+P+ S   Y   + E++     V+++ A D DS  N+++ Y+   T    +N F+I+ K+G I  T        Q +  L V   D G     +  +V V V+  N   P+F        +K   I++ +  RK    P+      D D+ P   I+ SI+ GND+  F ++   G V   +Q  A       SY I T++A+DNG P K +T  + I   K     P    F   + + TV  +  +   +            N  + + I  G++   F  EK  G I + KPL
Sbjct:  786 FIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYN-----GRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDG-EIQYSIRDGSGLGRFSIDDESGV---------ITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRI--TSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQF-------PEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTA------GSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQP----ANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPL 1271          

HSP 14 Score: 109.768 bits (273), Expect = 1.528e-22
Identity = 129/512 (25.20%), Postives = 228/512 (44.53%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIK---FG----FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFL-ETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNE-DDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP---PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHI----NQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQD--PRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNR-YQSVTVYRN-ASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLK 1625
            F+   Y+  + E+  I T + QV  +    G     +Y        F +N  TG++  ++ +DRES A+  ++I    K   GQ L   +++KV + D ND  P F P+    +++E++ + T I+     D D    G+    +    N+ + RF +       +    +R+ + LD E ++ Y LT+  +DKG+P        +EVE++  + N ++P F        + E++  G  V++V A D DSG + E++Y  +    +    FSID +SG I     T+  I      G   L V A D G   L +   V + V  +N   P        +++   Y  + + + K ++++  Q +D D    + +   I  GN +N FA+    G   I    + +       + + V   D G   KQ+T+ +++++   N   P F  + YQ     R+       I   FA D D G N +I YSI  G+   +F I+  +G+++  K
Sbjct:  681 FIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPD---LGLGGQVRYSLVNDYNGRFEID------KASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGL--GRFSIDDESGVI-----TAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPL-------TSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTG--LITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRK 1167          

HSP 15 Score: 105.916 bits (263), Expect = 2.420e-21
Identity = 133/541 (24.58%), Postives = 227/541 (41.96%), Query Frame = 3
Query:  165 YNFRVSENQPINTIVGQVLIKFGFSYEFFHKEG-----LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE---GQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANF-------FATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSD 1739
            YNF V E+  +  IVG V ++   +  +F   G      F+  K  G I+ +  +D E  +       +Y  ++E   G  +    + ++++D NDN P F     +  I E++   T+I    ATD D        +Y + S    D  ++    +     +L    R LD E ++K+ L I V D+  P  + +  V + VED ND+SP F+   Y   + ES   G  V++V A D D G N E+ Y  +   +   N F I+   G I + +        G   L ++  D GSP +SA   V + V   ++  PKF   +Y    ++   ++IG       AI          +  +   +  G+   IF +    G   ++   KA+      SY + ++A +    +   TV+  I+I   N   PVF     S ++   A INS + +         ATD D+  N  ++Y I +   +  F ++  +G I  +  L    +      +  RD+G   L     +++NI  +D
Sbjct: 1217 YNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRS-------IYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKH---KLSYTVHSSI--DSISMRKFRIDPSTGVLYTAER-LDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNT--GNMFKIEPVLGIITICKEPDM-TTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNEN--VDIGTSVILISAI---------SQSTLIYEVKDGDINGIFTINPYSG---VITTQKALDYERTSSYQLIIQATNMAGMASNATVN--IQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTD 1725          

HSP 16 Score: 102.449 bits (254), Expect = 2.676e-20
Identity = 130/504 (25.79%), Postives = 224/504 (44.44%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADG---SGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD--SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGIN-VLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNE---TVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRV-ANIAVNHD-NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQA--CGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITS-TDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +P+DRE  +   +++   DG   +  ++E     + V D+NDNSP+     +   + E+      I+ +   DAD  S  + +++SL G  N+ F ++P++G +     +DRE    Y +    +DG     +  + + + D NDN P  S +  N     NT+  A     +  + A D D     N ++ YSL+          +F +       +   + L    D E   + ++ + A+D+       S+T   + +    +   +     Y + V   +  G++V A  A + D     EIT+ I SGN    F I  K G IS S  ++   L + F L+V+A   GT  LS+V+      T+ + ++D N   P+      +  ISE   VG +++ +   D D+   G +  +I+    D+ F++ P         +KV   LD E    YSL + A D G P  S T+ V I + D +DNSP F   N+ A ++E
Sbjct: 2838 RPLDREEQDIYFLNITATDGLFVTQAMVE-----VSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGY-IRYSLYGSGNSEFFLDPESGELKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVYENTATKA----LLTRVQAVDPD--IGINRKVVYSLADS-----AGGVFSI-----DSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYE-LCKRFYLVVEAKDGGTPALSAVA------TVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLG-----LVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQE 3307          

HSP 17 Score: 99.7525 bits (247), Expect = 1.688e-19
Identity = 129/518 (24.90%), Postives = 233/518 (44.98%), Query Frame = 3
Query: 2892 SNTEIIIEFHPIFD-SPIFFEPFYTFVVKENSLSHTPLRKISLIQSQNID---------NYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINR--HTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQF---FDKQTFFQNISEDMKITEKIFKLEIDHQQM-VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTAT---GMESISV--FKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSV 4373
            S  E+ IE   + D +P+  EP Y  VV ENS      + +S+IQ Q  D          Y ++      +   +I +        +LD E++ ++   V   +     K + ++VV+ V D NDN P F  + Y   +      K    I + FA D D G N  ++YSI     +  F  ID ++G + + K       + I  I A D+G P+ +S+ +++++    P        FD+  +   + E  ++TE +  + +      + + I       AF   +  G I +   LD E  + + +++  TD ++      +AVT +++ ++D NDN P F      +  +SE     T +    A D D+      +++L+ T    ++SIS+  F+ID  +G LY  + +D+E + K    I   D  +P   +   V V + + ND  P F      E  V ++ A+G+ V +V A D D     E++Y +++ +  +  F I P+ GI+++
Sbjct:  980 STIEVYIEVEDVNDNAPLTSEPIYYPVVMENS-----PKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFF-IDPKTGMVSSRKQFTAGSYD-ILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTN------VAVTQVFIKVLDNNDNGPEFSQPNY-DVTISEDVLPDTEILQIEATDRDE------KHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTN-PLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNM-FKIEPVLGIITI 1475          

HSP 18 Score: 97.8265 bits (242), Expect = 6.390e-19
Identity = 139/534 (26.03%), Postives = 230/534 (43.07%), Query Frame = 3
Query: 8154 PVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQGEENNA---FSINPQNGSVFLAQTVDRELKSKYEMKV-AVSDGINVL--EIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQ--PPLFH---SITVHFLFITAECELRILKSTFQYP--------IAVLYTSQEGSRVANI-AVNHD-NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIIT----STDDRFSLVP----FPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE-------LDQLIVLP 9644
            P+D EV +  ++++  +D   G        + V D+NDN PIF    +   +SE +LIG+ ++ +  IDADS+   +  + +  +  N+   F I+  +G +  A+ +D EL     +KV ++  G   L  E+ + I ++D NDN P +  ++I +++V   SE A    FV  + A+DAD S  +  ++ YS+ S N R    + FL++  SG                   VI  ++ R Q   PL+    S++      TA+  +R+L +    P          V      G++V ++ A + D   YG+I++ II+      F I S    I+T R      L    S+ V+A         +FC    T+ +++ D N  +PQ    E   S+   +  G  + QV  IDPD G    +  ++ +    S  D   + P      T GN  QLK             S  + A D G P K     V I VL  +   P F    +  ++ E       +D L +LP
Sbjct: 2095 PLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDN-PPVFNQLIYESYV---SELAPRGHFVTCVQASDADSSDFD--RLEYSILSGNDR----TSFLMDSKSG-------------------VITLSNHRKQRMEPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSIFVRALDGG--GRTTFC----TVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLK---------NTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILP 2584          

HSP 19 Score: 93.9745 bits (232), Expect = 1.021e-17
Identity = 124/469 (26.44%), Postives = 200/469 (42.64%), Query Frame = 3
Query:  351 FLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQY------RGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP--SLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINL-QSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            FL     +G F+    ++V + D NDN P+         + E+I     I   +A D+D      SN Y         R++L G G          G+L  + +  LDRE    Y L     D G    +    + +I+ED NDN PVFS   Y   + E+      + +V A D D G+N++V Y    +   +   FSID  SG I L QP      Q    + V A D  SP  SLS+   VT+ V+ IN   P F R +Y+         E      + LA+     D     ++  + I  GN++  F +    G +     +  + +  L + + + V A D G P+      + I +   N   P F     S  +  +A +   +    A D+D+  NG+I +SI  GD  + F ++   GL+ + K L   ++    L + A D+GI ++ +T  ++++I
Sbjct: 2849 FLNITATDGLFVTQAMVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIG----SNGYI--------RYSLYGSGNSEFFLDPESGEL--KTLALLDRERIPVYSLMAKATDGGGRFCQS--NIHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGV---FSIDSSSGIIILEQPLDRE-QQSSYNISVRATDQ-SPGQSLSSLTTVTITVLDINDNPPVFERRDYL-----VTVPEDTSPGTQVLAVFATSKDIGTNAEITYL-IRSGNEQGKFKINPKTGGI----SVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDI 3286          

HSP 20 Score: 93.5893 bits (231), Expect = 1.248e-17
Identity = 79/282 (28.01%), Postives = 127/282 (45.04%), Query Frame = 3
Query:  252 HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFP 1097
            +++G F +N  TG I  S ++D E L      +   K           ++ + + D NDNPP F  +     I E+  +   + L  A D D+   G   ++ I +G+ D+ F +  V        L++V + LDRE    Y L +   D G P +     V I + D NDNSPVF+P+ YT  + E+   G  ++++  +D DS  N    + F       E EF +D   G +R +     H    +  L V+A D G P   ++ Y+ V VI  ++  P
Sbjct: 3129 NEQGKFKINPKTGGISVSEVLDYE-LCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNG-QIHFSIVNGDRDNEFTVDPV------LGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGP-PFSFSILSGNEEEEFVLD-PHGILR-SAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKP 3399          

HSP 21 Score: 92.4337 bits (228), Expect = 3.135e-17
Identity = 158/647 (24.42%), Postives = 274/647 (42.35%), Query Frame = 3
Query: 7776 YNGTIYQTFFSINRESGQISLNEPLP-QLVSVYTLRIRA---SLKMVNSKIL---WYKDTDVSISVYDN------VCKCTNHGYFTGSVEENSDSEIS----VSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLF-PLKFSLQGE-ENNAFSINPQNGSVFLAQTVDRELKSKYEMKV---AVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAV-NHDNLYGEITFFIISG-----NGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFP-RKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELD 9626
            YN T Y   F I+  SG I     L  +LV   TL++R+       ++S++L   +  D + +  V++       V +    G+F   V+  SD++ S    +  +ILS  GN + SF +  K     L          + H+    E   +L +SV     S G+  S   + I+V+  N  SP F+ + ++  V EN   G+ +I +   D D   +  + +++  +   + F I+  NG V   + +DRE   + ++ +   A+  G       + + V D NDN PQ        +     ++   G++ V  + A D DD    NS+I YSL SE   + V  L  ++ D+G +  K    N +  N  +   + A D G P     I V+   +  E  L     + QY   +   +  GS V  + +    N++    F  ++G     N    F I  + G I   + ++       F   V A  T  L  V      + + + + D N   P    S     I E + VG+ L QV  ID D G  G V  ++ + +     +  F  + N+  +  +  LD+E    ++ +++A DLG     S T++V ++V D +DN+P F    +  +++E D
Sbjct: 2181 YNSTDY---FHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQA-SDADSSDFDRLEYSILS--GNDRTSFLMDSKSGVITL----------SNHRKQRMEPLYSLNVSV-----SDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLID-SNGQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASV---RADVGRGHL-VTQVQAIDPDDGA--NSRITYSLYSE-ASVSVADLLEIDPDNGWMVTKG-NFNQLK-NTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQS-QYSFTIAEDTAIGSTVDTLRILPSQNVW----FSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRET-SPAFHFKVAA--TIPLDKVDIVFTVD-VDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESD 2787          

HSP 22 Score: 92.4337 bits (228), Expect = 3.135e-17
Identity = 117/500 (23.40%), Postives = 212/500 (42.40%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFGFSYEFF---------HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYAS-DAD-SGVNQEVEYQF-------KKTRSVLENEFSI------DRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEI---GKVTRKPLAIVHCQDDDQDPRDLIAVSIIG-GNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSIT 1562
            F  SQY+F ++E+  I + V  + I    +  F          +K G+F + + TG I     +DRE+  +   ++       +   + T+ + ++++D NDN P+F  +  +  I+E + + T ++   A D D    G    Y + S ++ ++  +    +       +  ++ LD ET   +  ++   D G+   L     V + V D NDN+PVF+   Y   + ES+ PG EVV V ++ D D S VN++V Y         +    ++++E+ +      DR+   I        +I   D   V +A             V V V  +N   P          D+ AY  +      + K +  V  +D D      I  S+ G GN E  F L+   G    L+ +  +    +  Y++  +A D G    Q+ + +++     N   PVF + + +  VY N +  + +    A D D G+N K++YS+ 
Sbjct: 2558 FTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANG-QVTYSLHSDSQPEK-VMEAFNID-SNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPG-EVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYF-----LNITATDGLFVTQAM------------VEVSVSDVNDNSP--------VCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSE--FFLDPESGE---LKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILE--DVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLA 3021          

HSP 23 Score: 88.1965 bits (217), Expect = 4.966e-16
Identity = 147/547 (26.87%), Postives = 239/547 (43.69%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINT--IVGQVLIKFGFSYEFFHKE--GLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIF----YPNKL-ERRIIENIALLTDIS--LTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPL--KGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLE---NEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQS-YTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIK--LEIIARDAGINSLETTGYLDLNIL 1730
            KF+   Y   V+EN  I T  I+   + +    YE    +  G+F +N  +GVI T   +D E  +S   ++ +    + G      ++ ++I+DENDN P+F    Y   L E   I +I    D S  +  ATD+D++   +     +ES  +      S  G        +R +  LD ET   +   + V D G P L  +  +EV I V D NDN PVF+ + +   L      G EV+KV A+D DS V  E+ Y      S++E   + F ID  SG + +    + ++++    L+V+  D    S S    VT+ V         F  ++  ++       I KV     AIV+   +  +  + +  SI+  N  N F ++ T G   +++      +   Q  Y + V A    +  +   V + + I   N   PVF        V  +A   + I    A D D G NG++ Y + + DY   F I  +SG + +LK  +   L  I+  + I+A+D G  SL T+  L + I+
Sbjct: 1520 KFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSS--YQLIIQATNMAG-MASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGA-------IRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTY------SLMEGSLDHFLIDSNSGVLTI---KNNNLSKDHYMLIVKVSDGKFYSTS---MVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKV-----AIVNAVGNRLN--EPLKYSIL--NPGNKFKIKSTSG---VIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTY-VLQDDY-GHFEINPNSGNV-ILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIV 2029          

HSP 24 Score: 87.4261 bits (215), Expect = 9.150e-16
Identity = 109/454 (24.01%), Postives = 184/454 (40.53%), Query Frame = 3
Query:  372 EGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSV-LENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF---RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGG-----NDENIFALERTHGNVHILRQIKAIHNINLQ---SYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDR----FAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +G F  T  + +R++  N   P F  +     + EN+A  T +    ATD D   +G   +Y I +    DRF +        GQ++      LDRE   +  ++I V             V +IV D NDN+P F   +Y   +      G  V +V A D D G N  + Y      SV + +   ID  +G + +T+     +     +  V+A D G P   +   V +HV+   +F P F   + ++  + D A    IG  T   L I+  Q+        +  S + G     N   IF +E+  G + + +++    +       + TI +  +D        TVD+ I++   N   PVF        +     + + +    A D+D G NG++ YS+      ++    F I+ ++G I+ LK L           ++A D G
Sbjct: 2323 DGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYG-QISYAIINDFAKDRFLIDS-----NGQVI--TTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWM-VTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTA----IGS-TVDTLRILPSQN--------VWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVD-----IVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLG 2749          

HSP 25 Score: 86.2705 bits (212), Expect = 2.241e-15
Identity = 106/462 (22.94%), Postives = 199/462 (43.07%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEI------FLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIE--IGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNP--SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITL 1619
            F ++  TGV+ T+  +D E+    ++ I      F Y++ L         + V + D ND+ P F     E  + E+ AL + +    A D D  E      Y IE+GN  + F +  V        ++ + +  D  T  ++ L+I V D+G PP+     V I V   +++ P F    Y   +NE+   G  V+ + A    + +     Y+ K     +   F+I+  SG I  TQ    +       L+++A +     +++   V + ++  N   P F  + Y GS  +AA I   +  +   PL ++   D D +   L+   I+    +  F ++ + G +   R I  + +  +  +   V   D+G+P  + ++ V++ I +   N   PVF        +     +   +    ATD D+ +  ++ YS+ +G   D F I+ +SG++T+
Sbjct: 1359 FRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLA-------RVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGE-NAELIYTIEAGNTGNMFKIEPV------LGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLI-----YEVKDGD--INGIFTINPYSGVI-TTQKALDYERTSSYQLIIQATNMA--GMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPL-VIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAI---RTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSL-DHFLIDSNSGVLTI 1791          

HSP 26 Score: 83.5741 bits (205), Expect = 1.216e-14
Identity = 149/631 (23.61%), Postives = 268/631 (42.47%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLPQLVS-VYTLRIRASLKMVNSKILWYKDTDVSI-SVYDNVCKCTNHGYFTGSVEENS-DSEISVSNNI-LSCNGNSKVSFTLH----PKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGII--KVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENN-----AFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDV---IITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGL-AGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLI 9635
            F I +E+G I L++ L +  S  +  ++ A++ +    I++  D D+ +  + DN        Y T  +E     ++++    I +    N +V+++LH    P+   +    ++ T  I T  K +D E       SV+ +D       S   ++  +V D+NDN+P+F    + G V E+   G  +  +   D D+     + S      N     A  +      V++ + +DRE +  Y + +  +DG+ V +  + ++V+D NDN P +  ++     +    E    N  ++ ++A DAD    +N  IRYSL          S F L+ +SG L  K +AL    D E + V   +  A+D G    F    +H +         +  S   Y   V   +   + +  + AV+ D        + ++ +    FSI S +G I   + ++       +++ V+A       S+S  +   T+T+ + D N   P     +  V++ E    G+ +L V     D G  A I  L    +   +F + P  T G    + V   LDYE+  ++ L + A D G P  S  + V I + D +DN P F    + A + E D L+
Sbjct: 2606 FVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTL-KDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVSVSDVNDNSP-VCDQVAYTALL---PEDIPSNKIILKVSAKDAD--IGSNGYIRYSLYGSG-----NSEFFLDPESGEL--KTLAL---LDRERIPVYSLMAKATDGGG--RFCQSNIHLILEDVNDNPPVFSSD-HYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIILEQPLDREQQSS-YNISVRATDQSPGQSLSSLT---TVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINP-KTGG----ISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISE-DALV 3206          

HSP 27 Score: 83.5741 bits (205), Expect = 1.438e-14
Identity = 183/807 (22.68%), Postives = 329/807 (40.77%), Query Frame = 3
Query: 7791 YQTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYF-----TGSVEENS---DSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL-QGEENNAFSINPQNGSVFL-AQTVDRELKSKYEMKVAVSDGINVLE---IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIA--VNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLT-IITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL-IVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILDVFGASQENYP-KRLPLGRYSRLMIYLILPKIPHSQIHCLFKE-INSGNEIKFVPVIAQEGLVY--------NLLRISPK----VSKPFISVDRTTGYISTQRIIKIANILISAS 10109
            Y   F I++ SG I L++ L  +    Y L +RA  K    + +             +V +  +  YF      GSV+ENS    S + V+        + ++ +++           + E+  I TA   +DRE   +  ++V   D G   +  +    I+V D+NDN+P+ +   +   V EN+     +I I   D DS     L + +  G   N F+IN + G +   ++ +DRE ++++ ++V V+DG    +   I +++ V D NDN+PQ  +    K + I   E            A   D  +  N++I YS+   N        F ++  +G ++ +        D  T    I A D G+P    +  +H  +I        +  TF  P    +T  E  RV  I   V+       + F I+ GN  S F      G I  ++ +++     +   +    GT +  +  F        + + D N   P+       V+ISE +   + +LQ++  D D       KL+  + S+ D  S+  F  + ++  L     LD+E Q ++ L ++  D  FP +   + V++ V D +D+SPYF +  + AS+ E   L   + +V   D       E  YT+++  +  +   +      + I K     ++   +L +    Q + P     + R S  M     PK  H        E ++ G  +  +  I+Q  L+Y         +  I+P      ++  +  +RT+ Y   Q II+  N+   AS
Sbjct:  829 YNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDK---GRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVI-TAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPE----KVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGND----DGKFFIDPKTGMVSSRKQFTAGSYDILT----IKAVDNGRPQKSSTARLHIEWIKKP-PPSPIPLTFDEPF-YNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNVAVTQVF--------IKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKH----KLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGI-ITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSY---QLIIQATNMAGMAS 1601          

HSP 28 Score: 78.9518 bits (193), Expect = 3.291e-13
Identity = 128/544 (23.53%), Postives = 229/544 (42.10%), Query Frame = 3
Query: 8061 NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGE-------ENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD----GINVLEIGML-ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSE-NQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP-IAVLYTSQEGSRVAN-----IAVNHDNLY-GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQ 9629
            N KV FT+    +      + ET +++    P+DRE  +   +++ I D       S   + I V D NDNSP+F  + +   + E++ IG+ II +   D D           GE       +   F+IN   G V++A  +DRE K+ Y +K+   D    G  +  +  L + + D ND  P      I  ++ +   E       +  +   D D       Q+RYSL ++ N R      F +++ SG++ +    L++    +  ++ + A D+G+P    S++          ++     T  +P  AV+ + +E SR+        A + D+   GEI + I  G+G   FSI  ++G I+ +  ++   +G ++ L V A    ++   S       + + + D N  +P          + E      +++Q+   DPD+     +   I +     F  +   T            LD E Q ++ L +   D G   K  T  V+++VLDE+DN P F  + +   L E D+
Sbjct:  608 NGKVLFTISDGNTDSCFNIDMETGQLKVL-MPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKD-------LGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPA----FIPSSYSVKVLEDLPVGTVIAWLETHDPD--LGLGGQVRYSLVNDYNGR------FEIDKASGAIRLSK-ELDY-EKQQFYNLTVRAKDKGRP---VSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYW-LTVYATDRGVVPLYSTIE----VYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKT---GLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDR 1118          

HSP 29 Score: 73.1738 bits (178), Expect = 1.785e-11
Identity = 114/463 (24.62%), Postives = 197/463 (42.55%), Query Frame = 3
Query:  351 FLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDE------FGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE---FSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSK-QTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYR--DRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLET 1703
             L  K  +G+F  T  + + + +  D+   F  +     I EN   +T +++  A  +  +E          N +KI+S         SGV +Q  G        P DRE +E Y+L +    +        + V + +ED NDNSPVF    Y   +     PG  + +V A D D G N EV Y       VL+++   F I+  SG++ L +  +  ++  +  + + A D G PSLS    + + ++  N   P F   +      A+  E  ++    L+I     + Q     I   II G+    F ++   G   +L+ +  +      +Y +T+RA D    ++ + TVD+L+  N  N   P+F     + T+   + I + +    + D D+  N  + Y I +  Y   D F I+  SGLI   + L    +    L++ + D+G  SL +
Sbjct: 1802 MLIVKVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKS--------TSGV-IQTTGV-------PFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTY-------VLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIV--NKAMPVFDKPFY----TASVNEDIRMNTPILSINATSPEGQG----IIYIIIDGDPFKQFNIDFDTG---VLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLV--NDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSS 2226          

HSP 30 Score: 72.0182 bits (175), Expect = 3.987e-11
Identity = 131/561 (23.35%), Postives = 222/561 (39.57%), Query Frame = 3
Query:  144 VKFLSSQYNFRVSENQPINTIVGQVLIK---FGFSYEFFHKEGL--FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETK-EKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE---FSIDRKSGSIRLTQP-TSCHINQGDCTLVVEAFD---------------HGSPSLSAY-CYVTVHVIRI-----------------NSFFPKFRINYVGST-DKAAYIEIGKVTRKPLAI----VHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARD 1679
            ++F    Y+  +SE  P   +V  V +        Y+    E    F +N  +G+I+T+  ++        +E+   +  L+ Q   TISI+    D ND+ P F     +  + E++ + T +   +A+D D  E G    Y I S N      L  V  Q+ G  ++     LD E+  E Y+  +   D G P   +  + V I + + NDNSP+F        ++     G  +  V A D D       E +  K + +  NE   F ++  SG ++L +  T+  I  G+  L + A D               HG  S  ++ C  T    ++                 + F   + IN  G   DK+   ++      P+      +   D D      +  +I  GN ++ F ++   G + +L  +   H      Y + +   D GNP K +   + I +  AN   PVF     SV +  ++ I + I    A D D G NG++ YS+       +FAI   +G++ +   L         L+I ARD
Sbjct:  224 IRFEKEVYDVSISEFSPPGVVVAIVKLSPEPIDVEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLKAQV--TISIE----DANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYI-TYSIASLN-----LLPFVINQFTG--VISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDID-------ELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHT---DLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTD--TQQFAINSSTGIVYVADQLDRESKANYSLKIEARD 758          

HSP 31 Score: 72.0182 bits (175), Expect = 4.192e-11
Identity = 86/338 (25.44%), Postives = 145/338 (42.90%), Query Frame = 3
Query:  759 NDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFD-----HGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQD-DDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQS----YTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQ------SVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLN 1724
            ND  P+FSP+ Y+V + ES      V +V A+DAD G N E  Y FK    +    FS+   SG I L+   + +  +    L + A D     +G+  +S+   + VH+ RIN   P   +          ++          A+V   D DD    ++ +VSI+ G+  + F L +  G      +IK    I+ +S    Y +T++A D G+P K + +  +   N      P+   R++      S++ +    +   I       +D      + Y ++ G+    F I   SGLI   +PL  VK +  KLE+  ++  + +  T    D N
Sbjct:    2 NDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDL----FSVHPTSGVISLSGRLN-YDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHV--------VTHVPFSLEKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAK-EGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPI---RFEKEVYDVSISEFSPPGVVVAIVKLSPEPID------VEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLKAQVTISIEDAN 316          

HSP 32 Score: 72.0182 bits (175), Expect = 4.445e-11
Identity = 100/399 (25.06%), Postives = 159/399 (39.85%), Query Frame = 3
Query:  630 LLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY-IEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQ--SYTITVRAIDNGNPS--------------------------KQTTVDMLIRINKANIYF----------------PVFRNRYQS-VTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            L+   RPL+   KE YKL ++ ++     LK   +V I +ED ND++P F    Y   +NES   G  V+ V ASD D G N  + Y       +    F I++ +G I  T+      +      +V A D GSP    +   VT+ +  +N   P F    V      +Y   +G       AI      D D  +L+   II GN+   F L    G   +L+  K++ N  ++  ++ + + A D  N +                           Q   + L+   KAN                   P F   + S V V  +  + + I    A D D+G NGK++++I+ G+    F I+ ++G + +L P+     D   L I   D G
Sbjct:  278 LIVTARPLNTVKKEVYKLEVTNKEGD---LKA--QVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLL---PFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFE--KVACQGVISYDFPVGGHITAVSAI------DIDELELVKYKIISGNELGFFYLNPDSG---VLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLG 657          

HSP 33 Score: 71.633 bits (174), Expect = 5.810e-11
Identity = 141/534 (26.40%), Postives = 231/534 (43.26%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIV-----GQVLIKFG---------FSYEFFHKEG--LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLET-ISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLE--NEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVH---CQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRI-NKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDA 1682
            FL SQY+  +SE  PIN+IV       ++I+             Y+         F ++  TG I T   +D E++A     + +          E+ + + + + D NDNPP+F     E  ++    +  ++   +ATD D+ E      Y +  G+ D     S  GV     L ++     +  +K+ Y L + V D           V I+V++  D+   F+ S Y+  ++E+N    +V  V A    + +N+ ++Y      S+L   N+F I   SG I+ T        Q    LVVEA         A   V V++  IN   P F    VG      Y    +V  +P  +++     D D+ P     V+ +  +D   F +    GNV IL++       N++ Y +T+ A D G PS  T+V++ I I NKA    PVF   + + +V  +  +N+ I +  AT  +      IIY I  GD   +F I+ D+G++ ++ PL +      KL I A DA
Sbjct: 1619 FLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDS-EVPPELTYSLMEGSLDHFLIDSNSGV-----LTIKN----NNLSKDHYMLIVKVSDG---KFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNA--VGNRLNEPLKY------SILNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVF----VG----LPYYAAVQVDAEPGTLIYQVTAIDKDKGPNG--EVTYVLQDDYGHFEINPNSGNV-ILKEAFNSDLSNIE-YGVTILAKDGGKPSLSTSVELPITIVNKA---MPVFDKPFYTASVNEDIRMNTPILSINATSPEGQ---GIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDA 2113          

HSP 34 Score: 68.5514 bits (166), Expect = 4.190e-10
Identity = 138/601 (22.96%), Postives = 238/601 (39.60%), Query Frame = 3
Query: 8070 VSFTLHPKWSQDYLYYNAETNEIRTAH--KPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSK-YEMKVAVSDGINVL----EIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQ---PPLFHSITV----------------------HFLFITAECELRI------------------LKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLY-GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVL--DEDDNSPYFISRNF-VASLRELDQLIVLPEVRDEDSIMASRNEPSYTL 9701
            V + L P     Y   N  +  I TA     V +EVY  LE++    D    +       I + D ND++P F    +  +V+E+  +G+ ++ +   D D  +   + +S+       F IN   G +   + +D E   + Y   V  SD  +      E+ + I + + NDN P   K         +     H    +  ++A D D+ +     ++Y + S N+       F LN DSG L +K    N    N    + ITA+D G+    P+  +I+V                        L I A+   ++                     +F   +AV      G+ +  I A + D+ + G++ F I  GN  S F+I  + GQ+     ++      +  ++ +   G    SS         +T+ + D N  SP       +V+I E   +G+ ++QV+  D D G  G V  +++T T        F  N ++  + V + LD E +  YSL + A D     +   S+V +KV   D +D SP FI  ++ V  L +L    V+  +   D  +    +  Y+L
Sbjct:  257 VEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYK-LEVTNKEGDLKAQVT------ISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGH----ITAVSAIDIDELE----LVKYKIISGNEL----GFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATD-GENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRL------LTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQ------FAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSL 825          

HSP 35 Score: 68.1662 bits (165), Expect = 5.759e-10
Identity = 110/509 (21.61%), Postives = 201/509 (39.49%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILT-SNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN-NYKIESGNEDDRFAL---SGVGVQYRGQLLLRVVRPLDRETKEKYK-LTISVEDKGQPPLKGVLEVEI---IVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHAR 1754
            +  F +N  TG+I T S  +DRE  A   +E+ +       +   TI + V+++DENDN P F     + ++ E         +  A   D DE   +  +Y I  GN+D +F +   +G+ V  R Q            T   Y  LTI   D G+P       + I        +     F    Y   + ES+     V  V    A++ +       F       ++ F  ++  G+I + +P      +    + VE  D  +    A   V + V+  N   P+F + NY         + I +       I+  +  D+D +  ++ ++    D       R   +  +L   + + +     + + +   D   P ++    +++ +  AN + P F N     +V+ +A++ S +    A D D G N ++IY+I  G+  + F IE   G+IT+ K      + +  L I   D G   +  T  + +++  SD  H +
Sbjct: 1043 QNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPK-QSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGM-VSSRKQF-----------TAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANTPL------WFDIVGGNFDSAFDAEKGVGTIVIAKPLDAE-QRSIYNMSVEVTDGTN---VAVTQVFIKVLDNNDNGPEFSQPNY--------DVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPK 1520          

HSP 36 Score: 67.781 bits (164), Expect = 7.341e-10
Identity = 101/365 (27.67%), Postives = 155/365 (42.47%), Query Frame = 3
Query:  633 LRVVRPLDRETKEKYKLTISVEDKGQPPLKGV-----LEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQF---KKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIEIGKVTRKPLAIVHCQD-DDQDPRDLIAVSIIGGNDENIFALE--RTHGNVHILRQI-KAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +++ + LDRET   +   ++       PL  V     ++V+I V D NDN PVF  S Y   + E    G ++ +V A D D G N +V Y      +   V+E  F+ID  +G I   +    H      T  V A D G   SLS+   V+V V  IN   P F    Y G+  ++     G+V    +A++   D D  D    ++  I GGN    FAL   ++   V++ R + +   +I    Y + + A D G    Q  V+  + ++  N   PV      +  +  +   N  I    A D D G NG I YS+  G     F ++ +SG +  L  L   ++    L   A D G
Sbjct: 2615 IKLDKRLDRETSPAFHFKVA----ATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVME-AFNIDSNTGWISTLKDLD-HETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESD--PPGEV----VAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDI----YFLNITATD-GLFVTQAMVE--VSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSL-YGSGNSEFFLDPESGELKTLALLDRERIPVYSLMAKATDGG 2959          

HSP 37 Score: 63.929 bits (154), Expect = 1.034e-8
Identity = 95/465 (20.43%), Postives = 203/465 (43.66%), Query Frame = 3
Query: 8259 LNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKV-AVSDGINVL-------EIGMLITVTDSNDNRPQI----------SKEIINKTFVINT-SEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVA-LNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQ-YSLTLLAHDLGFPRKSQTSI-VLIKVLDEDDNSPYF 9587
            +ND  P+F+   +   ++E+  + + +  +   DAD       +     + + FS++P +G + L+  ++ + K++Y++++ AV  G+ +           + + +   N++ P I           KE       ++   + A+G I  V+I A D  D        ++ L+ E +         LNE      IK    ++W S     ++ + A D+G P    ++   ++       + I      Y +++   S  G  VA + ++ + +  ++ + +  G  + YF I  ++G I T+R +N+ +  + + L V      +         +  +T+ I D N ++P+ +       ++E + VG+++L V   D D G  G +  +I +      +L+PF  N  +  +     LD+E   + Y   + A D G P + ++ + V I++ + +DNSP F
Sbjct:    1 MNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLD--------QFFLAKEGK--------WLNE----YKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPI--DVEYKLSPGEDAVYFKINPRSGLIVTARPLNT-VKKEVYKLEVTNKEGDL---------KAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIAS-----LNLLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLF 428          

HSP 38 Score: 59.6918 bits (143), Expect = 2.088e-7
Identity = 125/520 (24.04%), Postives = 214/520 (41.15%), Query Frame = 3
Query:  144 VKFLSSQYNFRVSENQPINTIVGQVLIKFG--------FSYEFFHKEGLFNLNKLTGVILTSNI-IDRESLASDLIEIFL-YKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDD--RFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVI--RINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGG--NDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITL-------LKPLW 1634
            + F  S Y+  +SEN   NT + +V I             Y   +    F +   +GVI T+ +  DRE    +L E+ +   + L+   +  + ++V I D NDN P+F        +  +    T I    A D D        N ++    +DD   F ++       G ++L+     D    E Y +TI  +D G+P L   +E+ I +   N   PVF    YT  +NE       ++ + A+  +      +       +     +F+ID  +G +++  P    +      L + A D  +    A   VTV ++   +N   P F      +T   A + IG     P+  V   D D +   ++   I+    N  + F ++ + G +   R +   H + +Q  T+ VR+ID+G PS  + V + I I+  N   PVF        V   A    F+    A+D D+    ++ YSI  G+ R  F ++  SG+ITL       ++PL+
Sbjct: 1830 LHFTQSFYSTSISEN---NTNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVPFDREE--QELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDK-----GPNGEVTYVLQDDYGHFEIN----PNSGNVILKEAFNSDLSNIE-YGVTILAKDGGKPSLSTSVELPITI--VNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPEGQGIIYIIIDGDPFK-----QFNIDFDTGVLKVVSPLDYEVTSA-YKLTIRASDALT---GARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASL-IGT----PVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLD--HEL-VQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLY 2315          

HSP 39 Score: 59.6918 bits (143), Expect = 2.141e-7
Identity = 140/585 (23.93%), Postives = 250/585 (42.74%), Query Frame = 3
Query: 7938 VSISVYDNVCKCTNHGYFTGSVEENSD--------SEISVSNNILSC-NGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWI-------IDIGVIDADSKLFPLKFSLQGEENNA---FSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVL----EIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +S+++ DN      H  +   V EN D        S IS S  I    +G+    FT++P        Y+     + T  K +D E  ++ ++ +I A    G+  +    I+++D NDN+P+F  + + G +SE A I S +       + I   DADS    L    Q  E+ A   F+++   G++     +D E  + +   V V D G   L     + + I VTD NDN P  ++ +     ++ T    +  + V+ ++ATD D       ++ YSL   +        FL++ +SG LTIK    N +S +  + +I+  SD G+   F+S ++  + +    +  +  +   Y  ++   +   ++VA +    + L   + + I+  N  + F I S +G I T+         + + L+V+A  ++ L  +        +   I D N  SP         ++    + G+ + QV  ID D G  G V   +    DD       P +GN    +  N     I  +Y +T+LA D G P  S +  + I ++++    P F    + AS+ E
Sbjct: 1509 ISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINP--------YSG----VITTQKALDYERTSSYQL-IIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNAL-LVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPT----YVGVEVLKVSATDPDSEVP--PELTYSLMEGSL-----DHFLIDSNSGVLTIKN---NNLSKDHYM-LIVKVSD-GK---FYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGNRLNEPLKYSIL--NPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEA--SRELDHLRVARVVVRVN--IEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVL---QDDYGHFEINPNSGNVILKEAFNSDLSNI--EYGVTILAKDGGKPSLSTSVELPITIVNK--AMPVFDKPFYTASVNE 2047          

HSP 40 Score: 57.7658 bits (138), Expect = 7.391e-7
Identity = 86/355 (24.23%), Postives = 150/355 (42.25%), Query Frame = 3
Query: 3693 FSINQHTGIIHLINRLDREAIAFHVLTIVATDNS-STKGSEYLAVT-NLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSG------ALYLNQ-------PVDYELKP-KWNFIITAFDLGYPALHSNLSVTVTITNINDEKP-RFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNS 4706
            FS++  +G+I L  RL+ +    + L I+A D      G+  ++ T  LYV+I  +N+++P         F L +      +    T +D+DDG NG++         ES+S+   D            +LN+        +D+E  P  +N  + A D G P   S L          D  P RF KE   +  + +    G  V  +    P+  +V Y L       + F INP SG++  + P L  V  ++  + V  +  D   Q ++ +   +D+  E Q   Y A +  +S      + T+ A    K  N    Y + + +    +IN++TG   +++T  ++F S
Sbjct:   54 FSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVV----TVDDLDDGANGEI---------ESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEV-YDVSISEFSPPGVVVA-IVKLSPEPIDVEYKLSPGEDAVY-FKINPRSGLIVTARP-LNTVKKEVYKLEVTNKEGDLKAQVTISIEDANDHTPEFQQPLYDAYV-NESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTG--VISTTEELDFES 388          

HSP 41 Score: 55.8398 bits (133), Expect = 3.041e-6
Identity = 118/534 (22.10%), Postives = 206/534 (38.58%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFG-------FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE----GQFLETISIKVRIIDENDNPPIFY-----PNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRET-KEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPV-FSPSKYTVRLNESNLPG--FEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSK-QTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLW--FVKLDKIKLEIIARDA 1682
            F  + Y+  ++E+ P+ T V QV            F Y F +K  LF+++  +GVI  S  ++ +      +EI    + ++         T  + V I   N++ P  +     P  LE+     +  + D+        D    G   +  I +G+  D+F L+  G ++  +  ++  + +D E+    Y LT+  +DKG P     L+   I     D  P+ F    Y V ++E + PG    +VK+     D      VEY+       +   F I+ +SG I   +P +    +      V   +  +        VT+ +   N   P+F+          AY+         +  V   D D+     I  SI   N    F + +  G +    ++    +  +  Y   VRA D G+P + ++ V++ IRI   N   P+F        +  +  +   I    A D+D      + Y I  G+    F +  DSG++ L K L    +K     L I A D 
Sbjct:    8 FSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVVTVDDL--------DDGANGEIESVSIVAGDPLDQFFLAKEG-KWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPID------VEYKLSPGEDAV--YFKINPRSGLIVTARPLNTVKKE------VYKLEVTNKEGDLKAQVTISIEDANDHTPEFQQPLYD-----AYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLN-LLPFVINQFTGVISTTEELDFESSPEI--YRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDE--LELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDG 508          

HSP 42 Score: 55.4546 bits (132), Expect = 4.251e-6
Identity = 84/327 (25.69%), Postives = 145/327 (44.34%), Query Frame = 3
Query: 2847 LRIELFDGLSGDLSVSNTEIIIEFHPIFDSPI-FFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNY-----HLSIIEESLYGKWSIFXXXXXXXXXXXXXXXR-KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGING-FVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVK-INPSPKSKQFFDKQTFFQNISEDMK--ITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDN 3791
            L +E  DG +  LS   T + I    + D+P  F +  Y+ V+ E++L       + L+ ++++D+      H SI+      ++++     L  + +    ER   YS  V AV+      S+   V I + D NDNSP+F+  +Y   I  +    T+I ++   D DS  NG   ++SI     E +FV +D   G L +  +    E  E++  + A+D G P+  S   + V+ I  S         + F   + +D    +  KI   + D   ++T+ + K  QK  F +N H G I  +  LD      +VL +  +D 
Sbjct: 3159 LVVEAKDGGTPALSAVAT-VNINLTDVNDNPPKFSQDVYSAVISEDALVGD---SVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFV-LDPH-GILRSAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFAL-KSEQKSLFKVNSHDGKIIALGGLDS---GKYVLNVSVSDG 3475          

HSP 43 Score: 55.0694 bits (131), Expect = 4.984e-6
Identity = 34/117 (29.06%), Postives = 61/117 (52.14%), Query Frame = 3
Query: 5784 INDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRV--------TVEVLINLINVNDETPLIH 6110
            +ND  P+F  T  +V+I E  P+ + + Q+ A+DAD      F     N   L +V+P +GVIS +G L+Y++  R+ L +   D   ++        T ++ +++  +N+  P IH
Sbjct:    1 MNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIH 117          
BLAST of Protocadherin Fat 4 vs. Ensembl Human
Match: FAT3 (FAT atypical cadherin 3 [Source:HGNC Symbol;Acc:HGNC:23112])

HSP 1 Score: 226.098 bits (575), Expect = 1.271e-57
Identity = 268/1016 (26.38%), Postives = 452/1016 (44.49%), Query Frame = 3
Query: 3189 KSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSI--EKLPVELDFVEIDSQSGRLFT----NKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRI-----SKCTQKGAFSINQHTGIIHLINRLDRE---AIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMES--ISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYP-ALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN----EVLYYLQSVHPPDHPFVINPISGILSV--SNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWI----NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDG---TFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADK---SDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETPLIHNPTTVYL 6131
            ++T   V + V D NDN+P F T  Y  S+         + +V A+DPD G N  + YS+  E      D +EID  +G + T    N+L + V     FF+ A D GIP  +S + VY+ + P       F +  +   I+ED  I   +  L I   Q V +        +  + G F I Q TG I L  RLDRE   A  F V   +  D       + +   ++ + ++D+NDN P+F+  + +  I+ E   VGT L    A D+D G NGQV Y L +       +  F ID+ +G +   + +D+E  P + F + A DLG   +L S   V+V +T+IND  P F +E      V+++   G  V  +   D DT+    +V Y++   +P    F +  +     V    P+ +E   D+  + + A       Q  V+V +   +DN      + Y A+ LP+     + I  + A+      N    Y L  S   +  ++  +G+  L +   ++   I +  L++  +       + +   ++ ++ D   + F  + Y   + E   T  L L R+QA+ P   I+    Y      G    I   + +I L++           LDRE  + S   + V   D+    S    T V + + D NDN PVF    ++   PE+T+ G ++    V A  KD+ +  E  ++    NE  +F ++  +G ++ S V LD+E    F   ++  DG     ++ A + I + D ND    F+ D Y   I E A +   +  +  ++  + PN  I F IV+    + F+V+P  G++  + ++D E+ + Y LL+ A D       +P + + T TV + I D+NDN PVF        I E+ P+ + I+QL+ +D D         F ILS N++    ++P  G++ +A +  + ++  + L V   D      V      + V +E+   H PT + L
Sbjct: 2580 RTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTV---LSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKV-----DIVFTVDVDIKVLDLNDNKPVFETSSYDTIIM-EGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEV-YRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGR-FALGLVQSEWKVYVKRPLDREEQ-DIYFLNITATDGLFVTQAMVEVSVSDVNDNSPVCDQVAYTAL-LPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFFLDPESGE--LKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPV-FSSDHYNTCVYENTATKAL-LTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIILEQP----------LDRE--QQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLA--VFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEV-LDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSG-----IPAMSS-TATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDP-HGILRSAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEES--THKPTAIPL 3554          

HSP 2 Score: 168.703 bits (426), Expect = 2.532e-40
Identity = 255/1020 (25.00%), Postives = 446/1020 (43.73%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIP--RLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPIL---QEVSFDLVVMAVDAERQDRYDQQSVKVHI--KHDNEDEIQVLTYGAIILPKSSFYR--EKIATLKAQSNSKNLNSRFMYLLKNSSYD-KIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLR--SDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGN-PISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIY----LDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIP-----EFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFT---STXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVT-VEVLINLINVNDETPL 6104
            Y   +   +  + +KS+   + I V+D NDNSP+F   SY  +I   +   T I +V A D D G NG V YS+     +     I+S +G ++    +D   +  +   I A D      +L S V + V ++        F   ++   + ED+ +   I  LE     +     V Y +      G F I++ +G I L   LD E   F+ LT+ A D         ++   + V  ++ N ++P F + A+   +  E++++GT +   TA D D G +G+++Y +       +  F ID  SG +     +D E    +   + A D G   L+S + V + + ++ND  P    E     +V +N     +V ++ A+DPD  +NE L Y  +   P + F IN  +G+++ ++  L   Q+    L V   D     +     V V +  ++DN+ +     Y  I LP+    +  E I    A    +  N+   Y + + + D K  I+  TG   ++S       S DI  + ++++ R    +  + H   +      P  L F +  Y F + E       ++  + ++ P N P+       FDI  G        N     D E G   VG I     LD E      ++VEV       +G+ +  T+VF+ + D NDN P F+   +     E+     +I    ++A D+D    L Y   + I      +F +D ++G++ T+   LDHEA    I  I V D  F    + A +I+ ++DAND    FT+  Y   + E+A + + + QVT  +     N  + + I +    ++F + P  GIIT   E D      ++L I  TD     +      + T  V +S+   +++ P F        + E+V I + +I LI++ +  +  L++E+   + + + T+NP +GVI+T   LDYE+T  + L +  T+     +   V I +++ ND  P+
Sbjct:  797 YLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVL---TDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVN-DYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSV-KENSRIGTSVLQVTARDEDSGRDGEIQYSIRDG--SGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAP-LTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVY-QIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTG--MVSSRKQFTAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRV--TEIVGVVSVQPANTPL------WFDIVGG--------NFDSAFDAEKG---VGTIVIAKPLDAEQRSIYNMSVEVT------DGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEIL--QIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAER-LDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPM------SATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVI-LISAISQST--LIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPV 1768          

HSP 3 Score: 157.918 bits (398), Expect = 4.553e-37
Identity = 248/1035 (23.96%), Postives = 446/1035 (43.09%), Query Frame = 3
Query: 3207 VVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILG-------FYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPAL--HSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQ-VLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQAL-YPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIR-CTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINE-IPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEW--GKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDL--LLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQN-----HNIMIKCSDQD--NLGPLSYDIM 6212
            V++ V+D ND+SP F+   Y  S+       + + +V A+D D G N  + Y+IE      +  +I+   G +   K  D+    +F+  I   D G P ++++  V + +  S  S   F  + +   ++E++ I   +  +    Q  + Y +      G F+IN ++G+I     LD E  + + L I AT+     G    A  N  + I+D NDN+P+F     +   LSE+  + +I+           A D D   N  + Y++  +  +    F +D+ +GA+     +D+E    ++F +   D G P L   S + V + +T++ND  P F  ++  E I+     +G  V +V A DPD+    E+ Y L      DH F+I+  SG+L++ N  L +  + L+V   D +    Y    V + +K   +  +    ++ +  + +++    K+A + A  N   LN    Y + N   +K  I   +G V  T+  P +    ++  L+ +E+ R    ++     + +NI D ++ +  F    Y+  + +    PG  ++++ A+     P  ++ Y + D Y         PN+             GN+ L +E        +E  V    K+G +    T V L I   N   PVF    +     E+      I   ++ A   +    +  I   +   +F++D  +G++     PLD+E  + +   I+ SD   T     + +    ND   N   F    Y+  + E + I T + QV   ++ +  N ++ + IV +       F ++   G+I T   +D+E   H  L + + D    SL    L      V + I D+NDN PVF+       + E  P    +  + ASDAD SD   L + ILS ND     ++  +GVI+ +          ++L VS +DGL   T +V I ++  N  +P     T  Y+ ++ +N       I ++ +D D    G +SY I+
Sbjct: 1552 VIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTG-NMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATN---MAGMASNATVN--IQIVDENDNAPVFLFSQYSGS-LSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKF--FTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFT-QAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLME-GSLDH-FLIDSNSGVLTIKNNNLSKDHYMLIVKVSDGKF---YSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGN--RLNEPLKYSILNPG-NKFKIKSTSG-VIQTTGVPFDREEQELYELV-VEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAV-QVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEIN---PNS-------------GNVIL-KEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPIL--SINATSPEGQGIIYIIIDGDPFKQFNIDFDTGVLKVVS-PLDYEVTSAYKLTIRASDA-LTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVL------VHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQST--YVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAII 2536          

HSP 4 Score: 156.762 bits (395), Expect = 1.079e-36
Identity = 268/1143 (23.45%), Postives = 489/1143 (42.78%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDK-----EKSTKVFVVIFVQDFNDNSPIFSTQSYF-FSINRHTKPNTTIGKVFAMDPDSGINGFVNYS--IEKLPVELDFVEIDSQ---SGRLFTNKLVDVVEQEFIFFIT--AEDHGIPRLNSSVKVYVKINPSPKSKQF-FDKQTFFQNISE--DMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGII---HLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPK-WNFIITAFDLGYPALH-SNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGIL----SVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSK-NLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPH-----NLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNP-----------ISDLE----YYIFDIY-CGISERIKLPNTMIRL---DKETGW------------------ISVGNIY----LDREIIEGSQITVEVVVIDRGKNGSR---IRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEYIWINEI-PEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYH------FHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAG-ILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPLIHNPTTVY---LPKINQNHN---IMIKCSDQDNLGP---LSYDIMTSSKDIQNIYVDRITGKVS 6269
            + +Y   +LAV++  K       S+   + + ++  N+++P     ++  FS+ +      T   V   D D G NG +     +   P++  F+  + +     ++   K +D     + + +T  A+D G P+  S++K     NP+  +    F+K+ +  +ISE     +   I KL  +    V Y++S       F IN  +G+I     +N + +E     V        ++ +G     VT   ++I D ND++P F+    + ++ +ES  VGT +   +A+D D G NG + Y + +  +     F I+ F+G +   + +D+E  P+ + FI+ A D G P  H S ++VT+ I N+ND  P F K +  + ++  +  +G  +  V A D D  E++ Y          F +NP SG+L    S++N  ++  +F L + A D E  +  D  S+ + + H    ++   ++       +    EK+  +KA++N K NL   F+     +         +  DV +    PV  N      ++ +++  +D+     + K++  I D +     N++ +       +P  +    L L  +     GNP           + D       +I D Y   I E   +   +I++   DK+ G                    S G +Y    LDRE    +  ++++   D+ ++G +   +   KVFL  +D ND  P F   ++     E+   G  I    ++ HD D  L   + Y  +N+    F +DK SG +  S   LD+E   ++   ++  D     + + +  ++      +   H  Y         + E + I T + QVT ++  +  +  I++ I    G   FS++ + G+IT    +D E    Y L + ATD     L+       T  V + + D+NDN P+         + E+ P +  +IQ+ A D D S  + L + I S N      +N  TG+I+T    LD E+   H L V+ TDG     + T+ V++ +++ ND  P    P  VY   LP+ ++      I    +   + GP   +SY I+  + D    ++D  TG VS
Sbjct:  224 KNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEP----TYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPID-VEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEV--------TNKEGDLKAQVT---ISIEDANDHTPEFQQPLYDAYV-NESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLP---FVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVA-CQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGE--NLADPMSINISVLH---GKVSSKSFSCRETRVAQKLAEKL-LIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGAN------ILKIKAYDADSGF---NGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRE--SKANYSLKIEARDKAESGQQLFSVVTLKVFL--DDVNDCSPAFIPSSYSVKVLEDLPVGTVI--AWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSK-ELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLY------STIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQF--PEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDD-GKFFIDPKTGMVS 1314          

HSP 5 Score: 152.525 bits (384), Expect = 2.108e-35
Identity = 256/1035 (24.73%), Postives = 450/1035 (43.48%), Query Frame = 3
Query: 3267 FFSINRH-------------TKPNTTIG----KVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE----FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPA---LHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILP---KSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDI-TFLISLESLRSDTLIKY-HSTKLVLNIGDPHNLN---------FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIR-------------LDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGK--NGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQV--TLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINL---INVNDETPLIHNPTTVYLPKINQNHNI 6158
            F+SINR               K +  +G    K+ A D DSG NG V ++I     +  F  ID ++G+L   K++  +++E    ++  IT  D G P+ +S   + + +  +  +   F + ++  NI E   I  +I ++E   + +     VTY +   TQ+  F+IN  TGI+++ ++LDRE+ A + L I A D + + G +  +V  L V + DVND SP F   + +  +L E   VGT++ +   +D D GL GQVRY L     +    F+ID  SGA+ L++ +DYE +  +N  + A D G P      S + V V   N N   P F  +  +   V++N  IGT+V +V A+D D+    E+ Y ++        F I+  SG+++ ++ + +E   S+ L V A D      Y   +++V+I+ ++ ++   LT   I  P   ++S     +  ++A+    + N +  Y                    +TS  P  F +I+I T LI+  S + D   +  H  ++ +  G P               +ND   Q PE      +KL        G PI     + FD       R + PN  I              +D +TG +S       ++   GS   + +  +D G+    S  R    ++     +     F    + F   E+    + + V +VQ  +  L    + +  N    F  +K  G +  +  PLD E  + +   ++V+DGT  +   + I + D ND    F+   Y   I E     T I Q+  T ++     ++ +   I S      F ++P  G++ T   +D+E  + +IL I   D  Q+  +   L      V+V++ D ND+ P F       S+ E   + S ++Q+ A D DK +   L++ I + N   +  + P+ G+I+     D     +  L++  TD G   ++   ++ +   ++ N     IH     Y  ++N+N +I
Sbjct:  715 FYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCF-NIDMETGQL---KVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQ--FAINSSTGIVYVADQLDRESKANYSLKIEARDKAES-GQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVL-EDLPVGTVIAWLETHDPDLGLGGQVRYSLVN---DYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYF-PDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGR-FSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLY--STIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYR-------------------ITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPE--KVYQIKLPERDRKKRGEPI--YRAFAFD-------RDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSS-----RKQFTAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANTPL--WFDIVGGNFDSAFDAEKGVGTIVIAK-PLDAEQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDS-ISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRD--QEFPYRRNL----ARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKD---YQAEVNENVDI 1686          

HSP 6 Score: 138.272 bits (347), Expect = 3.604e-31
Identity = 121/449 (26.95%), Postives = 207/449 (46.10%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDK--GQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCT---LVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKII-YSITKGDYRDRFAIE 1595
            F L+  +G + T  ++DRE +    +   + K T  G      +I + + D NDNPP+F  +     + EN A    ++   A D D     +  N K+     D   +  GV        ++ + +PLDRE +  Y +++   D+  GQ  L  +  V I V D NDN PVF    Y V + E   PG +V+ V+A+  D G N E+ Y  +      + +F I+ K+G I +++     +    C    LVVEA D G+P+LSA   V +++  +N   PKF  +       +A I    +    + ++  +D D  P   I  SI+ G+ +N F ++   G   +++  K +    +  Y++ V+A+D+G P+  +T  + I I+  N   PVF     +  +  N  + + I     TD D+  NG    +SI  G+  + F ++
Sbjct: 3076 FFLDPESGELKTLALLDRERIP---VYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPD-----IGINRKVVYSLAD---SAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQS-LSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNE--QGKFKINPKTGGISVSEVLDYEL----CKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVY-----SAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLG---LVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLD 3498          

HSP 7 Score: 128.257 bits (321), Expect = 4.555e-28
Identity = 159/619 (25.69%), Postives = 264/619 (42.65%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVL---IKFGFSYEF---FHKEG-------LFNLNKLTGVILTSNIIDRES--------LASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVV-KVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDC---TLVVEAFDHGSPSLSAYCYVTVHVI--RINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQI-------KAIHNINLQSYTITVRAIDNG-NPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHARIKSTCPTQFILDDSNLLHSFSHIFIEDFSKQLELSDSNRITEIEFKIIN 1901
            F +S Y+  + E  P+ T + QV    + +G + +     H +         FN++  TG I T   +D E+        +ASDL E F            T  + VR+ D NDN P+F        + E+      +++ +  D DT +     +Y I  GN   RFAL  V  +++    + V RPLDRE ++ Y L I+  D G    + ++EV   V D NDNSPV     YT  L E ++P  +++ KV A DAD G N  + Y    + +   +EF +D +SG ++    T   +++      +L+ +A D G      +C   +H+I   +N   P F  ++  +      +     T+  L  V   D D           IG N + +++L  + G V  +          + +      SY I+VRA D     S  +   + I +   N   PVF  R   VTV  + S  + +   FAT  D G N +I Y I  G+ + +F I   +G I++ + L +    +  L + A+D G  +L     +++N+   +    +      +  I +D+ +  S   +  ED        DS    +I F I+N
Sbjct: 2814 FETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAF--------SLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWK----VYVKRPLDREEQDIYFLNITATD-GLFVTQAMVEVS--VSDVNDNSPVCDQVAYTALLPE-DIPSNKIILKVSAKDADIGSNGYIRYSLYGSGN---SEFFLDPESGELK----TLALLDRERIPVYSLMAKATDGGG----RFCQSNIHLILEDVNDNPPVFSSDHYNTC-----VYENTATKALLTRVQAVDPD-----------IGINRKVVYSLADSAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDV-------DSQPNGQIHFSIVN 3382          

HSP 8 Score: 125.176 bits (313), Expect = 4.051e-27
Identity = 142/553 (25.68%), Postives = 261/553 (47.20%), Query Frame = 3
Query: 2931 DSPIFFEPFYTFVVKENSLSHTPLRKISLIQSQNID--------NYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVE-QEFIFFITAEDHGIPRLNSSVKVY---VKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIF-KNDALNNFILSESTKVGT--ILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAII 4526
            ++P+F +  Y   VKE   S  P   ++++ + + D        +YH  I   +  G++++    S + +      +R++     L +   D    T+  V + V D NDNSP+    +Y   +      N  I KV A D D G NG++ YS+        F  +D +SG L T  L+D      +     A D G     S++ +    V  NP   S   ++   +    ++ +    +    +I   + V Y ++  +  G FSI+  +GII L   LDRE  + + +++ ATD S   G    ++T + + ++D+NDN P+F + D L    + E T  GT  +  F T+ DI  G N ++ Y L  +G E    FKI+  +G + +++ +DYEL  ++  ++ A D G PAL +  +V + +T++ND  P+F+++     ++ ++  +G +V  + A+D D+  N  +++       D+ F ++P+ G++ V   + +E    + L+V AVD+         +V + I   +DN        Y A+I
Sbjct: 2920 NAPVFAQEVYRGNVKE---SDPPGEVVAVLSTWDRDTSDVNRQVSYH--ITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFF--LDPESGELKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLAD-SAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQS--PGQSLSSLTTVTITVLDINDNPPVFERRDYL--VTVPEDTSPGTQVLAVFATSKDI--GTNAEITY-LIRSGNEQ-GKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDV-YSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVI 3455          

HSP 9 Score: 121.324 bits (303), Expect = 5.904e-26
Identity = 100/337 (29.67%), Postives = 157/337 (46.59%), Query Frame = 3
Query:  630 LLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRI----NYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNV----HILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLIT 1616
            +L+VV PLD E    YKLTI   D      +  + V+++V D NDN P+F    Y   L+E++L G  V++V + DADS  N+ V YQ  +      + F ID  SG I LT     H     CTL V + D G PSLS+   V +++  +N   P F      +YV       +          +  V   D D    D +  SI+ GND   F ++   G +    H  ++++ ++++N+        ++ +G     +T  + IR+  AN+Y P F        V  N +  + + +  ATD D G  G+I Y+I     +DRF I+ +  +IT
Sbjct: 2239 VLKVVSPLDYEVTSAYKLTIRASD-ALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLI-LTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHF---------VTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNV--------SVSDG--LFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVIT 2554          

HSP 10 Score: 116.316 bits (290), Expect = 1.508e-24
Identity = 141/497 (28.37%), Postives = 227/497 (45.67%), Query Frame = 3
Query:  270 NLNKLTGVILTSNIIDRES-LASDLIEIFLYKK------TLEGQFLETISIKVRIIDENDNPPIF---YPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLEN--EFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVI--RINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDEN-IFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNP---SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETT 1706
            N++ L G + + +   RE+ +A  L E  L K        LE  FL+  SI       N   P F   +P+ +   + E++ +  +I    A D+D+  F     + I  GN D  F +        GQL  +V+ P+DRE  + Y L I++ D G P       + I VED NDNSPVF    Y+V + ES+  G E+++V A D D G N EV Y      SVL +  +F+I+  +G + +        ++ + +L +EA D        +  VT+ V    +N   P F I    S      + +G V    +A +   D D      +  S++  ND N  F +++  G + + +++        Q Y +TVRA D G P   S  + V++ +     N++ P F +     +V  N+ I + +    A D D+G +G+I YSI  G    RF+I+ +SG+IT    L    +    L + A D G+  L +T
Sbjct:  668 NISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSI-------NRQGPYFDKSFPSDVA--VKEDLPVGANILKIKAYDADSG-FNGKVLFTISDGNTDSCFNID----METGQL--KVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTY------SVLTDTQQFAINSSTGIVYVADQLDRE-SKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAF-IPSSYSVKVLEDLPVGTV----IAWLETHDPDLGLGGQVRYSLV--NDYNGRFEIDKASGAIRLSKELDYEKQ---QFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYST 1131          

HSP 11 Score: 112.849 bits (281), Expect = 1.812e-23
Identity = 144/549 (26.23%), Postives = 247/549 (44.99%), Query Frame = 3
Query: 8355 IDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEI----INKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHS---ITVHF--------LFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNV-NSAILGQWFSLIVQACGTKIL---------------SSVSFCSKRETITLVIS--------------------DF---NLYSPQIRIS-ETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL---IVLPEVRDEDSIMASRNEPSYTLKSKT------SSKVQLF-------QSKTNFTLKILKRSTNES 9788
            ID + KL P      GE+   F INP++G +  A+ ++   K  Y+++V   +G   L+  + I++ D+ND+ P+  + +    +N++  + TS        V+ ++A+D D  +  N  I YS++S N  +P    F++N+ +G ++     L++ S  E    I+ ASD G P    S   +T+          LF    C+  I   ++ +P+        G   A  A++ D L   + + IISGN   +F +   +G +   +++ NS I    F+L + A   + L               SS SF  +   +   ++                    DF   N   P    S  + V++ E + VG+N+L++   D D+G  G V  TI     D      F  +  + QLKV+ P+D E    Y L +  +DLG P+KS   ++ I V D +DNSP FI  ++  ++ E   +   I+  E RD+D  + S  E +Y++ + T      SS   ++       +SK N++LKI  R   ES
Sbjct:  405 IDVEYKLSP------GEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGD--LKAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTS--------VLTVSASDKD--KGENGYITYSIASLN-LLP----FVINQFTGVISTTE-ELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVI---SYDFPVG-------GHITAVSAIDIDELE-LVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSC----FNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKD--LGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAES 912          

HSP 12 Score: 111.694 bits (278), Expect = 4.221e-23
Identity = 261/1145 (22.79%), Postives = 478/1145 (41.75%), Query Frame = 3
Query: 3141 KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSG--INGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFK---LEIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNS-PIFKNDALNNFILSESTKVGTILGFYTA-------NDIDDG-LNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRF---------NKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISG-ILSVSNPILQEVS-FDLVVMAVDAERQDRYDQQSVKVHIK-HDNEDEIQVLTYGAI--ILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLV---LNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISD-LEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSG-IVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGK-HLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSP--NDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLI--NVNDETPLIHNPTTVYLPKINQ----NHNI-MIKCSDQD--NLGPLSYDIMTSSKDIQNIYVDRITG--------KVSFNPGLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYT 6398
            +Q S   ++V   D        V I V D NDN P FS  +Y  +I+    P+T I ++ A D D    ++  V+ SI+   + +    ID  +G L+T + +D   Q+  I  I   D   P   +  +V V +  +     +F    +  ++ E   +   + +   L+ D  +   + Y I        F I    GII +    D   +   VL+I  TD    +GS  ++ T +    + ++DNS P F +      + +E+  +GT +   +A        ++ DG +NG               +F I+ +SG +   + +DYE    +  II A ++    + SN +V + I + ND  P F         ++ + +  IV+ ++     V R    D + N +L Y          F ++  +G I +++N   + ++ F   V   D+       +  V+V+I+  D  D   V T      IL   ++   ++  + A      +     Y L   S D  +I+  +G   LT    ++ N++     + +  +      K++ST +V   +       L+F ++ Y   I E  T    K+  + A+  GN +++ L+Y I +           P    ++   +G I    +  DRE  E  ++ VE     R  +  R+    V +NIED NDN PVF    +      +   G  IY  T    DK  +  + Y+  ++   F ++  SG ++       D   + Y +  +    G  + + ++ + I   N     F    Y   ++E   ++T I    L  + T+P       I+ +      F+++ D G++     +DYE  + Y L I A+D             VT  +LV+  D+NDN P+FD      ++ E   I + ++Q+++ DAD  +  ++ ++I+    N      ++  +G+I TA +LD+E  +   L V   D G   ++ EVL+++   +VND  P+ +    +Y   +++     H +  ++ SD D  +   L Y I+ S  D  +  +D  +G        K    P  LY  S+NVS+  SD +  +   V + VL  N  S  ++
Sbjct: 1424 EQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDS--ISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTD----QGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEV-NENVDIGTSVILISAISQSTLIYEVKDGDING---------------IFTINPYSGVITTQKALDYERTSSYQLIIQATNMA--GMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVR-SLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSG--VLT----IKNNNLSKDHYMLIVKVSDG---KFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNI-TKVAIVNAV--GNRLNEPLKYSILN-----------PGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEA---SRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPI----LSINATSPEGQGIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDA-----LTGARAEVTVDLLVN--DVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQ--LIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSIL-SGNDRTSFLMDSKSGVITLSNHRKQRMEP--LY--SLNVSV--SDGLFTSTAQVHIRVLGANLYSPAFS 2497          

HSP 13 Score: 111.694 bits (278), Expect = 4.746e-23
Identity = 139/520 (26.73%), Postives = 217/520 (41.73%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIV-------------GQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDN--PPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFAL---SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRK----PLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTI-TVRAIDNGNPSKQTTVDMLIRINKANIYFP---VFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPL 1631
            F+ S Y+ +V E+ P+ T++             GQV       Y      G F ++K +G I  S  +D E      + +    K           ++V ++D N+N   P F    +   + EN  + T +    A D D+   G    Y I  G+   RF++   SGV         +     LDRET   Y LT+   D+G  PL   +EV I VED NDN+P+ S   Y   + E++     V+++ A D DS  N+++ Y+   T    +N F+I+ K+G I  T        Q +  L V   D G     +  +V V V+  N   P+F        +K   I++ +  RK    P+      D D+ P   I+ SI+ GND+  F ++   G V   +Q  A       SY I T++A+DNG P K +T  + I   K     P    F   + + TV  +  +   +            N  + + I  G++   F  EK  G I + KPL
Sbjct:  936 FIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYN-----GRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDG-EIQYSIRDGSGLGRFSIDDESGV---------ITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRI--TSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQF-------PEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTA------GSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQP----ANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPL 1421          

HSP 14 Score: 109.768 bits (273), Expect = 1.858e-22
Identity = 129/512 (25.20%), Postives = 228/512 (44.53%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIK---FG----FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFL-ETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNE-DDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP---PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHI----NQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQD--PRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNR-YQSVTVYRN-ASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLK 1625
            F+   Y+  + E+  I T + QV  +    G     +Y        F +N  TG++  ++ +DRES A+  ++I    K   GQ L   +++KV + D ND  P F P+    +++E++ + T I+     D D    G+    +    N+ + RF +       +    +R+ + LD E ++ Y LT+  +DKG+P        +EVE++  + N ++P F        + E++  G  V++V A D DSG + E++Y  +    +    FSID +SG I     T+  I      G   L V A D G   L +   V + V  +N   P        +++   Y  + + + K ++++  Q +D D    + +   I  GN +N FA+    G   I    + +       + + V   D G   KQ+T+ +++++   N   P F  + YQ     R+       I   FA D D G N +I YSI  G+   +F I+  +G+++  K
Sbjct:  831 FIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPD---LGLGGQVRYSLVNDYNGRFEID------KASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGL--GRFSIDDESGVI-----TAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPL-------TSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTG--LITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRK 1317          

HSP 15 Score: 105.531 bits (262), Expect = 2.895e-21
Identity = 133/541 (24.58%), Postives = 227/541 (41.96%), Query Frame = 3
Query:  165 YNFRVSENQPINTIVGQVLIKFGFSYEFFHKEG-----LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE---GQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANF-------FATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSD 1739
            YNF V E+  +  IVG V ++   +  +F   G      F+  K  G I+ +  +D E  +       +Y  ++E   G  +    + ++++D NDN P F     +  I E++   T+I    ATD D        +Y + S    D  ++    +     +L    R LD E ++K+ L I V D+  P  + +  V + VED ND+SP F+   Y   + ES   G  V++V A D D G N E+ Y  +   +   N F I+   G I + +        G   L ++  D GSP +SA   V + V   ++  PKF   +Y    ++   ++IG       AI          +  +   +  G+   IF +    G   ++   KA+      SY + ++A +    +   TV+  I+I   N   PVF     S ++   A INS + +         ATD D+  N  ++Y I +   +  F ++  +G I  +  L    +      +  RD+G   L     +++NI  +D
Sbjct: 1367 YNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRS-------IYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKH---KLSYTVHSSI--DSISMRKFRIDPSTGVLYTAER-LDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNT--GNMFKIEPVLGIITICKEPDM-TTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNEN--VDIGTSVILISAI---------SQSTLIYEVKDGDINGIFTINPYSG---VITTQKALDYERTSSYQLIIQATNMAGMASNATVN--IQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTD 1875          

HSP 16 Score: 102.449 bits (254), Expect = 2.706e-20
Identity = 130/504 (25.79%), Postives = 224/504 (44.44%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADG---SGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD--SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGIN-VLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNE---TVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRV-ANIAVNHD-NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQA--CGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITS-TDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +P+DRE  +   +++   DG   +  ++E     + V D+NDNSP+     +   + E+      I+ +   DAD  S  + +++SL G  N+ F ++P++G +     +DRE    Y +    +DG     +  + + + D NDN P  S +  N     NT+  A     +  + A D D     N ++ YSL+          +F +       +   + L    D E   + ++ + A+D+       S+T   + +    +   +     Y + V   +  G++V A  A + D     EIT+ I SGN    F I  K G IS S  ++   L + F L+V+A   GT  LS+V+      T+ + ++D N   P+      +  ISE   VG +++ +   D D+   G +  +I+    D+ F++ P         +KV   LD E    YSL + A D G P  S T+ V I + D +DNSP F   N+ A ++E
Sbjct: 2988 RPLDREEQDIYFLNITATDGLFVTQAMVE-----VSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGY-IRYSLYGSGNSEFFLDPESGELKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVYENTATKA----LLTRVQAVDPD--IGINRKVVYSLADS-----AGGVFSI-----DSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYE-LCKRFYLVVEAKDGGTPALSAVA------TVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLG-----LVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQE 3457          

HSP 17 Score: 99.7525 bits (247), Expect = 1.665e-19
Identity = 129/518 (24.90%), Postives = 233/518 (44.98%), Query Frame = 3
Query: 2892 SNTEIIIEFHPIFD-SPIFFEPFYTFVVKENSLSHTPLRKISLIQSQNID---------NYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINR--HTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQF---FDKQTFFQNISEDMKITEKIFKLEIDHQQM-VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTAT---GMESISV--FKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSV 4373
            S  E+ IE   + D +P+  EP Y  VV ENS      + +S+IQ Q  D          Y ++      +   +I +        +LD E++ ++   V   +     K + ++VV+ V D NDN P F  + Y   +      K    I + FA D D G N  ++YSI     +  F  ID ++G + + K       + I  I A D+G P+ +S+ +++++    P        FD+  +   + E  ++TE +  + +      + + I       AF   +  G I +   LD E  + + +++  TD ++      +AVT +++ ++D NDN P F      +  +SE     T +    A D D+      +++L+ T    ++SIS+  F+ID  +G LY  + +D+E + K    I   D  +P   +   V V + + ND  P F      E  V ++ A+G+ V +V A D D     E++Y +++ +  +  F I P+ GI+++
Sbjct: 1130 STIEVYIEVEDVNDNAPLTSEPIYYPVVMENS-----PKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFF-IDPKTGMVSSRKQFTAGSYD-ILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTN------VAVTQVFIKVLDNNDNGPEFSQPNY-DVTISEDVLPDTEILQIEATDRDE------KHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTN-PLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNM-FKIEPVLGIITI 1625          

HSP 18 Score: 97.8265 bits (242), Expect = 6.682e-19
Identity = 139/534 (26.03%), Postives = 230/534 (43.07%), Query Frame = 3
Query: 8154 PVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQGEENNA---FSINPQNGSVFLAQTVDRELKSKYEMKV-AVSDGINVL--EIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQ--PPLFH---SITVHFLFITAECELRILKSTFQYP--------IAVLYTSQEGSRVANI-AVNHD-NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIIT----STDDRFSLVP----FPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE-------LDQLIVLP 9644
            P+D EV +  ++++  +D   G        + V D+NDN PIF    +   +SE +LIG+ ++ +  IDADS+   +  + +  +  N+   F I+  +G +  A+ +D EL     +KV ++  G   L  E+ + I ++D NDN P +  ++I +++V   SE A    FV  + A+DAD S  +  ++ YS+ S N R    + FL++  SG                   VI  ++ R Q   PL+    S++      TA+  +R+L +    P          V      G++V ++ A + D   YG+I++ II+      F I S    I+T R      L    S+ V+A         +FC    T+ +++ D N  +PQ    E   S+   +  G  + QV  IDPD G    +  ++ +    S  D   + P      T GN  QLK             S  + A D G P K     V I VL  +   P F    +  ++ E       +D L +LP
Sbjct: 2245 PLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDN-PPVFNQLIYESYV---SELAPRGHFVTCVQASDADSSDFD--RLEYSILSGNDR----TSFLMDSKSG-------------------VITLSNHRKQRMEPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSIFVRALDGG--GRTTFC----TVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLK---------NTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILP 2734          

HSP 19 Score: 93.5893 bits (231), Expect = 1.283e-17
Identity = 79/282 (28.01%), Postives = 127/282 (45.04%), Query Frame = 3
Query:  252 HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFP 1097
            +++G F +N  TG I  S ++D E L      +   K           ++ + + D NDNPP F  +     I E+  +   + L  A D D+   G   ++ I +G+ D+ F +  V        L++V + LDRE    Y L +   D G P +     V I + D NDNSPVF+P+ YT  + E+   G  ++++  +D DS  N    + F       E EF +D   G +R +     H    +  L V+A D G P   ++ Y+ V VI  ++  P
Sbjct: 3279 NEQGKFKINPKTGGISVSEVLDYE-LCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNG-QIHFSIVNGDRDNEFTVDPV------LGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGP-PFSFSILSGNEEEEFVLD-PHGILR-SAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKP 3549          

HSP 20 Score: 93.5893 bits (231), Expect = 1.305e-17
Identity = 124/469 (26.44%), Postives = 200/469 (42.64%), Query Frame = 3
Query:  351 FLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQY------RGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP--SLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINL-QSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            FL     +G F+    ++V + D NDN P+         + E+I     I   +A D+D      SN Y         R++L G G          G+L  + +  LDRE    Y L     D G    +    + +I+ED NDN PVFS   Y   + E+      + +V A D D G+N++V Y    +   +   FSID  SG I L QP      Q    + V A D  SP  SLS+   VT+ V+ IN   P F R +Y+         E      + LA+     D     ++  + I  GN++  F +    G +     +  + +  L + + + V A D G P+      + I +   N   P F     S  +  +A +   +    A D+D+  NG+I +SI  GD  + F ++   GL+ + K L   ++    L + A D+GI ++ +T  ++++I
Sbjct: 2999 FLNITATDGLFVTQAMVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIG----SNGYI--------RYSLYGSGNSEFFLDPESGEL--KTLALLDRERIPVYSLMAKATDGGGRFCQS--NIHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGV---FSIDSSSGIIILEQPLDRE-QQSSYNISVRATDQ-SPGQSLSSLTTVTITVLDINDNPPVFERRDYL-----VTVPEDTSPGTQVLAVFATSKDIGTNAEITYL-IRSGNEQGKFKINPKTGGI----SVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDI 3436          

HSP 21 Score: 92.0485 bits (227), Expect = 3.332e-17
Identity = 117/500 (23.40%), Postives = 212/500 (42.40%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFGFSYEFF---------HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYAS-DAD-SGVNQEVEYQF-------KKTRSVLENEFSI------DRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEI---GKVTRKPLAIVHCQDDDQDPRDLIAVSIIG-GNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSIT 1562
            F  SQY+F ++E+  I + V  + I    +  F          +K G+F + + TG I     +DRE+  +   ++       +   + T+ + ++++D NDN P+F  +  +  I+E + + T ++   A D D    G    Y + S ++ ++  +    +       +  ++ LD ET   +  ++   D G+   L     V + V D NDN+PVF+   Y   + ES+ PG EVV V ++ D D S VN++V Y         +    ++++E+ +      DR+   I        +I   D   V +A             V V V  +N   P          D+ AY  +      + K +  V  +D D      I  S+ G GN E  F L+   G    L+ +  +    +  Y++  +A D G    Q+ + +++     N   PVF + + +  VY N +  + +    A D D G+N K++YS+ 
Sbjct: 2708 FTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANG-QVTYSLHSDSQPEK-VMEAFNID-SNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPG-EVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYF-----LNITATDGLFVTQAM------------VEVSVSDVNDNSP--------VCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSE--FFLDPESGE---LKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILE--DVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLA 3171          

HSP 22 Score: 92.0485 bits (227), Expect = 3.593e-17
Identity = 158/647 (24.42%), Postives = 274/647 (42.35%), Query Frame = 3
Query: 7776 YNGTIYQTFFSINRESGQISLNEPLP-QLVSVYTLRIRA---SLKMVNSKIL---WYKDTDVSISVYDN------VCKCTNHGYFTGSVEENSDSEIS----VSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLF-PLKFSLQGE-ENNAFSINPQNGSVFLAQTVDRELKSKYEMKV---AVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAV-NHDNLYGEITFFIISG-----NGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFP-RKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELD 9626
            YN T Y   F I+  SG I     L  +LV   TL++R+       ++S++L   +  D + +  V++       V +    G+F   V+  SD++ S    +  +ILS  GN + SF +  K     L          + H+    E   +L +SV     S G+  S   + I+V+  N  SP F+ + ++  V EN   G+ +I +   D D   +  + +++  +   + F I+  NG V   + +DRE   + ++ +   A+  G       + + V D NDN PQ        +     ++   G++ V  + A D DD    NS+I YSL SE   + V  L  ++ D+G +  K    N +  N  +   + A D G P     I V+   +  E  L     + QY   +   +  GS V  + +    N++    F  ++G     N    F I  + G I   + ++       F   V A  T  L  V      + + + + D N   P    S     I E + VG+ L QV  ID D G  G V  ++ + +     +  F  + N+  +  +  LD+E    ++ +++A DLG     S T++V ++V D +DN+P F    +  +++E D
Sbjct: 2331 YNSTDY---FHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQA-SDADSSDFDRLEYSILS--GNDRTSFLMDSKSGVITL----------SNHRKQRMEPLYSLNVSV-----SDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLID-SNGQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASV---RADVGRGHL-VTQVQAIDPDDGA--NSRITYSLYSE-ASVSVADLLEIDPDNGWMVTKG-NFNQLK-NTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQS-QYSFTIAEDTAIGSTVDTLRILPSQNVW----FSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRET-SPAFHFKVAA--TIPLDKVDIVFTVD-VDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESD 2937          

HSP 23 Score: 88.1965 bits (217), Expect = 6.035e-16
Identity = 147/547 (26.87%), Postives = 239/547 (43.69%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINT--IVGQVLIKFGFSYEFFHKE--GLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIF----YPNKL-ERRIIENIALLTDIS--LTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPL--KGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLE---NEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQS-YTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIK--LEIIARDAGINSLETTGYLDLNIL 1730
            KF+   Y   V+EN  I T  I+   + +    YE    +  G+F +N  +GVI T   +D E  +S   ++ +    + G      ++ ++I+DENDN P+F    Y   L E   I +I    D S  +  ATD+D++   +     +ES  +      S  G        +R +  LD ET   +   + V D G P L  +  +EV I V D NDN PVF+ + +   L      G EV+KV A+D DS V  E+ Y      S++E   + F ID  SG + +    + ++++    L+V+  D    S S    VT+ V         F  ++  ++       I KV     AIV+   +  +  + +  SI+  N  N F ++ T G   +++      +   Q  Y + V A    +  +   V + + I   N   PVF        V  +A   + I    A D D G NG++ Y + + DY   F I  +SG + +LK  +   L  I+  + I+A+D G  SL T+  L + I+
Sbjct: 1670 KFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSS--YQLIIQATNMAG-MASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGA-------IRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTY------SLMEGSLDHFLIDSNSGVLTI---KNNNLSKDHYMLIVKVSDGKFYSTS---MVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKV-----AIVNAVGNRLN--EPLKYSIL--NPGNKFKIKSTSG---VIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTY-VLQDDY-GHFEINPNSGNV-ILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIV 2179          

HSP 24 Score: 87.4261 bits (215), Expect = 9.327e-16
Identity = 109/454 (24.01%), Postives = 184/454 (40.53%), Query Frame = 3
Query:  372 EGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSV-LENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF---RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGG-----NDENIFALERTHGNVHILRQIKAIHNINLQ---SYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDR----FAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +G F  T  + +R++  N   P F  +     + EN+A  T +    ATD D   +G   +Y I +    DRF +        GQ++      LDRE   +  ++I V             V +IV D NDN+P F   +Y   +      G  V +V A D D G N  + Y      SV + +   ID  +G + +T+     +     +  V+A D G P   +   V +HV+   +F P F   + ++  + D A    IG  T   L I+  Q+        +  S + G     N   IF +E+  G + + +++    +       + TI +  +D        TVD+ I++   N   PVF        +     + + +    A D+D G NG++ YS+      ++    F I+ ++G I+ LK L           ++A D G
Sbjct: 2473 DGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYG-QISYAIINDFAKDRFLIDS-----NGQVI--TTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWM-VTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTA----IGS-TVDTLRILPSQN--------VWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVD-----IVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLG 2899          

HSP 25 Score: 85.8853 bits (211), Expect = 2.505e-15
Identity = 106/462 (22.94%), Postives = 199/462 (43.07%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEI------FLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIE--IGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNP--SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITL 1619
            F ++  TGV+ T+  +D E+    ++ I      F Y++ L         + V + D ND+ P F     E  + E+ AL + +    A D D  E      Y IE+GN  + F +  V        ++ + +  D  T  ++ L+I V D+G PP+     V I V   +++ P F    Y   +NE+   G  V+ + A    + +     Y+ K     +   F+I+  SG I  TQ    +       L+++A +     +++   V + ++  N   P F  + Y GS  +AA I   +  +   PL ++   D D +   L+   I+    +  F ++ + G +   R I  + +  +  +   V   D+G+P  + ++ V++ I +   N   PVF        +     +   +    ATD D+ +  ++ YS+ +G   D F I+ +SG++T+
Sbjct: 1509 FRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLA-------RVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGE-NAELIYTIEAGNTGNMFKIEPV------LGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLI-----YEVKDGD--INGIFTINPYSGVI-TTQKALDYERTSSYQLIIQATNMA--GMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPL-VIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAI---RTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSL-DHFLIDSNSGVLTI 1941          

HSP 26 Score: 85.1149 bits (209), Expect = 4.732e-15
Identity = 106/410 (25.85%), Postives = 178/410 (43.41%), Query Frame = 3
Query:  555 YKIESGNEDDRFALSGVGVQYRGQLLLRVVRP----LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFD-----HGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQD-DDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQS----YTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQ------SVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLN 1724
            Y+I SG+E+  F    V +     L +R        L+RE ++ Y L +    +G+  L+   +V I V D ND  P+FSP+ Y+V + ES      V +V A+DAD G N E  Y FK    +    FS+   SG I L+   + +  +    L + A D     +G+  +S+   + VH+ RIN   P   +          ++          A+V   D DD    ++ +VSI+ G+  + F L +  G      +IK    I+ +S    Y +T++A D G+P K + +  +   N      P+   R++      S++ +    +   I       +D      + Y ++ G+    F I   SGLI   +PL  VK +  KLE+  ++  + +  T    D N
Sbjct:   81 YRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNREIQDNYLLIVKGSVRGED-LEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDL----FSVHPTSGVISLSGRLN-YDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHV--------VTHVPFSLEKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAK-EGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPI---RFEKEVYDVSISEFSPPGVVVAIVKLSPEPID------VEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLKAQVTISIEDAN 466          

HSP 27 Score: 83.5741 bits (205), Expect = 1.219e-14
Identity = 149/631 (23.61%), Postives = 268/631 (42.47%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLPQLVS-VYTLRIRASLKMVNSKILWYKDTDVSI-SVYDNVCKCTNHGYFTGSVEENS-DSEISVSNNI-LSCNGNSKVSFTLH----PKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGII--KVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENN-----AFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDV---IITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGL-AGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLI 9635
            F I +E+G I L++ L +  S  +  ++ A++ +    I++  D D+ +  + DN        Y T  +E     ++++    I +    N +V+++LH    P+   +    ++ T  I T  K +D E       SV+ +D       S   ++  +V D+NDN+P+F    + G V E+   G  +  +   D D+     + S      N     A  +      V++ + +DRE +  Y + +  +DG+ V +  + ++V+D NDN P +  ++     +    E    N  ++ ++A DAD    +N  IRYSL          S F L+ +SG L  K +AL    D E + V   +  A+D G    F    +H +         +  S   Y   V   +   + +  + AV+ D        + ++ +    FSI S +G I   + ++       +++ V+A       S+S  +   T+T+ + D N   P     +  V++ E    G+ +L V     D G  A I  L    +   +F + P  T G    + V   LDYE+  ++ L + A D G P  S  + V I + D +DN P F    + A + E D L+
Sbjct: 2756 FVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTL-KDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVSVSDVNDNSP-VCDQVAYTALL---PEDIPSNKIILKVSAKDAD--IGSNGYIRYSLYGSG-----NSEFFLDPESGEL--KTLAL---LDRERIPVYSLMAKATDGGG--RFCQSNIHLILEDVNDNPPVFSSD-HYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIILEQPLDREQQSS-YNISVRATDQSPGQSLSSLT---TVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINP-KTGG----ISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISE-DALV 3356          

HSP 28 Score: 83.1889 bits (204), Expect = 1.634e-14
Identity = 183/807 (22.68%), Postives = 329/807 (40.77%), Query Frame = 3
Query: 7791 YQTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYF-----TGSVEENS---DSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL-QGEENNAFSINPQNGSVFL-AQTVDRELKSKYEMKVAVSDGINVLE---IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIA--VNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLT-IITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL-IVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILDVFGASQENYP-KRLPLGRYSRLMIYLILPKIPHSQIHCLFKE-INSGNEIKFVPVIAQEGLVY--------NLLRISPK----VSKPFISVDRTTGYISTQRIIKIANILISAS 10109
            Y   F I++ SG I L++ L  +    Y L +RA  K    + +             +V +  +  YF      GSV+ENS    S + V+        + ++ +++           + E+  I TA   +DRE   +  ++V   D G   +  +    I+V D+NDN+P+ +   +   V EN+     +I I   D DS     L + +  G   N F+IN + G +   ++ +DRE ++++ ++V V+DG    +   I +++ V D NDN+PQ  +    K + I   E            A   D  +  N++I YS+   N        F ++  +G ++ +        D  T    I A D G+P    +  +H  +I        +  TF  P    +T  E  RV  I   V+       + F I+ GN  S F      G I  ++ +++     +   +    GT +  +  F        + + D N   P+       V+ISE +   + +LQ++  D D       KL+  + S+ D  S+  F  + ++  L     LD+E Q ++ L ++  D  FP +   + V++ V D +D+SPYF +  + AS+ E   L   + +V   D       E  YT+++  +  +   +      + I K     ++   +L +    Q + P     + R S  M     PK  H        E ++ G  +  +  I+Q  L+Y         +  I+P      ++  +  +RT+ Y   Q II+  N+   AS
Sbjct:  979 YNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDK---GRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVI-TAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPE----KVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGND----DGKFFIDPKTGMVSSRKQFTAGSYDILT----IKAVDNGRPQKSSTARLHIEWIKKP-PPSPIPLTFDEPF-YNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNVAVTQVF--------IKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKH----KLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGI-ITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSY---QLIIQATNMAGMAS 1751          

HSP 29 Score: 78.5666 bits (192), Expect = 3.835e-13
Identity = 128/544 (23.53%), Postives = 229/544 (42.10%), Query Frame = 3
Query: 8061 NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGE-------ENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD----GINVLEIGML-ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSE-NQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP-IAVLYTSQEGSRVAN-----IAVNHDNLY-GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQ 9629
            N KV FT+    +      + ET +++    P+DRE  +   +++ I D       S   + I V D NDNSP+F  + +   + E++ IG+ II +   D D           GE       +   F+IN   G V++A  +DRE K+ Y +K+   D    G  +  +  L + + D ND  P      I  ++ +   E       +  +   D D       Q+RYSL ++ N R      F +++ SG++ +    L++    +  ++ + A D+G+P    S++          ++     T  +P  AV+ + +E SR+        A + D+   GEI + I  G+G   FSI  ++G I+ +  ++   +G ++ L V A    ++   S       + + + D N  +P          + E      +++Q+   DPD+     +   I +     F  +   T            LD E Q ++ L +   D G   K  T  V+++VLDE+DN P F  + +   L E D+
Sbjct:  758 NGKVLFTISDGNTDSCFNIDMETGQLKVL-MPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKD-------LGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPA----FIPSSYSVKVLEDLPVGTVIAWLETHDPD--LGLGGQVRYSLVNDYNGR------FEIDKASGAIRLSK-ELDY-EKQQFYNLTVRAKDKGRP---VSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYW-LTVYATDRGVVPLYSTIE----VYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKT---GLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDR 1268          

HSP 30 Score: 72.7886 bits (177), Expect = 2.242e-11
Identity = 114/463 (24.62%), Postives = 197/463 (42.55%), Query Frame = 3
Query:  351 FLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDE------FGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE---FSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSK-QTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYR--DRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLET 1703
             L  K  +G+F  T  + + + +  D+   F  +     I EN   +T +++  A  +  +E          N +KI+S         SGV +Q  G        P DRE +E Y+L +    +        + V + +ED NDNSPVF    Y   +     PG  + +V A D D G N EV Y       VL+++   F I+  SG++ L +  +  ++  +  + + A D G PSLS    + + ++  N   P F   +      A+  E  ++    L+I     + Q     I   II G+    F ++   G   +L+ +  +      +Y +T+RA D    ++ + TVD+L+  N  N   P+F     + T+   + I + +    + D D+  N  + Y I +  Y   D F I+  SGLI   + L    +    L++ + D+G  SL +
Sbjct: 1952 MLIVKVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKS--------TSGV-IQTTGV-------PFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTY-------VLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIV--NKAMPVFDKPFY----TASVNEDIRMNTPILSINATSPEGQG----IIYIIIDGDPFKQFNIDFDTG---VLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLV--NDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSS 2376          

HSP 31 Score: 72.0182 bits (175), Expect = 4.416e-11
Identity = 131/561 (23.35%), Postives = 222/561 (39.57%), Query Frame = 3
Query:  144 VKFLSSQYNFRVSENQPINTIVGQVLIK---FGFSYEFFHKEGL--FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETK-EKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE---FSIDRKSGSIRLTQP-TSCHINQGDCTLVVEAFD---------------HGSPSLSAY-CYVTVHVIRI-----------------NSFFPKFRINYVGST-DKAAYIEIGKVTRKPLAI----VHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARD 1679
            ++F    Y+  +SE  P   +V  V +        Y+    E    F +N  +G+I+T+  ++        +E+   +  L+ Q   TISI+    D ND+ P F     +  + E++ + T +   +A+D D  E G    Y I S N      L  V  Q+ G  ++     LD E+  E Y+  +   D G P   +  + V I + + NDNSP+F        ++     G  +  V A D D       E +  K + +  NE   F ++  SG ++L +  T+  I  G+  L + A D               HG  S  ++ C  T    ++                 + F   + IN  G   DK+   ++      P+      +   D D      +  +I  GN ++ F ++   G + +L  +   H      Y + +   D GNP K +   + I +  AN   PVF     SV +  ++ I + I    A D D G NG++ YS+       +FAI   +G++ +   L         L+I ARD
Sbjct:  374 IRFEKEVYDVSISEFSPPGVVVAIVKLSPEPIDVEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLKAQV--TISIE----DANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYI-TYSIASLN-----LLPFVINQFTG--VISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDID-------ELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHT---DLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTD--TQQFAINSSTGIVYVADQLDRESKANYSLKIEARD 908          

HSP 32 Score: 71.633 bits (174), Expect = 4.883e-11
Identity = 102/401 (25.44%), Postives = 160/401 (39.90%), Query Frame = 3
Query:  630 LLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINS---FFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQ--SYTITVRAIDNGNPS--------------------------KQTTVDMLIRINKANIYF----------------PVFRNRYQS-VTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            L+   RPL+   KE YKL ++ ++     LK   +V I +ED ND++P F    Y   +NES   G  V+ V ASD D G N  + Y       +    F I++ +G I  T+      +      +V A D GSP    +   VT+ +  +N     F K     V S D      I  V+    AI      D D  +L+   II GN+   F L    G   +L+  K++ N  ++  ++ + + A D  N +                           Q   + L+   KAN                   P F   + S V V  +  + + I    A D D+G NGK++++I+ G+    F I+ ++G + +L P+     D   L I   D G
Sbjct:  428 LIVTARPLNTVKKEVYKLEVTNKEGD---LKA--QVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLL---PFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVS----AI------DIDELELVKYKIISGNELGFFYLNPDSG---VLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLG 807          

HSP 33 Score: 71.633 bits (174), Expect = 5.007e-11
Identity = 106/502 (21.12%), Postives = 225/502 (44.82%), Query Frame = 3
Query: 8157 VDREVYNNLEISVIIADGS--GGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKV-AVSDGINVL-------EIGMLITVTDSNDNRPQI----------SKEIINKTFVINT-SEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVA-LNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQ-YSLTLLAHDLGFPRKSQTSI-VLIKVLDEDDNSPYF 9587
            ++RE+ +N    ++I  GS  G  +E+   + I+V+D+ND  P+F+   +   ++E+  + + +  +   DAD       +     + + FS++P +G + L+  ++ + K++Y++++ AV  G+ +           + + +   N++ P I           KE       ++   + A+G I  V+I A D  D        ++ L+ E +         LNE      IK    ++W S     ++ + A D+G P    ++   ++       + I      Y +++   S  G  VA + ++ + +  ++ + +  G  + YF I  ++G I T+R +N+ +  + + L V      +         +  +T+ I D N ++P+ +       ++E + VG+++L V   D D G  G +  +I +      +L+PF  N  +  +     LD+E   + Y   + A D G P + ++ + V I++ + +DNSP F
Sbjct:  117 LNREIQDNY---LLIVKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLD--------QFFLAKEGK--------WLNE----YKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPI--DVEYKLSPGEDAVYFKINPRSGLIVTARPLNT-VKKEVYKLEVTNKEGDL---------KAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIAS-----LNLLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLF 578          

HSP 34 Score: 71.2478 bits (173), Expect = 6.600e-11
Identity = 141/534 (26.40%), Postives = 231/534 (43.26%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIV-----GQVLIKFG---------FSYEFFHKEG--LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLET-ISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLE--NEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVH---CQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRI-NKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDA 1682
            FL SQY+  +SE  PIN+IV       ++I+             Y+         F ++  TG I T   +D E++A     + +          E+ + + + + D NDNPP+F     E  ++    +  ++   +ATD D+ E      Y +  G+ D     S  GV     L ++     +  +K+ Y L + V D           V I+V++  D+   F+ S Y+  ++E+N    +V  V A    + +N+ ++Y      S+L   N+F I   SG I+ T        Q    LVVEA         A   V V++  IN   P F    VG      Y    +V  +P  +++     D D+ P     V+ +  +D   F +    GNV IL++       N++ Y +T+ A D G PS  T+V++ I I NKA    PVF   + + +V  +  +N+ I +  AT  +      IIY I  GD   +F I+ D+G++ ++ PL +      KL I A DA
Sbjct: 1769 FLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDS-EVPPELTYSLMEGSLDHFLIDSNSGV-----LTIKN----NNLSKDHYMLIVKVSDG---KFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNA--VGNRLNEPLKY------SILNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVF----VG----LPYYAAVQVDAEPGTLIYQVTAIDKDKGPNG--EVTYVLQDDYGHFEINPNSGNV-ILKEAFNSDLSNIE-YGVTILAKDGGKPSLSTSVELPITIVNKA---MPVFDKPFYTASVNEDIRMNTPILSINATSPEGQ---GIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDA 2263          

HSP 35 Score: 68.5514 bits (166), Expect = 4.128e-10
Identity = 138/601 (22.96%), Postives = 238/601 (39.60%), Query Frame = 3
Query: 8070 VSFTLHPKWSQDYLYYNAETNEIRTAH--KPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSK-YEMKVAVSDGINVL----EIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQ---PPLFHSITV----------------------HFLFITAECELRI------------------LKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLY-GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVL--DEDDNSPYFISRNF-VASLRELDQLIVLPEVRDEDSIMASRNEPSYTL 9701
            V + L P     Y   N  +  I TA     V +EVY  LE++    D    +       I + D ND++P F    +  +V+E+  +G+ ++ +   D D  +   + +S+       F IN   G +   + +D E   + Y   V  SD  +      E+ + I + + NDN P   K         +     H    +  ++A D D+ +     ++Y + S N+       F LN DSG L +K    N    N    + ITA+D G+    P+  +I+V                        L I A+   ++                     +F   +AV      G+ +  I A + D+ + G++ F I  GN  S F+I  + GQ+     ++      +  ++ +   G    SS         +T+ + D N  SP       +V+I E   +G+ ++QV+  D D G  G V  +++T T        F  N ++  + V + LD E +  YSL + A D     +   S+V +KV   D +D SP FI  ++ V  L +L    V+  +   D  +    +  Y+L
Sbjct:  407 VEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYK-LEVTNKEGDLKAQVT------ISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGH----ITAVSAIDIDELE----LVKYKIISGNEL----GFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATD-GENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRL------LTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQ------FAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSL 975          

HSP 36 Score: 68.1662 bits (165), Expect = 6.326e-10
Identity = 110/509 (21.61%), Postives = 201/509 (39.49%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILT-SNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN-NYKIESGNEDDRFAL---SGVGVQYRGQLLLRVVRPLDRETKEKYK-LTISVEDKGQPPLKGVLEVEI---IVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHAR 1754
            +  F +N  TG+I T S  +DRE  A   +E+ +       +   TI + V+++DENDN P F     + ++ E         +  A   D DE   +  +Y I  GN+D +F +   +G+ V  R Q            T   Y  LTI   D G+P       + I        +     F    Y   + ES+     V  V    A++ +       F       ++ F  ++  G+I + +P      +    + VE  D  +    A   V + V+  N   P+F + NY         + I +       I+  +  D+D +  ++ ++    D       R   +  +L   + + +     + + +   D   P ++    +++ +  AN + P F N     +V+ +A++ S +    A D D G N ++IY+I  G+  + F IE   G+IT+ K      + +  L I   D G   +  T  + +++  SD  H +
Sbjct: 1193 QNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPK-QSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGM-VSSRKQF-----------TAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANTPL------WFDIVGGNFDSAFDAEKGVGTIVIAKPLDAE-QRSIYNMSVEVTDGTN---VAVTQVFIKVLDNNDNGPEFSQPNY--------DVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPK 1670          

HSP 37 Score: 67.781 bits (164), Expect = 7.798e-10
Identity = 101/365 (27.67%), Postives = 155/365 (42.47%), Query Frame = 3
Query:  633 LRVVRPLDRETKEKYKLTISVEDKGQPPLKGV-----LEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQF---KKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIEIGKVTRKPLAIVHCQD-DDQDPRDLIAVSIIGGNDENIFALE--RTHGNVHILRQI-KAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +++ + LDRET   +   ++       PL  V     ++V+I V D NDN PVF  S Y   + E    G ++ +V A D D G N +V Y      +   V+E  F+ID  +G I   +    H      T  V A D G   SLS+   V+V V  IN   P F    Y G+  ++     G+V    +A++   D D  D    ++  I GGN    FAL   ++   V++ R + +   +I    Y + + A D G    Q  V+  + ++  N   PV      +  +  +   N  I    A D D G NG I YS+  G     F ++ +SG +  L  L   ++    L   A D G
Sbjct: 2765 IKLDKRLDRETSPAFHFKVA----ATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVME-AFNIDSNTGWISTLKDLD-HETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESD--PPGEV----VAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDI----YFLNITATD-GLFVTQAMVE--VSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSL-YGSGNSEFFLDPESGELKTLALLDRERIPVYSLMAKATDGG 3109          

HSP 38 Score: 63.1586 bits (152), Expect = 1.712e-8
Identity = 59/233 (25.32%), Postives = 112/233 (48.07%), Query Frame = 3
Query: 5469 NFTHDRYHFHIHETAPIHTVI-GQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVN----PDHGI--ITTQGE----IDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRV--------TVEVLINLINVNDETPLIH 6110
            +FTH  Y+  ++E +   T +  Q  +  +  + ++ IK+ IVS   +  F        D     I T+G     ++ E  ++Y+L++  + V  + L         T V + ++D+ND  P+F  T  +V+I E  P+ + + Q+ A+DAD      F     N   L +V+P +GVIS +G L+Y++  R+ L +   D   ++        T ++ +++  +N+  P IH
Sbjct:   42 HFTHSIYNATVYENSAARTYVNSQSRMGITLIDLSWDIKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNREIQDNYLLIVKGS-VRGEDL------EAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIH 267          

HSP 39 Score: 59.6918 bits (143), Expect = 2.181e-7
Identity = 140/585 (23.93%), Postives = 250/585 (42.74%), Query Frame = 3
Query: 7938 VSISVYDNVCKCTNHGYFTGSVEENSD--------SEISVSNNILSC-NGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWI-------IDIGVIDADSKLFPLKFSLQGEENNA---FSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVL----EIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +S+++ DN      H  +   V EN D        S IS S  I    +G+    FT++P        Y+     + T  K +D E  ++ ++ +I A    G+  +    I+++D NDN+P+F  + + G +SE A I S +       + I   DADS    L    Q  E+ A   F+++   G++     +D E  + +   V V D G   L     + + I VTD NDN P  ++ +     ++ T    +  + V+ ++ATD D       ++ YSL   +        FL++ +SG LTIK    N +S +  + +I+  SD G+   F+S ++  + +    +  +  +   Y  ++   +   ++VA +    + L   + + I+  N  + F I S +G I T+         + + L+V+A  ++ L  +        +   I D N  SP         ++    + G+ + QV  ID D G  G V   +    DD       P +GN    +  N     I  +Y +T+LA D G P  S +  + I ++++    P F    + AS+ E
Sbjct: 1659 ISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLIYEVKDGDINGIFTINP--------YSG----VITTQKALDYERTSSYQL-IIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNAL-LVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPT----YVGVEVLKVSATDPDSEVP--PELTYSLMEGSL-----DHFLIDSNSGVLTIKN---NNLSKDHYM-LIVKVSD-GK---FYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGNRLNEPLKYSIL--NPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEA--SRELDHLRVARVVVRVN--IEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVL---QDDYGHFEINPNSGNVILKEAFNSDLSNI--EYGVTILAKDGGKPSLSTSVELPITIVNK--AMPVFDKPFYTASVNE 2197          

HSP 40 Score: 59.3066 bits (142), Expect = 2.850e-7
Identity = 124/521 (23.80%), Postives = 215/521 (41.27%), Query Frame = 3
Query:  144 VKFLSSQYNFRVSENQPINTIVGQVLIKFG--------FSYEFFHKEGLFNLNKLTGVILTSNI-IDRESLASDLIEIFL-YKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDD--RFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVI--RINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGG--NDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITL-------LKPLW 1634
            + F  S Y+  +SEN   NT + +V I             Y   +    F +   +GVI T+ +  DRE    +L E+ +   + L+   +  + ++V I D NDN P+F        +  +    T I    A D D        N ++    +DD   F ++       G ++L+     D    E Y +TI  +D G+P L   +E+ I +   N   PVF    YT  +NE       ++ + A+  +      +       +     +F+ID  +G +++  P    +      L + A D  +    A   VTV ++   +N   P F +  Y  +  +A+ I        P+  V   D D +   ++   I+    N  + F ++ + G +   R +   H + +Q  T+ VR+ID+G PS  + V + I I+  N   PVF        V   A    F+    A+D D+    ++ YSI  G+ R  F ++  SG+ITL       ++PL+
Sbjct: 1980 LHFTQSFYSTSISEN---NTNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVPFDREE--QELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDK-----GPNGEVTYVLQDDYGHFEIN----PNSGNVILKEAFNSDLSNIE-YGVTILAKDGGKPSLSTSVELPITI--VNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPEGQGIIYIIIDGDPFK-----QFNIDFDTGVLKVVSPLDYEVTSA-YKLTIRASDALT---GARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLI------GTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLD--HEL-VQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLY 2465          

HSP 41 Score: 58.151 bits (139), Expect = 7.218e-7
Identity = 86/355 (24.23%), Postives = 150/355 (42.25%), Query Frame = 3
Query: 3693 FSINQHTGIIHLINRLDREAIAFHVLTIVATDNS-STKGSEYLAVT-NLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSG------ALYLNQ-------PVDYELKP-KWNFIITAFDLGYPALHSNLSVTVTITNINDEKP-RFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNS 4706
            FS++  +G+I L  RL+ +    + L I+A D      G+  ++ T  LYV+I  +N+++P         F L +      +    T +D+DDG NG++         ES+S+   D            +LN+        +D+E  P  +N  + A D G P   S L          D  P RF KE   +  + +    G  V  +    P+  +V Y L       + F INP SG++  + P L  V  ++  + V  +  D   Q ++ +   +D+  E Q   Y A +  +S      + T+ A    K  N    Y + + +    +IN++TG   +++T  ++F S
Sbjct:  204 FSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVV----TVDDLDDGANGEI---------ESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEV-YDVSISEFSPPGVVVA-IVKLSPEPIDVEYKLSPGEDAVY-FKINPRSGLIVTARP-LNTVKKEVYKLEVTNKEGDLKAQVTISIEDANDHTPEFQQPLYDAYV-NESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTG--VISTTEELDFES 538          

HSP 42 Score: 55.4546 bits (132), Expect = 4.186e-6
Identity = 84/327 (25.69%), Postives = 145/327 (44.34%), Query Frame = 3
Query: 2847 LRIELFDGLSGDLSVSNTEIIIEFHPIFDSPI-FFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNY-----HLSIIEESLYGKWSIFXXXXXXXXXXXXXXXR-KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGING-FVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVK-INPSPKSKQFFDKQTFFQNISEDMK--ITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDN 3791
            L +E  DG +  LS   T + I    + D+P  F +  Y+ V+ E++L       + L+ ++++D+      H SI+      ++++     L  + +    ER   YS  V AV+      S+   V I + D NDNSP+F+  +Y   I  +    T+I ++   D DS  NG   ++SI     E +FV +D   G L +  +    E  E++  + A+D G P+  S   + V+ I  S         + F   + +D    +  KI   + D   ++T+ + K  QK  F +N H G I  +  LD      +VL +  +D 
Sbjct: 3309 LVVEAKDGGTPALSAVAT-VNINLTDVNDNPPKFSQDVYSAVISEDALVGD---SVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFV-LDPH-GILRSAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFAL-KSEQKSLFKVNSHDGKIIALGGLDS---GKYVLNVSVSDG 3625          
BLAST of Protocadherin Fat 4 vs. Ensembl Human
Match: FAT1 (FAT atypical cadherin 1 [Source:HGNC Symbol;Acc:HGNC:3595])

HSP 1 Score: 219.164 bits (557), Expect = 1.447e-55
Identity = 287/1146 (25.04%), Postives = 497/1146 (43.37%), Query Frame = 3
Query: 2733 FANITGRFHQHFYYIIQEQIVVLKDSFVDKNVNGRLIELRIELFDGL-SGDLSVSNTEIIIEFHPIFDSPIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLS--IIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVEL-DFVEIDSQSGRLFTNKLVDVVEQEFI-FFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISK-----CTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRL-TATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYP-ALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE----VLYYLQSVHPPDHPFVINPISGILSV--SNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHN--LNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIY--------LDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGT----VQAHDKDLDSTLEYIWI----NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD---LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD 6038
            ++ ++G  H+HF  +I     ++  S + ++       L + + DG+      V  T I    H    SP F +  Y   + EN+  HT + ++      +    H++  I+ +    ++ I   G ++ L +LD E   +   +V  + K+   K     V + + D NDN+P F    Y  +I       T++ KV A D D G N  + Y+IE     + + +EI+  SG + T + +  +E EF  FF+ A D+G P   S V VYVKI P       F +  +   +SED+ I  +I  +  +H   V Y + K       +  +F I++ +G + L   LD E   ++  +I+A    +    E +A  ++ + + D NDNSP+F++     FI+ E+   G+ +    A+D D G NGQV Y L  +  +E I  F I+  +G +   + +D+E +  +   + A D G    L S   V VT+T++ND  PRF  E   +  V ++   G  +  +   D D+ E    V Y++    P    F +  I     V    P+ +E   ++ L + A D     +   + VKV   +DN    +   Y   I P+     + I  + A       N+   Y L  S  +K  +N  TG+  L ++TP++     +  L+   +   D   ++    +VL + D ++    F  + Y   + E  T PG  L R+QA               D   G++ +I        +D   G  S+  +         LDRE+   +  T+ +  +D+G          V +++ D NDN PVF    +        T  + I VGT    V A  +D+++  E  +     NE  +FS+D  +G V      LD+E+   +   ++ +DG   S +++  +  +  D   N   F+ D Y   I E A +   +  V   ++    N  I + I+       F+++P  G +     +D E  + Y L + A+D              TTTV + + D+NDN PVF     +V I E+ P+   ++QL+ +D D S       F I++ ND+    VNP  GV+ T+  +  ++ + + L V   D
Sbjct: 2429 YSILSGNDHKHF--VIDSATGIITLSNLHRHALKPFYSLNLSVSDGVFRSSTQVHVTVIGGNLH----SPAFLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYINERGQIFTLEKLDRETPAEKVISVRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVVKVLASDADEGSNADITYAIEADSESVKENLEINKLSGVITTKESLIGLENEFFTFFVRAVDNGSPSKESVVLVYVKILPPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDESFVIDRQSGRLKLEKSLDHETTKWYQFSILA--RCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIV-ENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEI-YKGTVSEDDPQGGVIAILSTTDADSEEINRQVTYFITGGDPLGQ-FAVETIQNEWKVYVKKPLDREKRDNYLLTITATDGTFSSKAIVE-VKVLDANDNSPVCEKTLYSDTI-PEDVLPGKLIMQISATDADIRSNAEITYTLLGSGAEKFKLNPDTGE--LKTSTPLDREEQAVYHLLVRAT---DGGGRFCQASIVLTLEDVNDNAPEFSADPYAITVFE-NTEPGTLLTRVQAT--------------DADAGLNRKI----LYSLIDSADGQFSINELSGIIQLEKPLDREL--QAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREY------GATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIE-NLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDADGPSNSHIHYSIIDGNQGSSFTIDPVRGEVKVTKLLDRETISGYTLTVQASDNGSPP------RVNTTTVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTIVTGNDEKAFEVNP-QGVLLTSSAIKRKEKDHYLLQVKVAD 3521          

HSP 2 Score: 170.629 bits (431), Expect = 5.955e-41
Identity = 308/1357 (22.70%), Postives = 543/1357 (40.01%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKS--TKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVE----IDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSV--------KVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYL-NQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKE------SRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDH-PFVINPISGILSVSNPILQEVSFD-LVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKII-INRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFS-------LDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDG---TFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQ-------LIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVE----VLINLINVNDETPLIHNP---TTVYLPKINQNHNIMIKCSDQDN--LGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKN-----YTAFIKLERFEKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGEFKPIEGFAPRKHEYRFTIAGIKRDSLNQENQINIETILTYKEIELCYPSFLGTPY------SFQIDHRVTAPKYLGSVSVGYCSNQKILYYLSSGHSFFYVNGTSGDIFITRDLPLGQYKFKLSSLIDTNPKTYLSTIVTVSTMGP 6989
            + ++S  + A ++  +E    + V V + ++D NDN P F   +Y   +       T I  + A DPD G +G V YS+      LD  E    +D  SG +   + +D  +++ +   + A+D G P   SS          V   ++P P    F +K T    + ED  +   +  +    +       + Y I   +  G F I + TG+I   +RLDRE+ + + LT+ ATD      S ++ +   Y+ + DVNDN+P          I+  S K  +++    A D D   N ++ Y++T+   +    F I   +G +   ++ +D E + +    +T  D G P   +   V V I + ND KP+F ++         E   ++  A    +  V A D D     E+ Y ++  +  +H  F I P +G++S S        +D L + AVD  R  +     + +      +  ++ +++       +    + +A +    + +       + +   +YD    +++ TG + +      E  S    + +++E+    T I       V++  D H   F  + Y   IPE  T P  ++ ++ A+       D +     IY   S R  L     RLD  TG +      LD E +      + V+V D+     R    ++ +N+ D ND+ P F   ++     E+   G  +    V A DKD     E ++  E   F        +D   G + T+   LD    A +   ++ +D      +   ++ I +  A++    FT   Y   + ET  I + +G VT  + ++     + ++I        F +NP  G I TQ  +D+E    Y L+I  T+++  S          TTVLV + D NDN PVF        I E   INS ++        + A+DADK    LL++ I+ P+      ++  TG I T   LDYE+T     TV   D G  R+  E    V +++I++ND  P+   P    ++ LP       I +  +D D+     L Y I T     +   +D  TG ++        +   +++  SD     + +V + V +   S        Y+A +K    E   L + +       P ++   Y +L         D  F  I+ ++G          R+ +  F +     +        ++   +  ++     P F+  PY        ++ H +   +Y+ +V      N ++ YYL   H  F +             PLG+   K    +DT  K YL T+V      P
Sbjct:  888 QHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSL------LDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHP-PVFSSFVEKGT----VKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGSGVGVFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLSSFIEI---YIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQI-EAFDPDSSSNDKLMYKITSGNPQGF--FSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKPDRERNARREPLYHVIATDKDEGPNAEISYSIEDGN--EHGKFFIEPKTGVVS-SKRFSAAGEYDILSIKAVDNGRPQKSSTTRLHIEWISKPKPSLEPISFEESFFTFTVMESDPVAHMIGVISVEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKS---NYNLTVEATDGTTTILTQVFIKVIDTND-HRPQFSTSKYEVVIPE-DTAPETEILQISAV-------DQDEKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTSE-KLDHEAVPAH---LTVMVRDQDVPVKR-NFARIVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVL--QVTALDKDKGKNAEVLYSIESGTFGNIGNSFMIDPVLGSIKTAK-ELDRSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTAHSQSS-----VVYEIKDGNTGDAFDINPHSGTIITQKALDFETLPIYTLIIQGTNMAGLS--------TNTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSI-TEGNIGEKFSMDYKTGALTVQNTTQLRSRYELTVRASDGRFAGLTSVKINVKESKESHLKFTQDVYSAVVKENSTEAETLAVITAIGN---PINEPLFYHILNP-------DRRFK-ISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVI---RYVTAVDRDSGRNGEVHYYLKEHHEHFQIG------------PLGEISLKKQFELDTLNKEYLVTVVAKDGGNP 2164          

HSP 3 Score: 164.851 bits (416), Expect = 4.020e-39
Identity = 248/1025 (24.20%), Postives = 447/1025 (43.61%), Query Frame = 3
Query: 3144 QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGI--PRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI---DHQQMVTYRISKCTQ-KGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFD---LVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVL-TYGAIILP-------KSSFYREKIATLKAQSNSKNLNSRFMYLLKNSS-YDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLN-IGDP----HNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWIN-----EIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN--FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHL---FSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD--GLHRVTVEVLINLINVNDETPL 6104
            +Y+  +   +    +K+    + + V D NDN P F  +SYF  ++   + ++ I +V A D D G NG V YSI     + D   IDS +G +   + +D  ++ E    I A D     P+L S+V V V +     +   F    +   + ED+     I  LE    D  Q    R S     +G F +++ +G + ++ +LD E    + LT+ A D              + V  ++ N + P+F +  +    + E   VG+++   +A+D D   +G++RY +       + VFKI   +G +  +  +D E    +   + A D G   L S + + + + ++ND  P+ ++      I+ +N     +V ++ A DPD  +N+ L Y  +   P   F I+P +G+++ ++  L     D   L V   D     +     V V I  +N+++ Q L  +  I LP       + +  RE +  + A    +  N+   Y +++ + + K  I   TG V     +   F++     ++S++++ +    K  +T+L +  I  P      ++F+++ + F + E      + +  +    PG P+       FDI  G  +      +   +DK TG I V    LD E      +TVE        +G+    T+VF+ + D ND+RP F+   +    PE+T    +I    + A D+D  + L Y   +      + +F LD  +G + TS   LDHEAV   +  +              I+++ ++   H   FT   Y   ++E+A + +V+ QVT  +     N  + + I S    ++   F ++P  G I T  E+D      Y L++ ATD        P  E  +  + V+I D  +  P F +   +V + E V I S  + ++ + +  S  +++EI   N      +NP +G I T   LD+E    + L +  T+  GL   T  VL++L + ND  P+
Sbjct:  787 KYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSEIIQVEATDKDLGPNGHVTYSIV---TDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSS-FVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGS--GVGVFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTSEPVYYPEIM-ENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKPDRERNARREPLYHVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVV-----SSKRFSAAGEYDILSIKAVDNGRPQKSSTTRLHIEWISKPKPSLEPISFEESFFTFTVMESDPVAHM-IGVISVEPPGIPL------WFDITGGNYD------SHFDVDKGTGTIIVAKP-LDAEQKSNYNLTVEAT------DGTTTILTQVFIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEIL--QISAVDQDEKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTSE-KLDHEAVPAHLTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGTFGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSP----PMSEITSVRIFVTIAD--NASPKFTSKEYSVELSETVSIGS-FVGMVTAHSQSS--VVYEIKDGNTGDAFDINPHSGTIITQKALDFETLPIYTLIIQGTNMAGLSTNTT-VLVHLQDENDNAPV 1766          

HSP 4 Score: 159.844 bits (403), Expect = 1.256e-37
Identity = 265/1108 (23.92%), Postives = 475/1108 (42.87%), Query Frame = 3
Query: 2943 FFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNII--DVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEV---LYYLQSVHPPDHPFVINPISGILSVSNPILQEV----SFDLVVMAVDAERQDRYDQQSVKVHIK------H-----DNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNS-SYDKIIINRYTGDVF----LTSTTPVEFNSIDITFLISLESLRSDT--LIKYHSTKLVLNIGDPHNLNFQKNDYFFQI--PECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKI------YVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSG-----VPLDHEAVAYF----IGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHL---FSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDL---LLFEILSPNDDLLMTVNPITG--VISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETPL 6104
            F +  Y+ VVKENS     L  I+ I +   +     I+      K S  S       +  D E+++ +   V    ++       V V + V+D NDN+P+F    Y+  +   T+    I  V A+D DSG NG V+Y +++         +   S  L     +D + +E++  + A+D G P    S +V V I    K+   F+K  +   I+E +++   +  ++ +  +   V Y I+       F+IN +TG+I++I  LD EA   + L+I ATD+ +   +E      ++V+II  D+NDN P+F   +     LSE++ +GT +    A D D   N  + Y++     +S   F +D+ +G + L + +DYE   +    + A D G P L S++ VTV +T++ND  P F ++   E  + ++   G  V  V A D D++++    Y + S +   H FVI+  +GI+++SN     +    S +L V        D   + S +VH+       H      NE E++        L +++     +  +K       +     Y + N  + D+  IN   G +F    L   TP E        +IS+  +  D    + + +  ++L   + +   F+   Y   I     K T  +K+    A    N  +D+ Y I       SE +K     + ++K +G I+     +    +E    T  V  +D G + S+     V++ I       P F+   + F   E+   G +I      + GTV          L  +     PE + D++  I   SG       LDHE   ++    + +    D    ++ ++ I + DAND    F    Y   I E  P  + + Q+   ++ +  N  + + +       +   F++N + G ITT  E+D+E+ ++Y + + A+D  ++        + T  V V++ D+ND+ P F       ++ ED P    I  L  +DAD  ++   + + I   +      V  I     +     LD EK + + LT++ TDG       V + +++ ND +P+
Sbjct: 1981 FTQDVYSAVVKENSTEAETLAVITAIGNPINEPLFYHILNPDRRFKISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTAVDRDSGRNGEVHYYLKEHHEHFQIGPLGEIS--LKKQFELDTLNKEYLVTVVAKDGGNPAF--SAEVIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPEGLKVFYSITDGDPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAE------VFVDIIVDDINDNPPVFAQQSYA-VTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQI-YEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKH-FVIDSATGIITLSNLHRHALKPFYSLNLSV-------SDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVE--------LAENAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYINE-RGQIFTLEKLDRETPAE-------KVISVRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVVKVLASDADEGSN--ADITYAIE----ADSESVK---ENLEINKLSGVITTKESLIG---LENEFFTFFVRAVDNG-SPSKESVVLVYVKILPPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAEHSGTV----------LYSLVKGNTPESNRDESFVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQIKVVASDHGEKIQL-----SSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAILSTTDADSEEINRQVTYFITGGDPLGQFAVETIQNEWKVYVKKPLDREKRDNYLLTITATDGTFSSKAIVEVKVLDANDNSPV 3024          

HSP 5 Score: 147.132 bits (370), Expect = 7.413e-34
Identity = 145/498 (29.12%), Postives = 225/498 (45.18%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESG---NEDDRFA---LSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPP-LKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNG-KIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQ 1733
            F LN  TG + TS  +DRE  A   +   L + T  G      SI + + D NDN P F  +     + EN    T ++   ATD+D    G+  N KI      + D +F+   LSG+         +++ +PLDRE +  Y L++   D+G P  L     V + V D NDN PVF   +Y   ++E  L G EV++VYA+  D   N E+ Y           +FSID K+G++ + +    + +  +  L VEA D G+PSLS    V V+V  IN   P F +  Y     + A +E   +T      V   D D      I  SII GN  + F ++   G V +    K +    +  YT+TV+A DNG+P +  T  + I ++  N   PVF     SV +  N  +   +     TD D+  NG    ++I  G+    F +    G++     +   + D   L++   D G   L +  Y+D+ +++
Sbjct: 3072 FKLNPDTGELKTSTPLDREEQA---VYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQATDADA---GL--NRKILYSLIDSADGQFSINELSGI---------IQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNE--HGKFSIDSKTGAVFIIENLD-YESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVIT------VMADDADGPSNSHIHYSIIDGNQGSSFTIDPVRGEVKV---TKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTIVTGNDEKAFEVNP-QGVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIE 3539          

HSP 6 Score: 137.887 bits (346), Expect = 4.638e-31
Identity = 119/494 (24.09%), Postives = 229/494 (46.36%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE----------FIFFITAEDHGIP-RLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLK 4571
             +Q  + +L    +   +  +  +V+ ++D NDN+P FS   Y  ++  +T+P T + +V A D D+G+N  + YS+           IDS  G+   N+L  +++ E          +   + A D G+P RL ++  V V +     +   F+ + +   +SED+ +  ++ ++     +I+    +TY I    + G FSI+  TG + +I  LD E+   + LT+ ATD  +   S+   V  + VN+ D+NDN+P+F  D     I  ++    +++    A+D D   N  + Y +        S F ID   G + + + +D E    +   + A D G P   +  +V + ++++ND  P F++      I+Q+N  +G +V ++   D D+        S + P  PF    ++G    ++    EV+   V++   A ++   D   ++V +  + + ++  LTY  I + + S Y   I  L+
Sbjct: 3090 EEQAVYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSL-----------IDSADGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEYYLTVEATDGGTPSLSD---VATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVM-ADDADGPSNSHIHYSIIDGNQG--SSFTIDPVRGEVKVTKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSR-GNYSVIIQENKPVGFSVLQLVVTDEDS--------SHNGP--PFFFTIVTG----NDEKAFEVNPQGVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLE 3551          

HSP 7 Score: 134.806 bits (338), Expect = 3.923e-30
Identity = 140/540 (25.93%), Postives = 231/540 (42.78%), Query Frame = 3
Query:  165 YNFRVSENQPINTIVGQV---------LIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTL---EGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFR---INYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKG---DYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGIN-SLETTGYLDLNI 1727
            Y  R+SE+ P    V  V         + K  +S    +    F ++  TG+I  SN+  R +L         Y   L   +G F  +  + V +I  N + P F  N+ E  + EN  L T +     TD D+  +G    Y I +    DRF      +  RGQ+    +  LDRET  +  +++ +  K          V +I+ D NDN+P F  +KY V +  S   G  VVKV ASDAD G N ++ Y  +     ++    I++ SG I  T+ +   +     T  V A D+GSPS  +   V V ++      PKF      +  S D     EI  +  +    V           L+  +    N +  F ++R  G + + + +          ++I  R   + +     +VD+ I++  AN   PVF +      +  N    S +    A+D D+G NG+++YS+ +    +  + FAI  ++G IT LK L   K D  +++++A D G    L +T  +D+ +
Sbjct: 2397 YEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNL-HRHALKP------FYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYG-HVTYHIVNDFAKDRFY-----INERGQIF--TLEKLDRETPAEKVISVRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVVKVLASDADEGSNADITYAIEADSESVKENLEINKLSGVI-TTKESLIGLENEFFTFFVRAVDNGSPSKESVVLVYVKILPPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAEHSGTVLYS--------LVKGNTPESNRDESFVIDRQSGRLKLEKSLDH-ETTKWYQFSILARCTQDDH-EMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTV 2910          

HSP 8 Score: 134.806 bits (338), Expect = 4.023e-30
Identity = 142/568 (25.00%), Postives = 259/568 (45.60%), Query Frame = 3
Query: 2892 SNTEIIIEFHPIFDS-PIFFEP-FYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVD--VVEQEFIFFITAEDHGIP-RLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIF---KLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDR---EAIAFHVLTIVATDNSSTKGSEYLAVT--------------------------------------NLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFD--LVVMAVDAERQD 4442
            S+ ++I    P F + P+ FE   Y   + E +  +TP+  +  I + +    HL  + +S  GK     + +  L+S L+  +R+Q +   L V  +D++ STKV V +     N N P F+  +Y  + + +    TT+  + A+DPD G NG+V YSI  L   + F  ID  +G + T++ +D  ++ + +   I A D G+P R    V   + +N    +   F+K      I  D+ + E+I     ++ D  Q+V Y+I    +   FS+N ++G++ L   L       ++FH L I ATD  +     Y+ +T                                      +++ +   VN + P F++       + E+  VG+ + F  + D+D G NG++ Y +  +G    S F ID  +G L +  P+D E   K+   IT +DLG P   +   + V + + ND  P F +ES     V ++  + + + +V A D D     +   S+      F I+ ++G+++++ P+ +E+  +  L + A D  R++
Sbjct:  348 SSVKVIHVTSPQFKAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPAYS----HLRYVFKSTPGKAKFSLNYNTGLISILEPVKRQQAAHFELEVTTSDRKASTKVLVKVL--GANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYSIANLN-HVPFA-IDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQLVQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAV--SGGNEDSCFMIDMETGMLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYF-VEVSEDKEVHSEIIQVEATDKDLGPNGHVTYSIVTDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREE 904          

HSP 9 Score: 133.65 bits (335), Expect = 1.010e-29
Identity = 154/550 (28.00%), Postives = 247/550 (44.91%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADG---SGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGIN-VLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSL--SSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQE---GSRVANI-AVNHD-NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQAC--GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE-------LDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQ 9737
            KP+DRE  +N  +++   DG   S  I+E     +KV+D NDNSP+     +   + E+ L G  I+ I   DAD +    + ++L G     F +NP  G +  +  +DRE ++ Y + V  +DG     +  +++T+ D NDN P+ S +     + I   E       +  + ATDAD     N +I YSL  S++ Q       F +NE SG + ++      +    T+   + A D+G P     +T     I +  ++      F+Y       S++   G+ V  + A + D     EIT+ IISGN    FSI SK G +    N++     +++ L V+A   GT  LS V+      T+ + ++D N  +P       T  ISE   +  +++ V   D D      +  +II       S    P  G   ++KV   LD E    Y+LT+ A D G P +  T+ V I V D +DN+P F   N+   ++E       + QL+V     DEDS   S N P +     T +  + F+
Sbjct: 2984 KPLDREKRDNYLLTITATDGTFSSKAIVE-----VKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAEITYTLLGSGAEKFKLNPDTGELKTSTPLDREEQAVYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEFSAD----PYAITVFENTEPGTLLTRVQATDAD--AGLNRKILYSLIDSADGQ-------FSINELSGIIQLEKPLDRELQAVYTLS--LKAVDQGLP---RRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEYY-LTVEATDGGTPSLSDVA------TVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDADGPSNSHIHYSIIDGNQGS-SFTIDPVRG---EVKVTKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVT----DEDS---SHNGPPFFFTIVTGNDEKAFE 3492          

HSP 10 Score: 133.265 bits (334), Expect = 1.401e-29
Identity = 129/468 (27.56%), Postives = 207/468 (44.23%), Query Frame = 3
Query:  312 IDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQY------RGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQS---YTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +DRE   + L+ I       +G F     ++V+++D NDN P+         I E++     I   +ATD+D     + +N +I        + L G G +        G+L  +   PLDRE +  Y L +   D G    +    + + +ED NDN+P FS   Y + + E+  PG  + +V A+DAD+G+N+++ Y    +    + +FSI+  SG I+L +P    + Q   TL ++A D G P  L+A   V V V+ IN   P F     G+T     +   +V +     V+    D +    I  SII GN+   F+++   G V I      I N++ +S   Y +TV A D G PS      + + +   N   PVF     +  +  +A +   +    A D D   N  I YSI  G+    F I+   G + + K L    +    L + A D G
Sbjct: 2986 LDREKRDNYLLTI----TATDGTFSSKAIVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDAD-----IRSNAEI-------TYTLLGSGAEKFKLNPDTGEL--KTSTPLDREEQAVYHLLVRATDGGGRFCQA--SIVLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSLIDS---ADGQFSINELSGIIQLEKPLDREL-QAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQ-----VYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFI------IENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDADGPSNSHIHYSIIDGNQGSSFTIDPVRGEVKVTKLLDRETISGYTLTVQASDNG 3418          

HSP 11 Score: 132.88 bits (333), Expect = 1.756e-29
Identity = 228/1038 (21.97%), Postives = 445/1038 (42.87%), Query Frame = 3
Query: 3315 VFAMDPDSGINGFVNYSIEKLPVELDFV--------EIDSQSGRLFTNKLVDVVEQEFIFFITAE-DHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL---EIDHQQMVTYRISKCTQK---GAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESIS-VFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRF-NKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFY------REKIATLKAQSNSKNLNSRFMY-LLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCG-ISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDN-HYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDL-LMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLI--NVNDETPLIHNPT---TVYLPKINQNHNIMIKCSDQD---NLGPLSYDIMTS-SKDIQNIYVDRITGKVSFNPGLLYANS 6299
            V   DP + + G ++     +P+  D          ++D  +G +   K +D  EQ+  + +T E   G   + +  +V++K+  +   +  F    +   I ED     +I ++   + D +  + Y +           F ++  TG ++   +LD EA+  H+  +V   +   K +       + VN+ D ND++P F   +    +  ES  VG+++   TA D D G N +V Y + +    +I   F ID   G++   + +D   + +++ ++ A D G P +    SV + +T  ++  P+F +KE  +E    + V+IG+ VG V A     + V+Y ++  +  D  F INP SG +     +  E    + L++   +           V +  ++DN        Y  +I   +S        R     ++A    K+ N+  +Y +++ S +    I+  TG +    +   E  SI   F + +  + +  L   ++  + +++ D ++    F K  Y   +    T  G+K+  + A    +  S     I+ I  G I E+  +       D +TG ++V N    R   E   +TV      R  +G     T V +N+++  ++   F  + +     EN+T  + + V  + A    ++  L Y  +N    F + +TSG+++T+G P D E    F   ++V++    S    +++     DQ  N   F +  Y+  +     +  VI  VT  +  +  N  + +  + E  +H F + P  G I+ + + + +  N  Y++ + A D    +         +  V+V I  +N  +PVF+    +  I E + ++S ++ + A+  +   L +F  ++  D     T+N  TGVI+    LD+E    + L++  TD L     EV +++I  ++ND  P+    +   T+    +     + ++ +D D   N G +SY +  + SK   + +VD  TG +S    L Y  S
Sbjct: 1367 VMESDPVAHMIGVISVEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDA-EQKSNYNLTVEATDGTTTILT--QVFIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEILQISAVDQDEKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTSEKLDHEAVPAHLTVMVRDQDVPVKRN----FARIVVNVSDTNDHAPWFTASSYKGRVY-ESAAVGSVVLQVTALDKDKGKNAEVLYSIESGTFGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSKEYSVEL--SETVSIGSFVGMVTAHS--QSSVVYEIKDGNTGD-AFDINPHSGTIITQKALDFETLPIYTLIIQGTNMAGLSTNTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETSI-FHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASL-LLPTYKGVKVITVNATDADS--SAFSQLIYSITEGNIGEKFSM-------DYKTGALTVQNTTQLRSRYE---LTV------RASDGRFAGLTSVKINVKESKESHLKFTQDVYSAVVKENSTEAETLAV--ITAIGNPINEPLFYHILNPDRRFKISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTAVDRDSGRNGEVHY-YLKEHHEH-FQIGP-LGEISLKKQFELDTLNKEYLVTVVAKDGGNPAF--------SAEVIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPEG--LKVFYSITDGDPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVDDINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRG-ISYQMFGNHSKSHDHFHVDSSTGLISLLRTLDYEQS 2355          

HSP 12 Score: 132.494 bits (332), Expect = 1.974e-29
Identity = 140/546 (25.64%), Postives = 246/546 (45.05%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIV-------------GQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDP--RDLIAVSIIGGNDENIFALERTHGNVHIL----RQIKAIHNINLQSYTITVRAIDNGNPSKQT-TVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            F SS Y   + EN P  + V             GQV+     S      E  F +N  TG I T   +D E   +  I++       + Q   T  + V + D ND+PP F     +  + E+      I++ + TD+D++E      Y I  G+   +FA+  +  +++    + V +PLDRE ++ Y LTI+  D G    K ++EV+++  D NDNSPV   + Y+  + E  LPG  ++++ A+DAD   N E+ Y    + +    +F ++  +G ++ + P      Q    L+V A D G     A   +T+  +  N+  P+F      S D  A I + + T     +   Q  D D      I  S+I   D   F++    G + +     R+++A+       YT++++A+D G P + T T  +++ +   N   PVF  R    TV  +  + + +   +A   D   N +I YSI  G+   +F+I+  +G + +++ L +    +  L + A D G  SL     +++N+
Sbjct: 2811 FESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIES-FAINMETGWITTLKELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAILSTTDADSEEINRQVTYFITGGDPLGQFAVETIQNEWK----VYVKKPLDREKRDNYLLTITATD-GTFSSKAIVEVKVL--DANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAEITYTLLGSGA---EKFKLNPDTGELKTSTPLDRE-EQAVYHLLVRATDGGGRFCQASIVLTLEDVNDNA--PEF------SADPYA-ITVFENTEPGTLLTRVQATDADAGLNRKILYSLIDSADGQ-FSINELSGIIQLEKPLDRELQAV-------YTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNV 3327          

HSP 13 Score: 130.568 bits (327), Expect = 8.195e-29
Identity = 231/985 (23.45%), Postives = 417/985 (42.34%), Query Frame = 3
Query: 3153 FTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGK-------VFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRL----NSSVKVYV-KINPSPK--SKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGAL-YLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEF--IVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIA--------TLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN---FQKNDYFFQIPECKTTPGLKLFRLQAL-YPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLD--STLEYIWI--NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLI--TATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLL--MTVNPITGVIST 5978
            +T++    N    ST   V++ +QD NDN+P+F    Y   I+     N+ +         + A D D   N  + Y I +  V   F  IDS +G + T   +D  E   F F +   D G PRL     ++V V+V  IN  P   +K  ++             IT      +      + Y I++      FS++  TG + + N    +  + + LT+ A+D        +  +T++ +N+ +  ++   F  D  +  +   ST+  T L   TA  I + +N  + Y +    +     FKI   SG L     P D E +  ++ ++   +   P+  +++ V V + + ND  P F     L +  +V+ +  +G  +  V A D D+    EV YYL+  H  +H F I P+  I       L  ++ + +V  V  +  +      V V I   N+         A+ + +  FY  +IA         +  Q+NS      F  +     + +  IN  TG   +    P++F +    + +S+ +  +D+L   H+   V  I D  N N   F +  Y   + E     G  + +++A      P   + Y +F  +    +          +D  TG IS+    LD E  +  Q T+ V  +D G   +      V +++ D NDN P+F  + +     E+  +G   +V  V+A+D D      L+Y  +  N+   F +D  +GI+T S +   H    ++   + VSDG F S+  + + +   N     F  + Y   + E AP+HT++ +V   +  +     + + IV+++ K  F +N + G I T  ++D E     ++ +   A D   +  F         TV V + D NDN P F  T+  V+I       + +++++ASDAD+     + + I + ++ +   + +N ++GVI+T
Sbjct: 1735 YTLIIQGTNMAGLSTNTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFA-IDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSMDYKTGALTVQNTT--QLRSRYELTVRASDG------RFAGLTSVKINVKESKESHLKFTQDVYSAVVKENSTEAET-LAVITA--IGNPINEPLFYHI----LNPDRRFKISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVF---VNLPYYAVVKVDTEVGHVIRYVTAVDRDSGRNGEVHYYLKEHH--EH-FQIGPLGEISLKKQFELDTLNKEYLVTVVAKDGGNPAFSAEVIVPITVMNK---------AMPVFEKPFYSAEIAESIQVHSPVVHVQANSPEGLKVFYSITDGDPFSQFTINFNTG--VINVIAPLDFEA-HPAYKLSIRA--TDSLTGAHAEVFVDIIVDDINDNPPVFAQQSYAVTLSEASVI-GTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHF-------HVDSSTGLISLLRT-LDYE--QSRQHTIFVRAVDGGMP-TLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGH--FVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNL-HRHALKPFYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYIN-ERGQIFTLEKLDRETPAEKVISVRLMAKDAGGKVAFC--------TVNVILTDDNDNAPQFRATKYEVNIGSSAAKGTSVVKVLASDADEGSNADITYAIEADSESVKENLEINKLSGVITT 2659          

HSP 14 Score: 127.102 bits (318), Expect = 9.448e-28
Identity = 121/426 (28.40%), Postives = 185/426 (43.43%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFAL-SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGK-VTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLD 1526
            +G F++N+L+G+I     +DRE  A   + +    + L  +   T ++ V ++D NDNPP+F   +    + E+I + T++    A   D  E      Y I SGNE  +F++ S  G  +       ++  LD E+  +Y LT+   D G P L  V  V + V D NDN+PVFS   YT  ++E  +    V+ V A DAD   N  + Y          + F+ID   G +++T+        G  TL V+A D+GSP       V + V  +N   P F R NY      +  I+  K V    L +V   +D          +I+ GNDE  F +        +L    AI       Y + V+  DNG P   +   + IR+ + +IY P        +T          I    ATD D
Sbjct: 3171 DGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDI-EANAEITYSIISGNEHGKFSIDSKTGAVF-------IIENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDADGPSNSHIHYSIIDGNQ--GSSFTIDPVRGEVKVTKLLDRETISG-YTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNY------SVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTIVTGNDEKAFEVNPQG----VLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLEIFITSSGEEYSGGVIGKIHATDQD 3575          

HSP 15 Score: 122.094 bits (305), Expect = 3.050e-26
Identity = 107/360 (29.72%), Postives = 167/360 (46.39%), Query Frame = 3
Query:  630 LLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF--RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHG-----NVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDK-IKLEIIARDAG 1685
            ++ V+ PLD E    YKL+I   D        V  V+IIV+D NDN PVF+   Y V L+E+++ G  VV+V A+D+DS  N+ + YQ     S   + F +D  +G I L + T  +      T+ V A D G P+LS+   VTV V  +N   P F  +I     ++ A +          +  V   D D    D +  SI+ GND   F ++   G     N+H    +K  +++NL       R+      S Q  V ++      N++ P F      V +  NA +++ +     TD D+G+ G + Y I     +DRF I +   + TL K       +K I + ++A+DAG
Sbjct: 2237 VINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVF-VDIIVDDINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTGLISLLR-TLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGHF-------VTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNLH-RHALKPFYSLNLSVSDGVFRS------STQVHVTVI----GGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYINERGQIFTLEKLDRETPAEKVISVRLMAKDAG 2576          

HSP 16 Score: 120.168 bits (300), Expect = 1.204e-25
Identity = 137/540 (25.37%), Postives = 233/540 (43.15%), Query Frame = 3
Query:  174 RVSENQPINTIV---GQVLIKFGFSYEFFH------KEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGV-GVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKG--QPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINSFF--PKFRINYVGSTDKAAYIEIGKVTRKP-----LAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLL-KPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL 1730
            +V ENQP+ + V       +  GF+ +  +      ++  F ++  TG++   + +DRE+     + I +Y   +  +    + + V ++D NDNPP F        + E+  + ++I    ATD D    G + +       + D F++  V GV       + + RPLDRE + ++ L I   D+   +P L   + V++ +ED NDN P F P  Y V++ E    G  ++ + A D D G + +V Y         E  F +D+ SG++R+ Q       Q    L V A D G P SLS+ CYV V V+ +N     P F          ++++E G V         +  V   D+D      I  SI  G+   +F +    G   ++     +   +   Y +TV A D G     + +++ I +   N   P          +  N+  +  +    A D D+  N K++Y IT G+ +  F+I   +GLIT   + L   + D+  LE+   D G     T   + + IL
Sbjct:  725 QVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRL-LHVVVVDANDNPPEFLQESYFVEVSEDKEVHSEIIQVEATDKD---LGPNGHVTYSIVTDTDTFSIDSVTGV-------VNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHG---EGNFDVDKLSGAVRIVQQLDFEKKQV-YNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVF----------SSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGSGVGVFKIGEETG---VIETSDRLDRESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKIL 1236          

HSP 17 Score: 118.242 bits (295), Expect = 4.833e-25
Identity = 137/516 (26.55%), Postives = 228/516 (44.19%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQV------LIKFGF-SYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE-GQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNED-DRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYND--NSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSI----RLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQ--DDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTV--------YRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLIT 1616
            +FL   Y   VSE++ +++ + QV      L   G  +Y        F+++ +TGV+  +  +DRE      ++I    +  E  Q   T+ +KV + D NDNPP F P     ++ E++   T I    A D D  + G      ++ G  + D   LSG          +R+V+ LD E K+ Y LT+  +DKG+P  L     VE+ V D N+  + PVFS       + E    G  V+ V A D D+  + E+ Y  +    V    F I  ++G I    RL + ++ H       L V A D G   LS++  + + V  +N   P+       +++   Y EI + + K +++V  +  D D    D +   I  GN +  F++    G   I    + +       + + V   DNG+P K T   ++++I   N   P F  ++  + +         RNA     + +  ATD D G N +I YSI  G+   +F IE  +G+++
Sbjct:  821 EFLQESYFVEVSEDKEVHSEIIQVEATDKDLGPNGHVTYSIVTDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGNFDVDKLSGA---------VRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGSGV--GVFKIGEETGVIETSDRLDRESTSHY-----WLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQ-------TSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTG--LITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKPDRERNAR-REPLYHVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVS 1310          

HSP 18 Score: 113.235 bits (282), Expect = 1.411e-23
Identity = 140/538 (26.02%), Postives = 226/538 (42.01%), Query Frame = 3
Query:  144 VKFLSSQYNFRVSENQPINTIVGQVLIK-----FGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE---GQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNED---DRFALS-GVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKK-TRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIAN-------FFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSL 1697
            + F  S + F V E+ P+  ++G + ++       F     + +  F+++K TG I+ +  +D E  ++       Y  T+E   G       + +++ID ND+ P F  +K E  I E+ A  T+I   +A D D     +   Y ++S  +     +F L    G  Y  +        LD E    + LT+ V D+  P  +    + + V D ND++P F+ S Y  R+ ES   G  V++V A D D G N EV Y  +  T   + N F ID   GSI+  +      NQ +  L+V+A D GSP +S    V + V   ++  PKF      S + +  + IG      +   H Q         +   I  GN  + F +    G   I+ Q KA+    L  YT+ ++  +    S  TTV  L+ +   N   PVF     +  +  +ASINS +           A D D   N  ++Y I +      FAI+  +G I  +  L + +       +   D G   L
Sbjct: 1356 ISFEESFFTFTVMESDPVAHMIGVISVEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKSN-------YNLTVEATDGTTTILTQVFIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEILQISAVDQDEKNKLI---YTLQSSRDPLSLKKFRLDPATGSLYTSE-------KLDHEAVPAH-LTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGTFGNIGNSFMIDPVLGSIKTAKELD-RSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSKEY-SVELSETVSIGSFVG--MVTAHSQSS-------VVYEIKDGNTGDAFDINPHSGT--IITQ-KALDFETLPIYTLIIQGTNMAGLSTNTTV--LVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRL 1859          

HSP 19 Score: 110.538 bits (275), Expect = 9.127e-23
Identity = 156/642 (24.30%), Postives = 272/642 (42.37%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDN-----VCKCTNHGYFTGSVEENSDSEISVSNNILSCNGNSKVSFTLHPKWSQDYL---YYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVI--DLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLK---FSLQGEENNAFSINP-QN-GSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTD-DRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE---LDQLIVLPEVRDEDS 9665
            F I+R+SG++ L + L  +    Y   I A     + +++     DVSI V D      V + + +  F           I +  +      N +V ++L    S + +     N ET  I T  K +D E  +N +I V+ +D    I  S   I+ V   D+ND+ P FT   + G VSE+   G  I  +   DADS+    +   F   G+    F++   QN   V++ + +DRE +  Y + +  +DG    +  + + V D+NDN P   K + + T      E       ++ I+ATDAD    +N++I Y+L            F LN D+G L   +  L+   +     +++ A+D G      SI +    +          S   Y I V   ++ G+ +  + A + D        + +  +    FSI   +G I   + ++   L   ++L ++A    +   ++      T+ + + D N   P     E   ++SE I VG+ +LQV     D      +  +II+  +  +FS+     +  +  + ++  LDYE  H+Y LT+ A D G P  S  + V + V D +DN+P F    +   + E   L+Q ++     D D 
Sbjct: 2753 FVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMV--ASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTL-KELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAILSTTDADSEEINRQVTYFITGGDPLGQFAVETIQNEWKVYVKKPLDREKRDNYLLTITATDGTFSSKAIVEVKVLDANDNSPVCEKTLYSDTI----PEDVLPGKLIMQISATDAD--IRSNAEITYTLLGSGAE-----KFKLNPDTGELKT-STPLDR-EEQAVYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEF---SADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSLIDSADGQFSINELSGIIQLEKPLDRE-LQAVYTLSLKAVDQGLPRRLTATG---TVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSI-----DSKTGAVFIIENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDADG 3366          

HSP 20 Score: 110.538 bits (275), Expect = 9.678e-23
Identity = 143/534 (26.78%), Postives = 229/534 (42.88%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIV-------------GQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDEND--NPPIFYPNKLERRIIENIALLTDISLT-AATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQL--LLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF--RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIR-INKANIYF-PV-FRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDA 1682
            F+   Y  +V E+ P  T++             GQV           H EG F+++KL+G +     +D E      + +    K        T  ++V ++D N+  +PP+F  + +E+  ++  A +  + +T +A D D    G    Y I  G        SGVGV   G+   ++     LDRE+   Y LT+   D+G  PL   +E+ I VED NDN+P  S   Y   + E++     VV++ A D DS  N ++ Y  K T    +  FSI  K+G I  T        Q +  L V   D+GSP  S    V V ++  N   P+F  +   +   ++          R+PL  V   D D+ P   I+ SI  GN+   F +E   G V   R   A    ++    ++++A+DNG P K +T  + I  I+K      P+ F   + + TV  +  +   I          G+   + + IT G+Y   F ++K +G I + KPL   +     L + A D 
Sbjct:  927 FIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSL-----LDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFS-SFVEKGTVKEDAPVGSLVMTVSAHDEDARRDG-EIRYSIRDG--------SGVGVFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMY--KITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKPDRERNARREPLYHVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVSSKR-FSAAGEYDI----LSIKAVDNGRPQKSSTTRLHIEWISKPKPSLEPISFEESFFTFTVMESDPVAHMIGVISVE--PPGI--PLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDG 1434          

HSP 21 Score: 104.76 bits (260), Expect = 5.428e-21
Identity = 131/519 (25.24%), Postives = 239/519 (46.05%), Query Frame = 3
Query: 2937 PIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYGKWSI-FXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSI-EKLPVELDFVEIDSQSGRLFTNKLVDVVE-QEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMK-----ITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAI-AFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTF----SGALYLNQPVDYELKPKWNFI---ITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQS-VHPPDHPFVINPISGILSVSNPI--LQEVSFDLVVMAVD 4427
            P+F +PFY+  + E+   H+P+  +     + +  ++ SI +   + +++I F+ G + +++ LD+E    Y  ++ A +      + +VFV I V D NDN P+F+ QSY  +++  +   T++ +V A D DS  N  ++Y +        D   +DS +G +   + +D  + ++   F+ A D G+P L+S V V V +     +   F++Q +   ISE           K +  +      + Y I        F I+  TGII L N L R A+  F+ L +  +D        + + T ++V +I  N +SP F  +      L+E+  + T++      D D G+ G V Y +       ++ F  D F     G ++  + +D E  P    I   + A D G     +  +V V +T+ ND  P+F + ++ E  +  + A GT+V +V A D D     ++ Y +++          IN +SG+++    +  L+   F   V AVD
Sbjct: 2182 PVFEKPFYSAEIAESIQVHSPVVHVQANSPEGLKVFY-SITDGDPFSQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHA-EVFVDIIVDDINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSN-LHRHALKPFYSLNLSVSDGV------FRSSTQVHVTVIGGNLHSPAFLQNEY-EVELAENAPLHTLVMEVKTTDGDSGIYGHVTYHI-------VNDFAKDRFYINERGQIFTLEKLDRE-TPAEKVISVRLMAKDAGGKV--AFCTVNVILTDDNDNAPQF-RATKYEVNIGSSAAKGTSVVKVLASDADEGSNADITYAIEADSESVKENLEINKLSGVITTKESLIGLENEFFTFFVRAVD 2679          

HSP 22 Score: 102.449 bits (254), Expect = 2.389e-20
Identity = 101/341 (29.62%), Postives = 166/341 (48.68%), Query Frame = 3
Query: 5127 VFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLE--YIWINEIPE-FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFT-STXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIAS--DADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG----LHRVTVEVLINLINVNDETPLIHNPT 6119
            V + + D NDN PV     +    PE+   G+ I    + A D D+ S  E  Y  +    E F L+  +G + TS  PLD E  A +   ++ +DG      A+I++ ++D ND    F+ D Y   + E     T++ +V   ++    N  I + ++ +     FS+N   GII  +  +D E    Y L + A D       LP   T T TV+VS++DINDN PVF+      ++ ED+ + +E++Q+ A+  D + +  + + I+S N+    +++  TG +     LDYE +  + LTV  TDG    L  V   V +N+ ++ND TP+    T
Sbjct: 3011 VEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIM--QISATDADIRSNAEITYTLLGSGAEKFKLNPDTGELKTS-TPLDREEQAVYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSLI-DSADGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQG-----LPRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEYYLTVEATDGGTPSLSDVAT-VNVNVTDINDNTPVFSQDT 3341          

HSP 23 Score: 100.908 bits (250), Expect = 8.246e-20
Identity = 135/541 (24.95%), Postives = 233/541 (43.07%), Query Frame = 3
Query: 8154 PVDREVYNNLEISVIIADGSGGIIESCPGI---IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP---LKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGIN-----VLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRI---LKSTFQYPIAVLYTSQEGSRVANIAVNHDNLY--GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNP-----------LDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLIVLPEVRDEDSIMASRNEPSY 9695
            P+DRE  +   +++ + D   GI +        + V+D NDN P F    +   VSE+  + S II +   D D  L P   + +S+   + + FSI+   G V +A+ +DREL+ ++ +K+   D           + + +++ D NDN P      I   + +   E       ++ + A D D  QS   Q+RYSL    +       F +++ SG++ I  V        +  ++ + A D+G+P    S T +      +    +   + S+F     V   +  GS V  ++ + ++    GEI + I  G+G   F IG + G I TS  ++      ++ L V A    ++   SF      I + + D N  +PQ         I E      +++Q++  DPD            +S++D+  L+   T+GN      ++P           LD E Q ++ L +   D G P KS  + V++K+LDE+DN P F+ + +          I LPE    D    +R EP Y
Sbjct:  779 PLDRETTDKYTLNITVYDL--GIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSEIIQVEATDKD--LGPNGHVTYSIV-TDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTF----IPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSG--QVRYSLLDHGE-----GNFDVDKLSGAVRI--VQQLDFEKKQVYNLTVRAKDKGKPVSLSS-TCYVEVEVVDVNENLHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGSGVGVFKIGEETGVIETSDRLDRESTSHYW-LTVFATDQGVVPLSSFIE----IYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPD------------SSSNDK--LMYKITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFY---------KIRLPEREKPDRERNARREPLY 1272          

HSP 24 Score: 100.138 bits (248), Expect = 1.162e-19
Identity = 95/330 (28.79%), Postives = 154/330 (46.67%), Query Frame = 3
Query: 3474 ITAEDHGIPRLNSSVKVYVKINPSPKSKQF-FDKQTFFQNISEDMKITEKIFKLE-IDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPK-WNFIITAFDLGYPALHS-NLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE-VLYYLQSVHPPDHPFVINPISGILSVSNPILQ----EVSF-DLVVMAVDAE 4433
            + A+D G P   SSVKV    +P  K+    F+K  +   ISE       +  ++ I     + Y       K  FS+N +TG+I ++  + R+  A   L +  +D          A T + V ++  N N P F   A       E+  +GT +   +A D D+G NG V Y +    +  +  F ID F+GA+  ++ +DYEL P+ +   I A D G P      +  T+T+ N+ND  P F K    E  + +++ +G  +  V A D D  + V Y +++ +  D  F +NP SG+LS+   ++     +VSF  L + A D E
Sbjct:  336 LQAKDKGTPPQFSSVKVIHVTSPQFKAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPAYSHLRYVFKSTPGKAKFSLNYNTGLISILEPVKRQQAAHFELEVTTSDRK--------ASTKVLVKVLGANSNPPEFTQTAYKA-AFDENVPIGTTVMSLSAVDPDEGENGYVTYSIA--NLNHVP-FAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEK-INCEGTIPRDLGVGEQITTVSAIDADELQLVQYQIEAGNELDF-FSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGE 651          

HSP 25 Score: 100.138 bits (248), Expect = 1.329e-19
Identity = 121/503 (24.06%), Postives = 223/503 (44.33%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSK---LFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE---IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQ-------VDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPR--KSQTSIVLIKVLDEDDNSPYFISRNFVASL 9614
            KP+D E  +N  ++V   DG+  I+      IKVID ND+ P F+ + +   + E+    + I+ I  +D D K   ++ L+ S        F ++P  GS++ ++ +D E    + + V V D    ++     +++ V+D+ND+ P  +      ++     E A     V+ +TA D D  +  N+++ YS+ S      + + F+++   GS  IK       S+    D+++ A+D+G PP+   IT   +F+T         ++ +Y + +  T   GS V  +  +  +    + + I  GN    F I   +G I T + ++   L   ++LI+Q      LS+        T+ + + D N  +P    +E T  ISE   + S +L        +   D D     ++   I+  +   +    F  + ++  +  V  LDYE    +  T+  HD+G PR      + V + V+D +D  P F    + ASL
Sbjct: 1415 KPLDAEQKSNYNLTVEATDGTTTILTQV--FIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEILQISAVDQDEKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTSEKLDHEAVPAH-LTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFTA----SSYKGRVYESAAVGSVVLQVTALDKD--KGKNAEVLYSIES-GTFGNIGNSFMIDPVLGS--IKTAKELDRSNQAEYDLMVKATDKGSPPM-SEITSVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTAHSQS---SVVYEIKDGNTGDAFDINPHSGTIITQKALDFETL-PIYTLIIQGTNMAGLST------NTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTY----FAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASL 1890          

HSP 26 Score: 98.9821 bits (245), Expect = 2.640e-19
Identity = 141/574 (24.56%), Postives = 246/574 (42.86%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSK-YEMKVAVSD-GI---NVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVI-ITASDRGQ---PPLFHSITV---HFLFITAECE-------------------------------------LRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNL----YGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDED--DNSPYFISRNFVASLRE-LDQLIVLPEVRDEDSIMASRNEPSYTL 9701
            +PV R+   + E+ V  +D       S   ++KV+  N N P FT   +     EN  IG+ ++ +  +D D  +   + +S+    +  F+I+   G+V  ++ +D EL  + Y +++  SD G+     +E+   IT+ + NDN P   K  IN    I   +   G   +  ++A DAD+ Q     ++Y + + N+       F LN +SG L++K   ++ +    +   + ITA+D G+    PL+ +ITV   H L +  +CE                                     +   +ST    I V      GS V  I +N  +L     G++ + +  GN  S F I  + G +     ++     + ++L +      I    ++      + +V+ D N   P+       V +SE  +V S ++QV+  D D G  G V  +I+T TD       F  +  +  + +  PLD E+QH++SL + A D         S V++KV  ED  DN P FI  N+   +RE L +  V+  +   D  +    +  Y+L
Sbjct:  424 EPVKRQQAAHFELEVTTSDRKA----STKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEK--INCEGTI-PRDLGVGEQ-ITTVSAIDADELQ----LVQYQIEAGNEL----DFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATD-GENFATPLYINITVAASHKL-VNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSV--IFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPLDRETTDK-YTLNITVYDLGIPQKAAW----RLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSEIIQVEATDKDLGPNGHVTYSIVTDTDT------FSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSL 966          

HSP 27 Score: 98.9821 bits (245), Expect = 3.121e-19
Identity = 119/442 (26.92%), Postives = 190/442 (42.99%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLI---------KFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEG---QFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN---NYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPK---FRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTV-DMLIRINK 1418
            F   +Y   VSE+  + T V QV           +  +S    ++ G F+++  TG +     +D ES      E +L  +  +G      +  ++ V + D NDN P+F  +     I E+  L   +    A D+D    G SN   +Y I  GN+   F +  V    RG++  +V + LDRET   Y LT+   D G PP      V I V D NDN+PVFS   Y+V + E+   GF V+++  +D DS  N    + F       E  F ++ +   + LT        +    L V+  D+G P LS+  Y+ + VI  + + P      I    S ++ +   IGK+             DQD  D +  S+    D N+F++  T G      ++ A   +++  Y + V   D     K TTV D+ + I +
Sbjct: 3232 FEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSH----EYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMADDAD----GPSNSHIHYSIIDGNQGSSFTIDPV----RGEV--KVTKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGP-PFFFTIVTGNDEKAFEVNPQ--GVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLEIFITSSGEEYSGGVIGKI----------HATDQDVYDTLTYSLDPQMD-NLFSVSSTGG------KLIAHKKLDIGQYLLNVSVTDG----KFTTVADITVHIRQ 3635          

HSP 28 Score: 95.9005 bits (237), Expect = 2.489e-18
Identity = 122/508 (24.02%), Postives = 222/508 (43.70%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKT-LEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLL---RVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRK--PLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPS--KQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARD---AGINSLETTGYLDLNILQSDQLHAR 1754
            F L+  TG + TS  +D E++ + L  +   +   ++  F     I V + D ND+ P F  +  + R+ E+ A+ + +    A D D  +      Y IESG          +G  +    +L   +  + LDR  + +Y L +   DKG PP+  +  V I V   ++ SP F+  +Y+V L+E+   G  V  V A    S     V Y+ K   +   + F I+  SG+I +TQ           TL+++  +     LS    V VH+   N   P F +  Y G   ++A I    +T +  PL ++   D D+D   L+   I+  +    FA++ + G +H    + ++       +  TV+  D G P    +   ++ + +   N   PVF       ++         +    ATD D+    ++IYSIT+G+  ++F+++  +G +T+          + +L + A D   AG+ S++      +N+ +S + H +
Sbjct: 1505 FRLDPATGSLYTSEKLDHEAVPAHLTVMVRDQDVPVKRNFAR---IVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGK-NAEVLYSIESG------TFGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTAHSQSS-----VVYEIKDGNT--GDAFDINPHSGTI-ITQKALDFETLPIYTLIIQGTNMAG--LSTNTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPL-VIRAADADKDSNALLVYHIVEPSVHTYFAIDSSTGAIHT---VLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSMDYKTGALTVQNTTQL--RSRYELTVRASDGRFAGLTSVK------INVKESKESHLK 1980          

HSP 29 Score: 91.6633 bits (226), Expect = 5.241e-17
Identity = 126/542 (23.25%), Postives = 225/542 (41.51%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIV--------GQVLIKF--GFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADS-GVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRD-RFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGI-NSLETTGYLDLNIL 1730
            KF    Y F VSE+ PI T +        G VL     G + E    E  F +++ +G +     +D E+       I       + + + ++ + +++ D NDN P+F  +  E  I+EN+   + +    A+D+D+   G    Y ++     +      + ++      +  ++ LD E ++ Y++ +   D G+   L     V++ V D ND+ P F+   Y   ++E +  G  +  +  +DADS  +N++V Y       + +      +    + + +P      + +  L + A D    + S+   V V V+  N   P         T     I    +  K +  +   D D      I  +++G   E  F L    G    L+    +       Y + VRA D G    Q ++  ++ +   N   P F     ++TV+ N    + +    ATD DAGLN KI+YS+   D  D +F+I + SG+I L KPL         L + A D G+   L  TG + +++L
Sbjct: 2704 KFSEPFYTFTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDES-FVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNG-QVMYSLDQSQSVEVIESFAINMETG---WITTLKELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAILSTTDADSEEINRQVTYFITGGDPLGQFAVETIQNEWKVYVKKPLDRE-KRDNYLLTITATDG---TFSSKAIVEVKVLDANDNSPVCEKTLYSDT-----IPEDVLPGKLIMQISATDADIRSNAEITYTLLGSGAEK-FKLNPDTGE---LKTSTPLDREEQAVYHLLVRATDGGGRFCQASI--VLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSLI--DSADGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVL 3223          

HSP 30 Score: 84.7297 bits (208), Expect = 5.236e-15
Identity = 94/398 (23.62%), Postives = 165/398 (41.46%), Query Frame = 3
Query:  630 LLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLP-GFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGN--------------------PSKQTTV-----DMLIRINK----------------ANIYFPVFRNRYQS-VTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGI 1688
            L+ ++ P+ R+    ++L ++  D+     K   +V + V   N N P F+ + Y    +E N+P G  V+ + A D D G N  V Y       V    F+ID  +G++  ++     +     TL + A D G P         T+ +  +N   P F +IN  G+  +   + +G+      AI      D D   L+   I  GN+ + F+L    G + + R +       +  +++ + A D  N                      ++T V     + L++ NK                 N + P FR+   + + V  N  + S +    +TDLD G NGK++Y+++ G+    F I+ ++G++ +L PL     DK  L I   D GI
Sbjct:  419 LISILEPVKRQQAAHFELEVTTSDR-----KASTKVLVKVLGANSNPPEFTQTAYKAAFDE-NVPIGTTVMSLSAVDPDEGENGYVTYSIANLNHV---PFAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRD--LGVGEQITTVSAI------DADELQLVQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPLDRETTDKYTLNITVYDLGI 799          

HSP 31 Score: 83.1889 bits (204), Expect = 1.932e-14
Identity = 88/338 (26.04%), Postives = 156/338 (46.15%), Query Frame = 3
Query: 3423 LFTNKLVDVVEQEFIFFIT-AEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFI-LSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGY--PALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD---TNEVLYYLQSVHPPDHP---FVINPISGILSVSNPILQEVSFD 4406
            L  NKL +  E E IFF + + +  IP+  S++   +++    K  Q       F N ++          L+      + Y +S   +   F I+  TG++ +++ LDRE    + L I   D    + + +     L+V ++D NDN P F  ++   F+ +SE  +V + +    A D D G NG V Y +    +     F ID+ +G + + +P+D EL+ + +  I A D     P L S + V V++ ++ND  P F         V++++  GT +  + A DPD   + +V Y L      DH    F ++ +SG +     I+Q++ F+
Sbjct:  688 LQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQV----KENQPVGSSVIFMNSTD----------LDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRL---LHVVVVDANDNPPEFLQESY--FVEVSEDKEVHSEIIQVEATDKDLGPNGHVTYSI----VTDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTF-IPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLL-----DHGEGNFDVDKLSGAVR----IVQQLDFE 992          

HSP 32 Score: 82.8037 bits (203), Expect = 2.066e-14
Identity = 137/544 (25.18%), Postives = 217/544 (39.89%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIKFGFSYEFFHKEG----LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETIS----IKVRIIDENDNPPIFYPNKLERRIIE----NIALLTDISL-----TAATDSDTDEFGVSNNYKIESGNEDDRFAL-SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPL--KGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF---------RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQ-SYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKL-EIIARDAG 1685
            KF S +Y+  +SE   I + VG V      S  +  K+G     F++N  +G I+T   +D E+L        +Y   ++G  +  +S    + V + DENDN P+F   +    I E    N  +LTD ++      A  D D++   V   Y I   +    FA+ S  G        +  V  LD E    +  T+ V D G P L  +    V + V D ND  PVF+   Y   L      G +V+ V A+DADS    ++ Y    T   +  +FS+D K+G++ +   T     +    L V A D     L++   V ++V        KF         + N   +   A    IG    +PL   H  + D+                  F + RT G   +L       +   Q ++ + V   +   PS    V + + +   N   PVF N      V  +  +   I    A D D+G NG++ Y +   ++ + F I    G I+L K      L+K  L  ++A+D G
Sbjct: 1668 KFTSKEYSVELSETVSIGSFVGMVTAHSQSSVVYEIKDGNTGDAFDINPHSGTIITQKALDFETLP-------IYTLIIQGTNMAGLSTNTTVLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLV---YHIVEPSVHTYFAIDSSTGA-------IHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSI--TEGNIGEKFSMDYKTGALTVQNTTQL---RSRYELTVRASDGRFAGLTS---VKINVKESKESHLKFTQDVYSAVVKENSTEAETLAVITAIGNPINEPL-FYHILNPDRR-----------------FKISRTSG---VLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTAVDRDSGRNGEVHYYLK--EHHEHFQI-GPLGEISLKKQFELDTLNKEYLVTVVAKDGG 2162          

HSP 33 Score: 81.6481 bits (200), Expect = 5.321e-14
Identity = 95/361 (26.32%), Postives = 167/361 (46.26%), Query Frame = 3
Query:  651 LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFD-----HGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPL-AIVHCQDDDQDPR-DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQS----YTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRN---RYQSVTVYRNASINSFIAN----FFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARD 1679
            L+RE K+ Y L +   +K    ++   +V + V D ND  P+FSP+ Y+V L E+      + +V A+DAD G N E  Y FK    +    F+I   SG I LT     ++      + + A D     +GS  +S+   +TVH+ + N   P            A  +   ++ R P  AIV   D DQ    D+ ++SI+ G+    F   R+       + +KAI  I+  S    Y +T++A D G P + ++V ++      ++  P F+    +++   VYR A I+ F            + A  + + ++  T G  + +F++  ++GLI++L+P+   +    +LE+   D
Sbjct:  108 LNREVKDHYTLIVKALEKNTN-VEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDM----FAIHPTSGVIVLTGRLD-YLETKLYEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVI---------TAVTLSPSELDRDPAYAIVTVDDCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSKEYK-VKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVI------HVTSPQFKAGPVKFEK-DVYR-AEISEFAPPNTPVVMVKAIPAYSHLRYVFKSTPG--KAKFSLNYNTGLISILEPVKRQQAAHFELEVTTSD 442          

HSP 34 Score: 81.6481 bits (200), Expect = 5.786e-14
Identity = 107/414 (25.85%), Postives = 177/414 (42.75%), Query Frame = 3
Query:  573 NEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDL-IAVSIIGGNDENIFALERTHGNVHILRQIK-AIHNINLQSYTITVRAIDN-GNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSI--TKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLE-----TTGYLDLN----ILQSDQLHARIKSTCP 1772
            N D RF +S         +L     P DRE +E + + + V ++ +P     + V++IVED NDN+PVF    Y   +      G  +  V A D DSG N EV Y  K+        F I    G I L +         +  + V A D G+P+ SA   V + V  +N   P F   +  +       EI +  +    +VH Q +   P  L +  SI  G+  + F +    G ++++  +    H     +Y +++RA D+      +  VD++  ++  N   PVF  +  +VT+   + I + +    ATD D+  N  I Y +        D F ++  +GLI+LL+ L + +  +  + + A D G+ +L      T    DLN    + +     ARI    P
Sbjct: 2020 NPDRRFKISRTS-----GVLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVIRYVTAVDRDSGRNGEVHYYLKEHH----EHFQIG-PLGEISLKKQFELDTLNKEYLVTVVAKDGGNPAFSAEVIVPITV--MNKAMPVFEKPFYSA-------EIAESIQVHSPVVHVQAN--SPEGLKVFYSITDGDPFSQFTINFNTGVINVIAPLDFEAH----PAYKLSIRATDSLTGAHAEVFVDII--VDDINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAP 2406          

HSP 35 Score: 80.4925 bits (197), Expect = 1.121e-13
Identity = 69/256 (26.95%), Postives = 120/256 (46.88%), Query Frame = 3
Query: 5472 FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHL--FSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDL--LLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETP-LIHNPTTVYLPKINQNHNIM--IKCSDQDN--LGPLSYDIM 6212
            F    Y   + E + I T + QV   +S + PN  I + +     K    F V+   G+I+    +DYEQ   + + + A D       +P L +    V V + D+NDN P+F+       I E  P    +  + A DAD SD+  L + ILS ND     ++  TG+I+ + +  +     ++L +S +DG+ R + +V + +I  N  +P  + N   V L +    H ++  +K +D D+   G ++Y I+
Sbjct: 2285 FAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAVDGG-----MPTLSS-DVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNLHRHALKPFYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGHVTYHIV 2534          

HSP 36 Score: 78.1814 bits (191), Expect = 5.143e-13
Identity = 44/122 (36.07%), Postives = 55/122 (45.08%), Query Frame = 3
Query: 11502 CALLAK--CRQQVCHNGGVCGVNRNGEAVCECAPGYTGYNCEYDINECEKTNLCTPHGNCNNIRGGFKCECQLNWIGNGLCTQPFNYCSSNPCSELGTERCIPILGGFKCRCHFGNFGDHCQ 11861
            C L A   C    C NGGVC  +  G   C+C+  Y G +CE  +N C  +  C   G C    GGF C+C+  + G      P  YC   PC   GT  C   L G  C+C  G  G+ CQ
Sbjct: 4011 CFLTATEDCASNPCQNGGVCNPSPAGGYYCKCSALYIGTHCEISVNPCS-SKPCLYGGTCVVDNGGFVCQCRGLYTGQRCQLSP--YCKDEPCKNGGT--CFDSLDGAVCQCDSGFRGERCQ 4127          

HSP 37 Score: 76.2554 bits (186), Expect = 1.963e-12
Identity = 105/440 (23.86%), Postives = 194/440 (44.09%), Query Frame = 3
Query: 8346 IGVIDADSKLFPLKFSLQGEE-NNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQP-PL---FHSITV-------HFLFITAEC-ELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQAC--GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            IGVI  +    PL F + G   ++ F ++   G++ +A+ +D E KS Y + V  +DG   +   + I V D+ND+RPQ S       + +   E       ++ I+A D D+     +++ Y+L S    + +K  F L+  +GSL           D+E V   +T   R Q  P+   F  I V       H  + TA   + R+ +S     + +  T+ +  +  N  V +    G  TF    GN  + F I    G I T++ ++ +   + + L+V+A   G+  +S ++      ++ + ++  +  SP+    E +V +SE + +GS +  V         + +V      +T D F + P     +S  +     LD+E    Y+L +   ++     S  + VL+ + DE+DN+P F+   +   + E
Sbjct: 1377 IGVISVEPPGIPLWFDITGGNYDSHFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDGTTTILTQVFIKVIDTNDHRPQFS----TSKYEVVIPEDTAPETEILQISAVDQDE----KNKLIYTLQSSRDPLSLKK-FRLDPATGSLYTSEKL-----DHEAVPAHLTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESG--TF----GNIGNSFMIDPVLGSIKTAKELDRSNQAE-YDLMVKATDKGSPPMSEIT------SVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTA----HSQSSVVYEIKDGNTGDAFDINP-----HSGTIITQKALDFETLPIYTLIIQGTNMA--GLSTNTTVLVHLQDENDNAPVFMQAEYTGLISE 1778          

HSP 38 Score: 75.8702 bits (185), Expect = 3.111e-12
Identity = 109/515 (21.17%), Postives = 220/515 (42.72%), Query Frame = 3
Query: 8280 FTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQP-----PLFHSITVH------FLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQ--WFSLIVQAC-----GTKILSSVSFCSKRETITLVISD--------------------------------FNLYSPQIRIS-ETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNF---VASLRELDQLIVLPEVRDED 9662
            F  + +   +SE A   + ++ +  I A S L  +  S  G+    FS+N   G + + + V R+  + +E++V  SD        +L+ V  +N N P+ ++      F     E       V++++A D D+ +  N  + YS+++ N  +P    F ++  +G+++     L++        + I ASD G P      +  +IT++       LF    CE  I +         L   ++ + V+ I  +   L   + + I +GN   +FS+   +G +S  R++   +  +  + SL + A       T +  +++  +  + + L   +                                 N + PQ R +  T + + E   VGS+++ ++  D D G  G +   +    +D   ++   T      LK+++PLD E   +Y+L +  +DLG P+K+   ++ + V+D +DN P F+  ++   V+  +E+   I+  E  D+D
Sbjct:  367 FEKDVYRAEISEFAPPNTPVVMVKAIPAYSHLRYVFKSTPGKAK--FSLNYNTGLISILEPVKRQQAAHFELEVTTSD--RKASTKVLVKVLGANSNPPEFTQTAYKAAF----DENVPIGTTVMSLSAVDPDEGE--NGYVTYSIANLNH-VP----FAIDHFTGAVSTSE-NLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRD--------LGVGEQITTVSAIDADELQL---VQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETG----MLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSEIIQVEATDKD 850          

HSP 39 Score: 75.0998 bits (183), Expect = 4.534e-12
Identity = 148/661 (22.39%), Postives = 280/661 (42.36%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEEN--SDSEISVSNNILSCNGNSKVSFTL---HPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSK-LFPLKFS-LQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVN--HDNLYGEITFFIISGNGS--SYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISE-----TTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSI-VLIKVLDEDDNSPYFISRNFVASLRE-LDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSKV 9725
            F+IN  +G I++  PL  +    Y L IRA+  +  +    + D  V   + DN        Y     E +    S + V         N  +S+ +   H K S D+ + ++ T  I +  + +D E      I V   DG    + S   + + V DLNDN P+F    +   +SE+A  G ++  +   DADS  +  L++S L G ++  F I+   G + L+      LK  Y + ++VSDG+      + +TV   N + P      +   + +  +E A  +  V+ +  TD D     +  + Y + ++      K  F +NE     T++ +     ++ + + V + A D G    F   TV+ +           ++T +Y + +  ++ +G+ V  +  +   +    +IT+ I + + S      I   +G I+T  ++   +  ++F+  V+A      S       +E++ LV     +  P++++ +      T ++SE + +G+ +  +        L  +VK     S  D      F  +  S +LK+   LD+E    Y  ++LA       +   S+ V I+V D +DNSP F S  + A + E L     + ++R  D+   +  +  Y+L    S +V
Sbjct: 2229 FTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVD-DINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSK-SHDHFHVDSSTGLI-SLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNLHRHALKPFYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPA----FLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGH--VTYHIVNDF----AKDRFYINERGQIFTLEKLDRETPAE-KVISVRLMAKDAGGKVAF--CTVNVILTDDNDNAPQFRAT-KYEVNIGSSAAKGTSVVKVLASDADEGSNADITYAIEADSESVKENLEINKLSGVITTKESL-IGLENEFFTFFVRAVDNGSPS-------KESVVLVY--VKILPPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDE----SFVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEV 2858          

HSP 40 Score: 70.0922 bits (170), Expect = 1.426e-10
Identity = 172/804 (21.39%), Postives = 337/804 (41.92%), Query Frame = 3
Query: 4080 ELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPI--LQEVSFDLVVMAVDAERQDRYDQQSVK------VHIKHDNEDEIQVLTYGAIILPKSSFYRE---KIATLKAQSNSKNLNSRFMYLLKNSSYDKI-IINRYTG--DVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPH----NLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEY--IWINEIPEFSLDKTSGIVTTSGVPLDHEAVAY-FIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHL--FSVNPDHGIITTQGEID---YEQDNHYILLITATD---------------VSQQSLFLPCLETVTTTVLVSIV--------------------DINDNIPVFDTT-RLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLIN--LINVNDETP-LIHNPTTVYLPKINQNHN--IMIKCSDQDNLGP---LSYDIMTSSKDIQNIYVDRITGKV 6266
            E+K  +  I+ A +     + +   V V + + ND +P F+  S     + +N AI T++ RV A D D  TN   YY  S       F I+P SG++ ++  +  L+   +++ ++A D   +  Y    +       VHI+  NE    V+T  A+ L  S   R+    I T+       N +   + ++      +   +  + G  +  + +   ++++S    + ++L++    T  ++ S K V+++  P      + F+K+ Y  +I E    P   +  ++A+    P      Y+F    G ++          L+  TG IS+    + R+  + +   +EV   DR  +      TKV + +   N N P F    +     EN   G  +   +    D+  +  + Y    +N +P F++D  +G V+TS   LD+E +   +  +I+ SD        + +L     +  ++ T      +   T P    +G+     S  + + +       E G  L  FS+NP+ G+++ +  +      + + + L ITATD                S + + L C ET    +L   +                     +N +IP F +T    + + E+ P+ S +I + ++D D      L++ +   N+D    ++  TG++     LD E T+++ L ++  D G+ +     L++  +++ ND  P  +     V + +  + H+  I ++ +D+D LGP   ++Y I+T   D     +D +TG V
Sbjct:  111 EVKDHYTLIVKALEKNT-NVEARTKVRVQVLDTNDLRPLFSPTS-YSVSLPENTAIRTSIARVSATDADIGTNGEFYY--SFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAADRGMK-LYGSSGISSMAKLTVHIEQANEC-APVIT--AVTLSPSELDRDPAYAIVTVDDCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSKEYKVKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVK-VIHVTSPQFKAGPVKFEKDVYRAEISEF-APPNTPVVMVKAI----PAYSHLRYVFKSTPGKAK--------FSLNYNTGLISILEP-VKRQ--QAAHFELEVTTSDRKAS------TKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYSIANLNHVP-FAIDHFTGAVSTSE-NLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQLVQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSEIIQVEATDKD-LGPNGHVTYSIVT---DTDTFSIDSVTGVV 877          

HSP 41 Score: 69.707 bits (169), Expect = 2.279e-10
Identity = 31/86 (36.05%), Postives = 44/86 (51.16%), Query Frame = 3
Query: 11469 CLCDDGFLGEKCALLAKCRQQVCHNGGVCGVNRNGEAVCECAPGYTGYNCEYDINECEKTNLCTPHGNCNNIRGGFKCECQLNWIG 11726
            C C   + G++C L   C+ + C NGG C  + +G AVC+C  G+ G  C+ DI+EC   N C     C N  G + C C   + G
Sbjct: 4078 CQCRGLYTGQRCQLSPYCKDEPCKNGGTCFDSLDG-AVCQCDSGFRGERCQSDIDECSG-NPCLHGALCENTHGSYHCNCSHEYRG 4161          

HSP 42 Score: 69.3218 bits (168), Expect = 2.695e-10
Identity = 95/467 (20.34%), Postives = 187/467 (40.04%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD---------GINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSEN---QRIPVKSLFLLNEDSGSLTIKAV-ALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITA----ECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQ-YSLTLLAHDLGFPRKSQTSIVLIKVLDE-DDNSPYF 9587
            ++V+D ND  P+F+   +   + EN  I + I  +   DAD       +    +  + F+I+P +G + L   +D      YEM++  +D         GI+ +   + + +  +N+  P I+   ++ + +     +A        I   D  D  +N      S+ + +   Q   V+S       S    +KA+  ++W S     ++ + A D+G PP F S+ V  + +T+       ++  K  ++  I+             + V     Y  + +   S  G + FS+    G IS    V             QA   ++  + S       + + +   N   P+   +    +  E + +G+ ++ +  +DPD G  G V  +I        + VPF  +  +  +     LDYE+  + Y+L + A D G P + +  ++    L+  +DN+P F
Sbjct:  137 VQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAADRGMKLYGSSGISSM-AKLTVHIEQANECAPVITAVTLSPSELDRDPAYA--------IVTVDDCDQGANGDIASLSIVAGDLLQQFRTVRSF----PGSKEYKVKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKV--IHVTSPQFKAGPVKFEKDVYRAEISEFAPPN----TPVVMVKAIPAYSHLRYVFKSTPGKAKFSLNYNTGLISILEPVKRQ----------QAAHFELEVTTSDRKASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYSIA-----NLNHVPFAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLF 569          

HSP 43 Score: 66.6254 bits (161), Expect = 1.671e-9
Identity = 44/143 (30.77%), Postives = 61/143 (42.66%), Query Frame = 3
Query: 11445 PSVNFNIKCLCDDGFLGEKCAL-LAKCRQQVCHNGGVCGVNRNGEAVCECAPGYTGYNCEYDINECEKTNLCTPHGNCNNIRGGFKCECQLNWIGNGLCTQPFNYCSSNPCSELGTERCIPILGGFKCRCHFGNFGDHCQYSA 11870
            PS      C C   ++G  C + +  C  + C  GG C V+ NG  VC+C   YTG  C+  ++   K   C   G C +   G  C+C   + G   C    + CS NPC  L    C    G + C C     G HC+ +A
Sbjct: 4032 PSPAGGYYCKCSALYIGTHCEISVNPCSSKPCLYGGTCVVD-NGGFVCQCRGLYTGQRCQ--LSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGE-RCQSDIDECSGNPC--LHGALCENTHGSYHCNCSHEYRGRHCEDAA 4168          

HSP 44 Score: 63.5438 bits (153), Expect = 1.562e-8
Identity = 104/455 (22.86%), Postives = 184/455 (40.44%), Query Frame = 3
Query:  399 IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFAL---SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDK-----GQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNL---PGFEVVKVYASDADSGVNQEVE----------YQFKKTRSVL-ENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVT--RKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKI-KLEIIARDAGI 1688
            ++V+++D ND  P+F P      + EN A+ T I+  +ATD+D    G +  +     +  D FA+   SGV V         +   LD    + Y++ I   D+     G   +  + ++ + +E  N+ +PV +     V L+ S L   P + +V V   D D G N ++            QF+  RS     E+ +    G    + P   +       L ++A D G+P      + +V VI + S  P+F+   V         EI +      P+ +V         R  +  S  G   +  F+L    G + IL  +K     + +    T          ++ +  +L+++  AN   P F           N  I + + +  A D D G NG + YSI   ++   FAI+  +G ++  + L +  + ++  L I A D G+
Sbjct:  135 VRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDAD---IGTNGEFYYSFKDRTDMFAIHPTSGVIV---------LTGRLDYLETKLYEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVIT----AVTLSPSELDRDPAYAIVTV--DDCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSKEYKVKAIGGIDWDSHPFGYN-------LTLQAKDKGTPPQ----FSSVKVIHVTS--PQFKAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPAYSHLR-YVFKSTPG---KAKFSLNYNTGLISILEPVKRQQAAHFELEVTT--------SDRKASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYSIANLNHV-PFAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGL 545          

HSP 45 Score: 62.3882 bits (150), Expect = 3.208e-8
Identity = 54/200 (27.00%), Postives = 94/200 (47.00%), Query Frame = 3
Query: 5472 FTHDRYHFHIHETAPIHTVIGQ-VTLKNSTTNPNFIIKFDIVSEWGKHLFSVNP----DHGI--ITTQGE----IDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD 6038
            FTH  Y+  + E +   T +G  V +    T+P + +++ IVS   ++LF        D     I T+G     ++ E  +HY L++ A + +             T V V ++D ND  P+F  T  +VS+PE+  I + I ++ A+DAD      F     +   +  ++P +GVI   G LDY +T+ + + +   D
Sbjct:   34 FTHLEYNVTVQENSAAKTYVGHPVKMGVYITHPAWEVRYKIVSGDSENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIVKALEKNTNV-------EARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAAD 226          

HSP 46 Score: 59.3066 bits (142), Expect = 2.515e-7
Identity = 139/573 (24.26%), Postives = 219/573 (38.22%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFG-------FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETIS----IKVRIIDENDNPPI-----FYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLL--LRVVR--PLDRETKEK-------------YKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPV-FSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIE---IGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNP-SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLW---FVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQL 1745
            F  + Y+  + EN  I T + +V            F Y F  +  +F ++  +GVI+ +  +D        +EI    + ++      IS    + V I   N+  P+       P++L+R          D +    T  D D+           G   D  +LS V     G LL   R VR  P  +E K K             Y LT+  +DKG PP    ++V  +        PV F    Y   ++E   P   VV V A  A S     + Y FK T    + +FS++  +G I + +P           L V   D       A   V V V+  NS  P+F      +  KAA+ E   IG       A+    D D+     +  SI   N    FA++   G V     +   + +  + YT+ +RA D G P  ++  V   I +N  N   P+F       T+ R+  +   I    A D D      + Y I  G+  D F++  +SG+++L + L      K+    L I A D    +  T  Y+++ +  S +L
Sbjct:  149 FSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVITAVTLSPSELDR----------DPAYAIVTVDDCDQ-----------GANGDIASLSIVA----GDLLQQFRTVRSFPGSKEYKVKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQFKAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPAYS----HLRYVFKSTPG--KAKFSLNYNTGLISILEPVKRQ-QAAHFELEVTTSDR-----KASTKVLVKVLGANSNPPEF----TQTAYKAAFDENVPIGTTVMSLSAV----DPDEGENGYVTYSIANLN-HVPFAIDHFTGAVSTSENLD--YELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ--LVQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDG--ENFATPLYINITVAASHKL 669          
BLAST of Protocadherin Fat 4 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 162.925 bits (411), Expect = 4.606e-39
Identity = 230/896 (25.67%), Postives = 393/896 (43.86%), Query Frame = 3
Query: 3402 IDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITE---KIFKLEIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAII---LPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIG-DPHNLNFQKNDYFF--QIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRC-TKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGT----VQAHDKDL--DSTLEYIWINE------IPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD-GT--FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPD---HGI--ITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVI 5972
            +D+ SG +   K +D  V  + I  +TA +   P +++S  V V +     +   F+K ++F  I ED  I      +F  ++D  +   + Y + +   K   +IN  +G+I     LDRE ++   L ++A+D  + K      V    + ++DVNDN+P+F +D+ N  IL E+  +  ++    A D D G NG+V Y + ++    I    ID  +G + L + +D +  P    +I A D   PAL S + +T+ + +IND  P      ++   +++NVAIG  VGRVYA D D+  N ++ Y          F+I+  SG++  +  + +E +  + L V A D          ++ V +K  +DN        Y   I   +P+ S    +I TLKA  N +  + +  Y ++ +  +   I    GD     +   E    D    + + +     L      + V+N+  D  N     ND+ F  +IPE  +  G  +  L+A    +   D    ++ I           +   R+D  +G ISV +  LDRE     + T  V+V         +   T++ + ++D NDN P F + ++        T  + I VGT    V A D D+  +  ++Y ++NE      I  F LD+TSG +  S   LD E  A  +  I   D GT   ++ + I + + D ND    F    Y  +I E +P+ + +G +  +++    N  I F I       LF +  D   +G+  I T+ E DYE   +           Q S  +P        V + + D+NDN P      + ++  ++V +  +I  + A D D++  L +  L  ND  L+     TG I
Sbjct:  215 LDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVE---ITVVDVNDNAPVFASDSYNVTIL-ENITIPAVIATVKATDEDFGTNGKVHYSMASSS--GIGGLTIDYSTGEVTLRERIDAKNSPI-TAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKM-ITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGS----QIITLKAVDNDE--DQKITYRIEEADREVFSI-LDIGDQGAILSVSGELKRQDHKVRVEISATDQGGL----QGRCVVNVFIDDVNSAPYFNDHPFSVKIPE-HSPIGYPVITLKA--EDHDRGDNARIVYSID---------SSQFFRIDPSSGDISVSS-DLDRE----DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYA------ATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSS-KLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVP--------VRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLEY-FLEEND--LIEAEKYTGKI 1052          

HSP 2 Score: 156.377 bits (394), Expect = 4.458e-37
Identity = 194/787 (24.65%), Postives = 352/787 (44.73%), Query Frame = 3
Query: 3144 QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFV----INPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSV-KVHIKHDNEDEIQVLTYG-----AIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPG-NPISDLEYYIFDIYCGISERIKLPN-TMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD----LDSTLEYIWINEIPEFSLDKTS---GIVTT-SGVPLDHEAVA-YFIGKIQVSDGTFTST 5423
            ++   V A  + D   S    VV+ V D  DNSPIF   SYF  I       TT+  VFA D DSG NG + YS+ +   + + + I+++SG + T   +D      I   + A D G P+  S+  V + +     +   F   ++   I E++ I   I  ++   +       V Y ++  +  G  +I+  TG + L  R+D +      + I A D +    S  + +T   +N+ID+ND++P     A     L E+  +G  +G   A D D G NG ++Y      ME    F ID  SG +   + +D E   +++  +TA D+G P+L+++ ++ V + +IND  P F+K+      + + +  G+ +  + A D D ++ + Y   +   D        I     ILSVS  + ++     V + + A  Q     + V  V I     D++    Y      ++ +P+ S     + TLKA+ + +  N+R +Y + +S + +  I+  +GD+ ++S    E +    + +++     S  L      +++L+  + ++  F  + Y   I E     G    ++ A+     P   ++Y+       ++E    P+  + RLD+ +G + V +  LDRE  + + I + +   DRG   S    +++ L + D NDN P F   ++  +  EN+  G    VGT+ A D D     D +       +   F +++ +   G+V   +    D+EA A  F  ++Q S G  +ST
Sbjct:  235 KHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGK-NLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLT---INVIDINDHAPTLIA-AQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY-----SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK-EYNVTISEEMPRGSQIITLKAVDNDEDQKITY--RIEEADREVFSILDIGDQGAILSVSGELKRQDH--KVRVEISATDQGGLQGRCVVNVFI-----DDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR--IDPSSGDISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISE-DIPVGTSFLQVSAIDADIGPNGIVDYF-------LNESSSSPSIQLFRLDRTSGTLRVSS-KLDRE--QFAVIVLPIFARDRG-TPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGST--VGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSST 983          

HSP 3 Score: 146.362 bits (368), Expect = 4.333e-34
Identity = 141/529 (26.65%), Postives = 231/529 (43.67%), Query Frame = 3
Query:  144 VKFLSSQYNFRVSENQPINTIVGQVLIKFGFSYEFFHK---------EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFAL---SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNES-NLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEK--DSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            V F   +Y   + E+ PI TI+  V      S   ++          + LF L+ ++G I  +  +DRE L   ++++  Y++ ++     + ++ V ++D  DN PIF  +     I E+  + T +    A D D+ E G    Y +  GN  +  A+   SGV         ++   PLDRET    +L +   DKG P  +    VEI V D NDN+PVF+   Y V + E+  +P   +  V A+D D G N +V Y    +  +     +ID  +G + L +           T V+ A D   P+LS+   +T++VI IN   P        +  K   +E      + +  V+  D+D  P  +I  S+ G  D   F ++   G   +++  K +       Y++ V A D G PS  T+  + + +   N   P F  +  +VT+       S I    A D D   + KI Y I + D R+ F+I    D G I  +      +  K+++EI A D G
Sbjct:  163 VHFQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYER-VDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENG-EIEYSLGEGNGKNLLAINAKSGV---------IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAV-IATVKATDEDFGTNGKVHYSMASSSGI--GGLTIDYSTGEVTLRERID--AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLI-----AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSG---LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEAD-REVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG 661          

HSP 4 Score: 115.546 bits (288), Expect = 9.159e-25
Identity = 99/361 (27.42%), Postives = 166/361 (45.98%), Query Frame = 3
Query:  633 LRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLV---VEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETT 1706
            +R+ + +DRE  +K+ L ++  ++  P +     V + V D  DNSP+F    Y   + E    G  V+ V+A D DSG N E+EY   +     +N  +I+ KSG I+   P    +++   +L+   V A D G+P   +   V + V+ +N   P F  +    T     I I  V    +A V   D+D      +  S+   +      ++ + G V +  +I A ++      T  +RA D   P+  +TV + I +   N + P      + +T+  N +I   +   +A D D+G NG I YS+   +  + F I++DSGLI   K L      +  L++ ARD G  SL T+
Sbjct:  222 IRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNG--KNLLAINAKSGVIQTAAP----LDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVT-ILENITIPAV----IATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNS----PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM---EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTS 564          

HSP 5 Score: 112.079 bits (279), Expect = 1.025e-23
Identity = 97/388 (25.00%), Postives = 183/388 (47.16%), Query Frame = 3
Query: 3198 KVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGA---FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYL-AVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFS---GALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQ----NVAIGTTVGRVYAQDPDTNEVLYYL 4310
            +  V +F+ D N ++P F+   +   I  H+     +  + A D D G N  + YSI+       F  ID  SG +  +  +D  ++  F   +TA DH  P LN+S ++ V ++    +   F   ++   ISED+ +     ++     +I    +V Y +++ +   +   F +++ +G + + ++LDRE  A  VL I A D    +G+  L A + + + + DVNDN+P F+  + + +I +E++ VG+ +G   A D D+G N  + +R+   G     +F I+  +   G + +    +++ + K N            L S + V + ++++ND KP        +F++      NV +   +G + A DPD N  L Y 
Sbjct:  666 RCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS----QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARD----RGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYI-AENSPVGSTVGTIVARDADEGDNADISFRIF--GGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALK-----DFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYF 1036          

HSP 6 Score: 110.923 bits (276), Expect = 2.804e-23
Identity = 131/506 (25.89%), Postives = 218/506 (43.08%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIK---------FGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN--NYKIESGNEDDRFALSGVGVQYR-GQLLLRVVRPLDRETKEKYKLT--ISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY-IEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIR-INKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITL 1619
            F    Y   + E+ PI T V  V  +           +S    + + L  +N  +GVI T+  +DRE+L+   +++    K    +   T  +++ ++D NDN P+F  +     I+ENI +   I+   ATD D   FG +   +Y + S +      + G+ + Y  G++ LR     +R   +   +T  I  +D  QP L   + + I V D ND++P    ++  + L E+   G EV +VYA D DSG N  ++Y  + +      +F ID  SG I+ T+           +L V A D G+PSL+    + V +  IN   P F        DK  Y + I +   +   I+  +  D D    I   I    D  +F++        IL     +   +     + + A D G    +  V++ I  +N A    P F +   SV +  ++ I   +    A D D G N +I+YSI    +   F I+  SG I++
Sbjct:  270 FEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKR-ESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED---FGTNGKVHYSMASSS-----GIGGLTIDYSTGEVTLR-----ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE-----DFIIDEDSGLIKTTKLLD-RETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF--------DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEA-DREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVFIDDVNSA----PYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF---FRIDPSSGDISV 738          

HSP 7 Score: 106.301 bits (264), Expect = 7.077e-22
Identity = 143/523 (27.34%), Postives = 232/523 (44.36%), Query Frame = 3
Query: 8061 NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVII--ADGSGGIIESC-PGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP---LKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLEIGMLITVT--DSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQE--GSRVANI-AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQAC--GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            N KV +++        L  +  T E+ T  + +D +   N  I+ +I   DG+   + S  P  I VID+ND++P       M  + EN  IG  +  +  ID DS   P   +K+S++G E+  F I+  +G +   + +DRE  ++Y +KV   D G   L     I V   D NDN P   K+  N T    + E   G+  ++ + A D D+ Q    +I Y +   ++ +     F + +      I +V+      +  V V I+A+D+G         V  +FI    ++        +P +V        G  V  + A +HD   G+    + S + S +F I   +G IS S +++       FS+IV A    +  L++ +       I +++ D N  SPQ   S    +ISE I VG++ LQV  ID D G  GIV    +  +    S+  F  +  S  L+V + LD E      L + A D G P  S  S + + + D +DN+P F
Sbjct:  407 NGKVHYSMASSSGIGGLTIDYSTGEV-TLRERIDAK---NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSG--PNGIIKYSMEGSED--FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTI---SEEMPRGSQ-IITLKAVDNDEDQ----KITYRIEEADREV-----FSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG---LQGRCVVNVFID---DVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDR--GDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTST------QIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF 892          

HSP 8 Score: 101.679 bits (252), Expect = 1.727e-20
Identity = 172/721 (23.86%), Postives = 307/721 (42.58%), Query Frame = 3
Query: 4014 SISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHI--KHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSS-YDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGD--PHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE-----FSLDKTSGIVTTSG--VPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS-----DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTV--EVLINLINVNDETP 6101
            S ++F +DT SG + L + +D E+  K    +TA++   P + ++ +V V + ++ D  P F K+S    I +++  IGTTV  V+A+D D+    E+ Y L   +  +    IN  SG++  + P+ +E      L V+A D     R     V++ +   +DN       +Y   IL   +     IAT+KA       N +  Y + +SS    + I+  TG+V L     ++  +  IT +I  +      L    +  L +N+ D   H            + E     G ++ R+ A+   +  + +  Y  +   G  + I        +D+++G I    + LDRE    ++ +++V   D G   S    T + + ++D NDN P F  + +     E    G +I   T++A D D D  + Y  I E          +     I++ SG     DH+       +I  +D        ++ +  D  +    F    +   I E +PI   +  +  ++     N  I + I S      F ++P  G I+   ++D E    + +++TA+D +   L        +T + V + DINDN P F ++  A +I ED+P+ +  +Q+ A DAD       D  L E  S     L  ++  +G +  +  LD E+     L +   D G   ++   E+ + L +VND  P
Sbjct:  209 SQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEI-REDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNL-LAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITI-PAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRER--IDAKNSPITAVIRAKDGAQPAL--SSTVPLTINVIDINDHAPTLIAAQKMITLEE-NVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFI--------IDEDSGLIKTTKL-LDRETT--ARYSLKVTARDMG-TPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQII--TLKAVDNDEDQKITYR-IEEADREVFSILDIGDQGAILSVSGELKRQDHKVRV----EISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPL------NTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAP 890          

HSP 9 Score: 95.9005 bits (237), Expect = 8.666e-19
Identity = 140/523 (26.77%), Postives = 237/523 (45.32%), Query Frame = 3
Query: 8097 SQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIE-SCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADS-KLFPLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLEIGML--ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSI--TVHFLFITAECELRILKS---TFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQA--CGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDR--FSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            SQ+    +  + EIR A K +DREV +   + V   +     I  S   ++ V+D+ DNSPIF  + + G + E+A IG+ ++ +   D DS +   +++SL +G   N  +IN ++G +  A  +DRE  S   + V  SD G    E   +  ITV D NDN P  + +  N T + N +  A     +  + ATD D     N ++ YS++S +    +  L  ++  +G +T++       + N  +  +I A D  QP L  ++  T++ + I       I      T +  +A+    +E  RV   A++ D+  G       S  GS  F I   +G I T++ ++     + +SL V A   GT  L++ +      TI +V+ D N  +P     E  V+ISE +  GS ++ +  +D D       K+T      DR  FS++     G    L V   L  +  H+  + + A D G     Q   V+   +D+ +++PYF    F   + E
Sbjct:  209 SQNLFTLDTMSGEIRLA-KSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPA----VIATVKATDED--FGTNGKVHYSMASSSG---IGGL-TIDYSTGEVTLRE---RIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAI---GEEVGRV--YAIDEDS--GPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTAR-YSLKVTARDMGTPSLNTST------TIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ----KITYRIEEADREVFSILDIGDQG--AILSVSGELKRQ-DHKVRVEISATDQG---GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPE 693          

HSP 10 Score: 95.5153 bits (236), Expect = 1.087e-18
Identity = 128/483 (26.50%), Postives = 216/483 (44.72%), Query Frame = 3
Query: 5034 LDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGK------------IQVSDGT---FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDL--LMTVNPITGVISTAGILDYEKTERHALTV--SCTD--GLH-RVTVEVLINLINVNDETPLIHNPTTVYLPKINQNHNIMIKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDTIH-----NTIKNVSLIVLDRNRSSKNYTA 6401
            LDRE +  S I ++V+  D+G    R     V + + D NDN PVFA++++     EN T      + TV+A D+D  +       N    +S+  +SGI    G+ +D+      + +            I+  DG     +ST  + I + D ND        +    + E   I   +G+V   +  + PN IIK+ +    G   F ++ D G+I T   +D E    Y L +TA D+   SL        +TT+ V + DINDN P FD     V+I E++P  S+II L A D D+   + + I   + ++  ++ +     ++S +G L   K + H + V  S TD  GL  R  V V I+  +VN       +P +V +P+ +     +I    +D+    +  I+ S    Q   +D  +G +S +  L   +    S+  + + H     NT   + +I+ D N +S  +T+
Sbjct:  333 LDRETL--SLIRLDVIASDKG-TPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITI--PAVIATVKATDEDFGT-------NGKVHYSMASSSGI---GGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSL------NTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKVRVEISATDQGGLQGRCVVNVFID--DVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS 786          

HSP 11 Score: 91.6633 bits (226), Expect = 1.849e-17
Identity = 71/257 (27.63%), Postives = 119/257 (46.30%), Query Frame = 3
Query: 3564 FDKQTFFQNISEDMKITEKIFKLEIDHQQ-------MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYY 4307
            F ++ + + + ED  I   I  ++  H         MV  + S+   +  F+++  +G I L   +DRE +  H+L + A +      S   A T + V+++DV DNSPIF+ D+    I  E   +GT +    A D+D G NG++ Y L     +++    I+  SG +    P+D E        + A D G P   S   V +T+ ++ND  P F  +S     + +N+ I   +  V A D D  TN  ++Y
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSR--SQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTIS---ASTTVVVHVLDVQDNSPIFEKDSYFGEI-REDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNL--LAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDS-YNVTILENITIPAVIATVKATDEDFGTNGKVHY 412          

HSP 12 Score: 91.6633 bits (226), Expect = 1.849e-17
Identity = 94/347 (27.09%), Postives = 159/347 (45.82%), Query Frame = 3
Query:  651 LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE-FSIDRKSGSIRLTQPTSCHINQGDCTLVVE---AFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALE---RTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFR------NRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLD 1649
            LDRE +  + + ++  D   PPL    ++E+I++D NDNSP F+ S Y   ++E    G   ++V A DAD G N  V+Y   ++ S    + F +DR SG++R+    S  +++    ++V    A D G+PSLSA   +T+ +  +N   P F +++Y        YI         +  +  +D D+     I+  I GG D  +F +E     +G V IL + +  +      +   ++A  +G  S  +TV + I ++  N   P  +      NR+ +V + R      FI  F     D   N  + Y + + D       EK +G I L+K  W   +D
Sbjct:  742 LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRV----SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSY------DLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA-SSGQLS--STVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQI---GFIPAF-----DPDQNATLEYFLEENDL---IEAEKYTGKI-LVKQEWKRNMD 1063          

HSP 13 Score: 83.5741 bits (205), Expect = 4.561e-15
Identity = 76/289 (26.30%), Postives = 134/289 (46.37%), Query Frame = 3
Query: 5469 NFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQNHNI-----MIKCSDQD--NLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANS 6299
            +F  ++Y   + E  PI T+I  V   ++++ P +           ++LF+++   G I     +D E  + +IL +TA +    ++      + +TTV+V ++D+ DN P+F+       I ED PI + ++ + A D D  +   + + +   N   L+ +N  +GVI TA  LD E      L V  +D        T  V I +++VND  P+  + +  Y   I +N  I      +K +D+D    G + Y  M SS  I  + +D  TG+V+    +   NS
Sbjct:  164 HFQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTI------SASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDS--YNVTILENITIPAVIATVKATDEDFGTNGKVHYS-MASSSGIGGLTIDYSTGEVTLRERIDAKNS 443          

HSP 14 Score: 82.8037 bits (203), Expect = 8.412e-15
Identity = 98/365 (26.85%), Postives = 165/365 (45.21%), Query Frame = 3
Query: 5061 QITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGT---FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKF---DIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPIT---GVIS--TAGILDYE-KTERHALTVSCTDGLHRVTVEVLINLINVNDETPLIHN 6113
            ++ VE+   D+G  G + RC  V + I+D N + P F +  F    PE++  G  +     + HD+  ++ + Y  I+    F +D +SG ++ S   LD E  A F   +  SD       ++  I +++DD ND    FT   Y   I E  P+ T   QV+  ++   PN I+ +   +  S     LF ++   G +    ++D EQ    +L I A D    SL      +  + + +++ D+NDN P F+     + I E+ P+ S +  ++A DAD+ D   + F I    D  L  +       GV+   T    DYE K  +    +  + G    TV V I++ +VND  P + +
Sbjct:  650 KVRVEISATDQG--GLQGRCV-VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYS-IDSSQFFRIDPSSGDISVSS-DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL------SAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKD 1002          

HSP 15 Score: 81.2629 bits (199), Expect = 2.630e-14
Identity = 160/709 (22.57%), Postives = 300/709 (42.31%), Query Frame = 3
Query: 7794 QTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSIS-----------VYDNVCKCTNHGYFTGSVEENS---DSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEEN-NAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVL---EIGMLITVTDSNDNRPQI--SKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETV---DVIITASDRGQPPLFHSITVHFLFITAECELRILKSTF---QYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGS--SYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE-LDQLIVLPEVRDEDSIMASRNEPSYTL-KSKTSSKVQLFQ-SKTNFTLKILKRSTNESVINLILDVFG 9818
            Q  F+++  SG+I L + +  +++  + L++ A           Y+  D +IS           V DN        YF G + E++    + +SV    L    N ++ ++L     ++ L  NA++  I+TA  P+DRE  + + + VI +D      ES   + I V+D+NDN+P+F  + +   + EN  I + I  +   D D      + +S+         +I+   G V L + +D +  S     +   DG        + + I V D ND+ P +  ++++I     +   E   G ++ +       D+    N  I+YS+            F+++EDSG   IK   L    D ET     + +TA D G P L  S T+  +      ++     TF   +Y + +      GS++  +    ++   +IT+ I   +    S   IG +   +S    V+  +  Q   + V+   T        C     + + I D N  +P       +V I E   +G  ++ +   D D G    +  +I +S   R      P++G+   + V + LD E +  +S+ + A D   P  + ++ + + + D +DNSP F S ++ A++ E +       +V   D+ +       Y L +S +S  +QLF+  +T+ TL++  +   E    ++L +F 
Sbjct:  210 QNLFTLDTMSGEIRLAKSMDREVLDKHILKVTA-----------YERVDPTISASTTVVVHVLDVQDNSPIFEKDSYF-GEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTA-APLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEV-GRVYAI-------DEDSGPNGIIKYSMEGSED-------FIIDEDSG--LIKTTKL---LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLK----DINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILS----VSGELKRQDHKVRVEISATDQGGLQGRC----VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRID----PSSGD---ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFA 864          

HSP 16 Score: 74.3294 bits (181), Expect = 3.000e-12
Identity = 114/496 (22.98%), Postives = 225/496 (45.36%), Query Frame = 3
Query: 4797 DPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVV-VIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIW--INEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD-GT--FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS-DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLI--NVNDETPLI----HNPT-TVYLPKINQNHNIMIKCSDQDNLGPLSYDIMTSSKDIQNI 6239
            D + ++FQ+  Y  ++PE   TP   +  + ++   +  S   YY       ++ +      +  LD  +G I +    +DRE+++   + V     +D   + S    T V +++ D  DN P+F  +++     E+   G  +     +  D   +  +EY     N     +++  SG++ T+  PLD E ++     +  SD GT    STA + I + D ND    F  D Y+  I E   I  VI  V   +     N  + + + S  G    +++   G +T +  ID  +++    +I A D +Q +L      + T  + ++++DIND+ P     +  +++ E+V I  E+ ++ A D D   + ++   +  ++D +  ++  +G+I T  +LD E T R++L V+  D G   +     I ++  ++ND  P      +N T +  +P+ +Q   I +K  D D    ++Y I  + +++ +I
Sbjct:  159 DANAVHFQQEKYVKELPE--DTPIETI--IASVKASHASSQPLYYSM-----VAPQDSRSQNLFTLDTMSGEIRLAK-SMDREVLDKHILKVTAYERVDPTISAS----TTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAA-PLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPAL------SSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFI--IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQ--IITLKAVDNDEDQKITYRIEEADREVFSI 628          

HSP 17 Score: 70.4774 bits (171), Expect = 4.769e-11
Identity = 42/160 (26.25%), Postives = 81/160 (50.62%), Query Frame = 3
Query: 1251 ENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL 1730
            +N+F L+   G +   R  K++    L  + + V A +  +P+   +  +++ +       P+F        +  +A I + + + FA DLD+G NG+I YS+ +G+ ++  AI   SG+I    PL    L  I+L++IA D G    E+T  +++ ++
Sbjct:  210 QNLFTLDTMSGEI---RLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVV 366          

HSP 18 Score: 68.5514 bits (166), Expect = 1.608e-10
Identity = 60/214 (28.04%), Postives = 93/214 (43.46%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQY----RGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQ 893
             F ++  +G I  S+ +DRE  A+  + I             +  I+V + D NDN P F  +     I E+I + T     +A D+D    G+ + +  ES         S   +Q     R    LRV   LDRE      L I   D+G P L    E+ + + D NDN+P F    Y + + E++  G  V  + A DAD G N ++ ++
Sbjct:  726 FFRIDPSSGDISVSSDLDREDRATFSV-IVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESS--------SSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFR 930          

HSP 19 Score: 63.929 bits (154), Expect = 3.697e-9
Identity = 77/329 (23.40%), Postives = 145/329 (44.07%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPV--ELDFVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL------EIDHQQMVTYRISKCTQKGAFSIN---QHTGIIHLINR--LDREAIA---FHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDA--LNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQ 4067
            R  +S  V A +      +T   + + + D NDNSP F++ SY  +I+      T+  +V A+D D G NG V+Y + +      +    +D  SG L  +  +D  +   I   I A D G P L+++ ++ + ++    +   F++ ++   I+E+  +   +  +      E D+   +++RI        F I    +  G++ ++ R   D EA A   F  L   +   SST          + +++ DVNDN P  K+    +N F   ++ ++   +GF  A D D   N  + Y L     E   + + + ++G + + Q
Sbjct:  747 RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNAD-ISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSST--------VPVRIHVSDVNDNKPALKDFVILMNRF---DNVQMARQIGFIPAFDPDQ--NATLEYFL-----EENDLIEAEKYTGKILVKQ 1056          

HSP 20 Score: 55.4546 bits (132), Expect = 1.584e-6
Identity = 125/534 (23.41%), Postives = 219/534 (41.01%), Query Frame = 3
Query: 8097 SQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINP--QNGSVFLAQTVDRELKS---KYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFI-----TAECELRILKSTFQYPIAVLYTSQEGSRV-ANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIV-----QACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPL-----DYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL 9632
            S+D++  + ++  I+T  K +DRE      + V   D G+  +  S    + + D+NDN+P F    +   +SE    GS II +  +D D     + + ++  +   FSI      G++    +V  ELK    K  ++++ +D   +    ++    D  ++ P  +    +  F +   E +     V+ + A D D  + +N++I YS+ S          F ++  SG +++ +       D  T  VI+TASD   PPL  S  +  +       + +       +T    I V  +  + S + A+I  N     G + +F+   + S    +   +    T R V+S +  + F++IV     +  GT  LS+ S       ITL +SD N  +P        + I+E   VGS +  +   D D G    +   I    D +     F    ++ Q  VV  L     DYE +       L    G  + S T  V I V D +DN P    ++FV  +   D +
Sbjct:  521 SEDFII-DEDSGLIKTT-KLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ-KITYRIEEADREVFSILDIGDQGAIL---SVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFN----DHPFSVKIPEHSPIGYPVITLKAEDHD--RGDNARIVYSIDSSQ-------FFRIDPSSGDISVSSDLDR--EDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPN-----GIVDYFLNESSSSPSIQLFRLDRTSGTLR-VSSKLDREQFAVIVLPIFARDRGTPSLSAAS------EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKL----FDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPAL--KDFVILMNRFDNV 1013          
BLAST of Protocadherin Fat 4 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 145.206 bits (365), Expect = 1.032e-33
Identity = 259/1005 (25.77%), Postives = 413/1005 (41.09%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIE-------KLPVELDFVE-IDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPR-LNSSVKVYV----KINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI-----DHQQMVTYRI-----------SKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSEST-------KVGTILGFYTANDID-DGLNGQVRYRLTATG-MESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPAL-------HSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVL-YYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQS-VKVHIK--HDNEDEIQVLTYGAII------LPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKII-INRYTGDVFLTST----TPVEFNSIDITFLISLESLRSDTLIKYHSTKL-VLNIGDPHNLNFQKNDYFFQIPECKT---TPGLKLFRLQALYPGNPISD---LEYYIFDIYCGISERIKLPN--TMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIY-VGTVQAHDKDLDSTLEYIWINEIPEF--SLDKTSGIVTTSGV-----PLDHEAVAYFIG---KIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINS-EIIQLIASDADKSDL 5903
            R +   TV A ++ D+         + V D NDNSP F   SY  S++R     T++  VFA D D+  N  + YS+E       +   +LDF E ++ +SG +   K + +  Q+FIF + A+D+GIP  L SS +V +    K   +PK +   D +     + E++++ + I +             V Y++           SK  Q   F        + ++  LD E +  + LT+ ATD +S   S         V + DVND  P F  D     I  E T         G  +    A D D DG   +V YR+      E    F+ID  +G ++ N+  D E    +   + A D    AL         N+ V + I ++ND  P F +E +    V+++   G  V  + A D D +  L Y+L        PF +   SG + V  P+  E S  + LV++A D     R++  + V +HI+  +DN  + +   Y   +      +PK  F    +    A  + K  +SR +Y L+    D++  I +Y+G + L        P    S +  F++       + L+ Y   ++ V +I D  N        F  I E +    + G+    +QA    +P ++   +EY I         R KL N  ++ R+D+ TG I      LDREI    +  +EV   DRG   SR     V + + D NDN P F    +     E    G  +       A ++  D+   Y    E   F  + DK S   ++ GV     PLD+E V    G    I+VSDG   + A + + + D ND   +  H      + E  P  T IG+ T  +         + +  S+  K  F+++ D G +     +D E    Y L+I A D S               V V + D+NDN P   T        E+ P+N     ++ A+D D ++ 
Sbjct:  942 RPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGI-TVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVAS----TKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSF-EEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG----RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLF---NVHATDADQDEK--SSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWN--FVVQAIDDDGNGLVGYADVQVNVRDIND--NSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIV--------RNKLINGESVFRIDQNTGKI-FAMRSLDREISSEREFIIEVRANDRGVP-SREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSK-QSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHI-HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSD-PKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSNN--------IGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEF 1905          

HSP 2 Score: 112.079 bits (279), Expect = 1.043e-23
Identity = 126/444 (28.38%), Postives = 204/444 (45.95%), Query Frame = 3
Query: 3162 LAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFI--FFITAEDHGIP-RLNSSVKVYVKI-NPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEID--HQQMVTY----RISKCTQK-GAFSINQHTGIIHLINRLDREAIAFHV----LTIVATDNSST---KGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFIL-----SESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPV--DYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQ------SVHPPDHPF--VINPISGILSVSNPI 4385
            L V   +  + + V + I + D NDN P F+   Y   +      N TI KV A+D D+G N  + YS++     ++     S   RL  ++L    E+ F+  F +TA DHG P  L+SS  ++++  N + +S  F     +   ++ED +    + +++     +  VTY    +  + TQK   FSI++HTG++ L + +    +A       LT++  D+ S        + +   L + I DVN+N P F + A  + I      +  T   TI+    A D D   NG + Y L  T  ES   F ID  +G L  +  V  D E +P+ +  + A D G   L      +V + +IND  P+F + S  E  V +  A+GT+V  V+A D D     E+ Y L+        H  D  F  ++N  SG +++  PI
Sbjct:  613 LKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQL---NERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKV-EATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPS-YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI 1051          

HSP 3 Score: 102.064 bits (253), Expect = 1.124e-20
Identity = 157/612 (25.65%), Postives = 262/612 (42.81%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIKFGFSYEFFHKEG----------------LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLET-ISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDR--ETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSP-SKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQF--KKTRSVLE-NEFSIDRKSGSIRLTQPTSCHI-----NQGDCTLVVEAFDHGS----PSLSAYCYVT--VHVIRINSFFPKFRINYVGSTDKAAYIEIGKV------TRKPLAI-VHCQDDDQDPRDLIAVSIIGGNDEN--IFALERTHG----NVHIL--RQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSI----TKGDYR----DRFA-IEKDSGLITLLKPLWFVKLDKIKLEIIARDAGI-NSLETTGYLDLNILQSDQLHARIKST--CPTQFILDDS 1796
            +F   +Y   VSE+  ++  V  V  +   S+E    +G                 F ++  TG+I  + ++D +  A  L ++   K T      E+ + + +RI D NDN P F       ++ E+I L   I    A D DT      +N +I    ++  F+++       G++  +V    D+  E    Y+  ++  D G+P  L     + I  E+ ND S VF P S+YT  + E    G  V+++ A DAD     EV Y F  K  RS  + N FSID  +G ++L    S        N  + T++V+  D GS    PS +   Y T  + +  +N+  P+F        D A Y +I K+      T  P  + V   DDD      I  S+     E+   F ++R  G    + H++  R+ +   +       +TV+A D G+          + +   N   P F       +V R  ++ + +   FA D DA  N +I YS+    T G+      D F  + + SG ITL+KP+  +K  K    +IA D GI  +L+++  + LN+L   Q   + +++  C     +D++
Sbjct:  529 QFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPA--LPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDT-----GDNSRITYSVDNHNFSINS-----NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQ--DDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF-------PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPRED-------VTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI-PMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDEN 1108          

HSP 4 Score: 90.1225 bits (222), Expect = 5.607e-17
Identity = 239/1079 (22.15%), Postives = 435/1079 (40.32%), Query Frame = 3
Query: 3231 NDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMD----PDSGINGFVNYSIE-KLPV-ELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLN------------SSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIA----FHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRL---TATGMESISVFKIDTFSGALYLNQPVDY----ELKPKWNFIITAFDLG----YPA-LHSN-LSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGT------TVGRVYAQDPDTNE------VLYYLQSVHPPDHPFVINPISGILSVSNPIL----QEVSFDLVVMAVDAERQDR----YDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKI----------IINRYTGDVFLTSTTPVE-----FNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLK----------LFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEG---SQITVEVVVIDRGKNGSRIRCTKVFL-NIEDCNDNRPVFANETFIFHAPENTTYGQKIY------VGTVQAHDKDLDS---TLEYIWINEI-----PEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD----------GTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHET-APIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHL-FSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVS-IPEDVPINSEIIQLIASDAD---KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYE-----KTERHALTVSCTDGLHRVT-VEVLINLINVNDETPL 6104
            ++  P F+ Q Y  +++     + ++  V A       D    G + YS+E   P  E  +  ID  +G +   +L+D            +D  +P+L+            S V + ++I+    +   F +  +   + ED+ + + I K+  +D       RI+       FSIN + G I    RLD + +      +   + A D+         A+  +++   + ND S +F   +     ++E  + GT +    A D D     +V Y          + +++F ID  +G + L   V      E +   N  +   D G    YP+  H++  ++ + I ++N+ KP F   ++   I +  +  GT      T+ +V A D D++        LYY QS       FVI+  +G+L+ S  ++         D+ V A D  R DR    + Q SV+V   +DN  + +  +Y   +  +       + T+ A  N    N+   Y L+  +              ++NR +G++ L    P++     FN I     I  E+L+S       S ++ LN+ D      QK   +   P+CK  PG+           + R +A+  G+  S     I+ +        K  +   + +K       GN +++  I+EG    Q+    + +      SR+  TK F+  + D ND  P F  + F     E  T  + +       + TV+A D D D     + Y  + E        F +D+ +G +  +    D E +  +I  ++ SD          G       + I+I+D ND   +F   +Y   + E+    H VI   T+K    + +  +++ ++   G  + F V  D G I  +  +D+E  + Y L++ A+D    +         TT V + I D+NDN P F+  + A + I EDV I   +  + A+DAD   KS  +++ +     D +  +   +G I     LD +      +    +     DG   V   +V +N+ ++ND +P+
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDF-----------DDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM--IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAK--IMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQS--ESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATD--RGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV-SRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIP-EALQS-------SAQVTLNVLDKQ----QKAPKWQTSPDCK--PGITVDENVELNKVILRCRAVSSGD--SRNSDVIYKLTASGGPGNKAESKFRQFNK----FENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPN-EKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVI---TIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNA---------TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPI 1545          

HSP 5 Score: 85.8853 bits (211), Expect = 1.036e-15
Identity = 128/579 (22.11%), Postives = 243/579 (41.97%), Query Frame = 3
Query: 7989 FTGSVEENSDSEISVSNNILSCNGNSKV---SFTLHPKWSQDYLYYN--AETNEIRTAHKPVDR---EVYNN-------LEISVIIADGSGGIIESCPGI-----------IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENN--AFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLT-IKAVALNWISDNETVDVIITASDRGQPPL--FHSITVHFLFITAECELRILKSTFQY------PI---AVLYTSQEGSRVANIAVNHDNL-YGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQ-----LKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPY 9584
            FTG+++E    E++ + ++   NG   V   +        Q+ ++Y    E N   T H  +D    E++ N       +++ ++  + S   + + PG            I + D+NDN+P F    ++G V E+   G  +I I   D D K   L++ L G       F +   +G++F+ + +D E   +Y + +  SDG +     + I + D NDN PQ  ++    T +    +       + N+ ATDAD  +  +S+I Y L  +        +F + + SG++  +KA+  +  +   + + ++ A D     L  +  + V+   I     +   +  F Y      PI    V +   +     +    + N+ YG +   +I  NG S F I    G+I   R+++  I  +  F + V+A    + S   F +    +T+ ++D N  +P    +    S+ E   +G+ ++     D D      V    ++   D F +    T+ +S Q     L+V  PLDYE   Q     L   +   R    + V + ++D +D++P+
Sbjct: 1216 FTGTIDE----EMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD-KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPK---VLFNVHATDADQDEK-SSRIVYRLEGQG----ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPI-FPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLI--NGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFAN----VTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVT---TDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPH 1771          

HSP 6 Score: 79.337 bits (194), Expect = 1.031e-13
Identity = 121/488 (24.80%), Postives = 209/488 (42.83%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE------GQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVV-KVYASDADSG-VNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQG--DCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAI-------VHCQDDDQDPR--------DLIAVSIIGGNDENIFALERTHGNVHILRQI-KAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVF-RNRYQSVTVYRNASINSFIANFFATDLDAGLNGKII-YSIT-KGDY----RDRFAIEKDSGLITLLKPL 1631
            F +++LTG I  +   DRE +   ++ +    +++       G   + + +++ I D NDN P F   K   R+ E+     D+    A   D D+      + I +G     F     GV+     +  V  PLD E  ++Y L +   D           V I +ED NDN+P F   KY   + E ++   +V+  V+A+DAD    +  + Y+ +   +  +  F I + SG+I L +        G      VV+A D     L  Y  V V+V  IN   P F     G      YIE     R+P+         V  +D D DP          ++   +I G  E++F +++  G +  +R + + I +   + + I VRA D G PS++   ++ I++   N   P F + RY+  +V   A I + + +F A D D      +  Y ++ + DY     D+ + +   G++ + +PL
Sbjct: 1271 FRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKA--HDLDKHSNLRYHLIGAGGGRIPF-----GVRTDSGTIF-VKEPLDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGA--DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFG------YIE---ENREPIHSDGVYFMDVQARDFD-DPTTENANIEYGIVRNKLING--ESVFRIDQNTGKIFAMRSLDREISS--EREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEG-SVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPL 1730          

HSP 7 Score: 75.8702 bits (185), Expect = 1.133e-12
Identity = 243/1105 (21.99%), Postives = 434/1105 (39.28%), Query Frame = 3
Query: 3183 KEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINR------HTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVE--LDFVEIDSQSGRLFTNKLVDVVEQEFI----FFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKI-----FKLEIDHQQMVTYRISKCTQKGAFS---------INQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKN--DALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGM---ESISVFK-IDTFSGA-----LYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKE---SRLEFIVQQNVAIGTTVGR----VYAQDPDT----NEVLYYL--QSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRY----------DQQSVKVHIK----HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHN--LNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEG-SQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIF-HAPENTTYGQKIYVGTVQAHDKDLDST----LEY-----IWINEIPEFSLDKTSG-IVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNP-NFIIKFDIVSEWGKHLFSVNPDH-----GIITTQGEIDYE---QDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIP-VFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVE-VLINLINVNDETPLIHNPTTVYLP-------KINQNHNIMIKCSDQD--NLGP 6194
            K  ++   ++I ++D N+N P F   + +  I +       T P T + KV A D DS  NG + YS+     E    FV ID Q+G L  +  V V ++E        + A D G   L    +  V++     +   F++ ++  ++S    +   +     F  +  H   +TY +   T  G            +N+ +G I LI  +  +   F +  ++A DN   +  +  A   L  N++D    +P ++   D      + E+ ++  ++    A    D  N  V Y+LTA+G    ++ S F+  + F        + + + +DYE    +   +TA D+    + S  +  V + ++ND  P+F  +     ++  +  N  +  T G+    V A D D+    NEV Y +  ++       F I+ ++G +   N        D+ ++ V+A   DR           ++ +VKV I     +DN    +   Y   +  +S      + T+KA    K+ N R+  +          +   +G +F+    P++F + D   L+ + S          +T + ++I D ++    F++  Y   + E        LF + A       +D +     I   +    +  + + R+ K +G I +    LDR+   G       V  ID   NG  +    V +N+ D NDN P+F    F +        +   +Y   VQA D D  +T    +EY       IN    F +D+ +G I     +  +  +   FI +++ +D    S      +     D   N   F   RY   + ETAPI   +   +  ++     + +  + +  E      + + D      G++  +  +DYE   Q + + L I  +D    +            V V++VD ND+ P +   T   V   EDVP  + I +  A+D D  D   F I   +D          G +  A  LD E    + L +   D  + +  + V + L +VND  P    P TV  P        +NQ     I+ +D+D    GP
Sbjct:  843 KTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV-KVEATDDDSSANGDIVYSLYYTQSESRKAFV-IDRQTGVLTPSPHV-VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKF-IFNVIADDNGIPEALQSSAQVTL--NVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEI-FPNEKFDREKIDMYILTVEA--SDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRV-KESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKE--PLDFEASDQYHLVLIASDGRHNA----TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATD-----ADQDEKSSRIVYRLEG--QGADEVFRIGKYSGTIELVKA-LDRDPPAGVPSWNFVVQAIDDDGNG-LVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDA---------EAAVHVALVDRNDHAPHIHGATEHRVR--EDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGP---EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGP 1907          

HSP 8 Score: 74.7146 bits (182), Expect = 2.234e-12
Identity = 90/382 (23.56%), Postives = 156/382 (40.84%), Query Frame = 3
Query:  651 LDRETKEKYKLTISVEDKGQPPLKGV-------LEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHI-NQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPR-DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINS---FIANFFATDLD--AGLNGKIIYSITKG---DYRDRFAIEKDSGLITLLKPL--WFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSD 1739
             DRE  + Y LT+   D+    L G        ++V+I++ D NDN+P F   KY  R+ ES   G +V+ + A D D   N            +    F +   SG+I + +P      +Q    L+     H     +A   V +H+  +N   P+F      +T     ++I KV    L  VH  D DQD +   I   + G   + +F + +  G + +++ +       + S+   V+AID+         D+ + +   N   P+F  R           I+S   +  +  A D D     N  I Y I +    +    F I++++G I  ++ L        +  +E+ A D G+ S E  G+ ++ I  +D
Sbjct: 1286 FDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRI---PFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH-----NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKV----LFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSRE--GFANVTIKVTD 1653          

HSP 9 Score: 74.3294 bits (181), Expect = 2.848e-12
Identity = 151/679 (22.24%), Postives = 268/679 (39.47%), Query Frame = 3
Query: 7800 FFS-INRESGQISLNEPLPQLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKC----TNHGYFTG-SVEENSDSEISVSNNILSC----NGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHK--------------PVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALI--------GSWIIDIGVIDADSK------LFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD----------GINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSL-SSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHF--------LFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNS---AILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIR------ISETTVSISELIKVGSNLLQVDVIDPDAGLA----GIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEI--QHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            FF  +NR SG+I+L +P+P     +   + A    +   +       V+++V D   K     T+     G +V+EN    + ++  IL C    +G+S+ S  ++ K +      N   ++ R  +K               +D E  NN  +++   D +  +  +   +++V D+ND  P FT++ F G + E            G  I+ +  ID DS        + +     GEE   F I+   G +F  +  DRE    Y + V  SD          G N   + + I + D NDN P   ++     ++    E       V+ I A D D     +S +RY L  +   RIP    F +  DSG++ +K   L++ + ++   +++ ASD G+     ++ +H          F   +    +++     P  VL+       V     + D     I + +        F IG  +G I   + ++    A +  W + +VQA        V +      + + + D N  SP         I E    I        ++   D  DP    A    GIV+  +I           F  + N+ ++  +  LD EI  + ++ + + A+D G P +   + V IKV D +DN+P+F    +  S+ E
Sbjct: 1034 FFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEAL--QSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDEN----VELNKVILRCRAVSSGDSRNSDVIY-KLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQ----KYIGRVKESEGEGHDVITIKAHDLD----KHSNLRYHLIGAGGGRIP----FGVRTDSGTIFVKE-PLDFEASDQ-YHLVLIASD-GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIP-KVLFN------VHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSW-NFVVQAIDDDGNGLVGYAD----VQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGES------VFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEE 1672          

HSP 10 Score: 73.559 bits (179), Expect = 5.035e-12
Identity = 131/556 (23.56%), Postives = 235/556 (42.27%), Query Frame = 3
Query: 8262 NDNSPIFTLNYFMGFVSENALIGSWIIDIGVI------DADSKLFPLKFSLQGE----ENNAFSINPQNGSVFLAQTVDRE---LKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVI---ITASDRGQP-PLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSS-----YFSIGSKNGQISTSRNVNSAILGQW-----FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGS------NLLQVDVIDPDAGLAG-IVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNP-----LDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL---IVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLI 9803
            ++  P F    +   VSE+ L+   ++D+         D  SK  P+ +SL+G+    E   F I+P  G + L + +D +   L   +++KV   +      + + I + D NDN P  ++ +    +     E    N  ++ +TA D D    +NS+I YS+ + N        F +N + G ++ K V L+    NE   V    +TA D G+P  L  S  +H        E  +   T QY   V   +Q G+ V  I    D    E+T+  +  NG S      FSI    G +     V++A L +       ++IVQ  G+  +      +   T+ + I D N   P+         I+++++ G+       +++V+  D D+   G IV     T ++ R + V         Q  V+ P      D E + +  +T+ A D G           ++V+D +DNSP F   ++  S+   + +   ++     D D+  A   E +Y+L+  T++  +  Q+  +F   + +RS   ++I  I
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSK-GPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPL----YTAQVREDIPLNQTILKVTAVDKD--TGDNSRITYSVDNHN--------FSINSN-GEISAK-VRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQA-RDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIME-GTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVI------DRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA--AHNAEITYSLEIDTTAGEE-HQNDLDFFELVNRRSGEITLIKPI 1051          

HSP 11 Score: 64.6994 bits (156), Expect = 2.246e-9
Identity = 119/544 (21.88%), Postives = 230/544 (42.28%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLN-YFMGFVSENALIGSWIIDIGVIDAD--SKLFPLKFSLQGE-ENNAFSINPQNGSVFLAQTVDRELKSKYE----MKVAVSDGINVLEIG---MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGN-IFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPL--FHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFC--SKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE---LDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSK 9722
            +P+D E  +   + +I +DG      +    I + D+NDN+P F    Y    + E+  I   + ++   DAD   K   + + L+G+  +  F I   +G++ L + +DR+  +       +  A+ D  N L +G   + + V D NDN P   + +    ++    E  H + ++ +++ A D DD  + N+ I Y +   N+ I  +S+F +++++G +         IS      + + A+DRG P    F ++T+    +T   +        +Y  +V  T+  G+ V +  A + D    +  F       S YF + +      +S  V        +  + Q  G  +   VS         + + + D N ++P I    T   + E +  G+++ +    D DAG     ++   +    +F++    T      L+V + LD E    Y+L + A+D       Q   V ++ ++++   PY + R  +   RE   ++QL    E+R  D   A    P +T++   S K
Sbjct: 1395 EPLDFEASDQYHLVLIASDGRHNATTNV--YIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGL-VGYADVQVNVRDINDNSPIFPERLFG--YIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIV-RNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIK---VTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGT------LRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCI--FRENTPVNQLGTC-EIRATDRDTAEFG-PPFTMEVSPSFK 1918          

HSP 12 Score: 58.151 bits (139), Expect = 2.089e-7
Identity = 58/230 (25.22%), Postives = 102/230 (44.35%), Query Frame = 3
Query: 8145 AHKPVDREVYNNLEISVIIADGSGGIIESCPGI----IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQ-GEENNAFSINPQN-------GSVFLAQTVDRE---LKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTI 8789
            A + +DRE+ +  E  + +     G+  S  G     IKV D+NDN+P F    + G V E A IG+ ++     DAD +     F+ Q  EE++ F +           G + + Q +D E    +  + + + VSDG +  E  + + + D ND+ P I     ++       E       +   TATD D    + ++ R +  S+ +R      F +++D G+L +
Sbjct: 1613 AMRSLDREISSEREFIIEVRANDRGV-PSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHR-----VREDVPRGTSIGRYTATDRD--AGDTARFRINRQSDPKR-----QFTIDQD-GTLRV 1828          

HSP 13 Score: 56.225 bits (134), Expect = 7.851e-7
Identity = 69/255 (27.06%), Postives = 106/255 (41.57%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE--GQFLETISIKVRIIDENDNPPIFYPNKLERRIIENI-------ALLTDISLTAATDSDTD----EFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVE--DKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEV-EYQFKKTRS---VLENEFSIDRKSGSIRLTQP 971
            +F + K +G I     +DR+  A      F+ +   +     +    ++V + D NDN PIF P +L   I EN            D+      D  T+    E+G+  N  I   N +  F +     Q  G++    +R LDRE   + +  I V   D+G P  +G   V I V D NDN+P F  ++Y   + E+   G  V+   A DAD      V  YQ  +      V  ++ S     G +R+ QP
Sbjct: 1485 VFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF-PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLI---NGESVFRID----QNTGKIF--AMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQP 1729          

HSP 14 Score: 55.0694 bits (131), Expect = 2.093e-6
Identity = 122/548 (22.26%), Postives = 224/548 (40.88%), Query Frame = 3
Query: 8142 TAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSLQ-----GEEN----NAFS-INPQNGSVFLAQTVDRELKSKYEMKVAVSDGI-NVLEIGMLIT--VTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSEN---QRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVD---VIITASD---------------RGQPPLFHSITVHFLFITAECEL---RILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIIS---GNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKI--LSSVSFCSKRE-TITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLIVLPEV 9650
            + H   DRE     +++V   D G   +I  C   ++V+D+NDNSP F    +   VS    +G+ +I +   D D+     + +SL+     GEE+    + F  +N ++G + L + +  + +      +A  +GI   L+    +T  V D     P+       K   I   E    N  ++   A  + DS+  NS + Y L++      +   K       ++G+  ++ V +  + D E V+   + +TA+D               R    +    TV     T + E+     L+ T   PI           V  I  + D    E+ + I+    G  + +F I    G+I  +   +   +  +  L V+A    +  L   +  +K    + +VI+D N  +P     +    + E    G +++ +   D D      ++  +I +   R   +PF    +S  + V  PLD+E   QY L L+A D    R + T+ V I + D +DN+P F  + +  ++ E D  + +P+V
Sbjct:  932 SPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPG-ITVDENVELNKVILRCRAVSSGDSR--NSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGL-DYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVT---------VKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYI-LTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGGR---IPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD---GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEED--VDIPKV 1455          

HSP 15 Score: 53.5286 bits (127), Expect = 5.393e-6
Identity = 87/337 (25.82%), Postives = 145/337 (43.03%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISVSNNILSCNGN-----SKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYN-----NLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALI----GSWIIDIGVIDADSKLFP---LKFS------LQGEENNAFSINPQNGSVFLAQTVDRELKSKYE--MKVAVSD-GINVLE--IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSE 8726
            F +  +SG I + EPL  +    Y L + AS    N+    Y   +    V DN  +     Y T  +EE+ D    V  N+ + + +     S++ + L  + + +       +  I    K +DR+        N  +  I  DG+G ++      + V D+NDNSPIF    F G++ EN       G + +D+   D D        +++       + GE  + F I+   G +F  +++DRE+ S+ E  ++V  +D G+   E    + I VTD NDN P   K      +  +  E A     V++ +A DAD+   +N    Y LS E
Sbjct: 1382 FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIE---DVNDNAPQFEQQKYATTVIEEDVDIP-KVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELV-KALDRDPPAGVPSWNFVVQAIDDDGNG-LVGYADVQVNVRDINDNSPIFPERLF-GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGE--SVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEK----TRYEGSVEETAPIGAAVMSFSAFDADEEAKDNV-FTYQLSEE 1704          
BLAST of Protocadherin Fat 4 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 145.206 bits (365), Expect = 1.032e-33
Identity = 259/1005 (25.77%), Postives = 413/1005 (41.09%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIE-------KLPVELDFVE-IDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPR-LNSSVKVYV----KINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI-----DHQQMVTYRI-----------SKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSEST-------KVGTILGFYTANDID-DGLNGQVRYRLTATG-MESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPAL-------HSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVL-YYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQS-VKVHIK--HDNEDEIQVLTYGAII------LPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKII-INRYTGDVFLTST----TPVEFNSIDITFLISLESLRSDTLIKYHSTKL-VLNIGDPHNLNFQKNDYFFQIPECKT---TPGLKLFRLQALYPGNPISD---LEYYIFDIYCGISERIKLPN--TMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIY-VGTVQAHDKDLDSTLEYIWINEIPEF--SLDKTSGIVTTSGV-----PLDHEAVAYFIG---KIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINS-EIIQLIASDADKSDL 5903
            R +   TV A ++ D+         + V D NDNSP F   SY  S++R     T++  VFA D D+  N  + YS+E       +   +LDF E ++ +SG +   K + +  Q+FIF + A+D+GIP  L SS +V +    K   +PK +   D +     + E++++ + I +             V Y++           SK  Q   F        + ++  LD E +  + LT+ ATD +S   S         V + DVND  P F  D     I  E T         G  +    A D D DG   +V YR+      E    F+ID  +G ++ N+  D E    +   + A D    AL         N+ V + I ++ND  P F +E +    V+++   G  V  + A D D +  L Y+L        PF +   SG + V  P+  E S  + LV++A D     R++  + V +HI+  +DN  + +   Y   +      +PK  F    +    A  + K  +SR +Y L+    D++  I +Y+G + L        P    S +  F++       + L+ Y   ++ V +I D  N        F  I E +    + G+    +QA    +P ++   +EY I         R KL N  ++ R+D+ TG I      LDREI    +  +EV   DRG   SR     V + + D NDN P F    +     E    G  +       A ++  D+   Y    E   F  + DK S   ++ GV     PLD+E V    G    I+VSDG   + A + + + D ND   +  H      + E  P  T IG+ T  +         + +  S+  K  F+++ D G +     +D E    Y L+I A D S               V V + D+NDN P   T        E+ P+N     ++ A+D D ++ 
Sbjct:  942 RPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGI-TVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVAS----TKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSF-EEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG----RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLF---NVHATDADQDEK--SSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWN--FVVQAIDDDGNGLVGYADVQVNVRDIND--NSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIV--------RNKLINGESVFRIDQNTGKI-FAMRSLDREISSEREFIIEVRANDRGVP-SREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSK-QSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHI-HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSD-PKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSNN--------IGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEF 1905          

HSP 2 Score: 112.079 bits (279), Expect = 1.043e-23
Identity = 126/444 (28.38%), Postives = 204/444 (45.95%), Query Frame = 3
Query: 3162 LAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFI--FFITAEDHGIP-RLNSSVKVYVKI-NPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEID--HQQMVTY----RISKCTQK-GAFSINQHTGIIHLINRLDREAIAFHV----LTIVATDNSST---KGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFIL-----SESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPV--DYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQ------SVHPPDHPF--VINPISGILSVSNPI 4385
            L V   +  + + V + I + D NDN P F+   Y   +      N TI KV A+D D+G N  + YS++     ++     S   RL  ++L    E+ F+  F +TA DHG P  L+SS  ++++  N + +S  F     +   ++ED +    + +++     +  VTY    +  + TQK   FSI++HTG++ L + +    +A       LT++  D+ S        + +   L + I DVN+N P F + A  + I      +  T   TI+    A D D   NG + Y L  T  ES   F ID  +G L  +  V  D E +P+ +  + A D G   L      +V + +IND  P+F + S  E  V +  A+GT+V  V+A D D     E+ Y L+        H  D  F  ++N  SG +++  PI
Sbjct:  613 LKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQL---NERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKV-EATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPS-YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI 1051          

HSP 3 Score: 102.064 bits (253), Expect = 1.124e-20
Identity = 157/612 (25.65%), Postives = 262/612 (42.81%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIKFGFSYEFFHKEG----------------LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLET-ISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDR--ETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSP-SKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQF--KKTRSVLE-NEFSIDRKSGSIRLTQPTSCHI-----NQGDCTLVVEAFDHGS----PSLSAYCYVT--VHVIRINSFFPKFRINYVGSTDKAAYIEIGKV------TRKPLAI-VHCQDDDQDPRDLIAVSIIGGNDEN--IFALERTHG----NVHIL--RQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSI----TKGDYR----DRFA-IEKDSGLITLLKPLWFVKLDKIKLEIIARDAGI-NSLETTGYLDLNILQSDQLHARIKST--CPTQFILDDS 1796
            +F   +Y   VSE+  ++  V  V  +   S+E    +G                 F ++  TG+I  + ++D +  A  L ++   K T      E+ + + +RI D NDN P F       ++ E+I L   I    A D DT      +N +I    ++  F+++       G++  +V    D+  E    Y+  ++  D G+P  L     + I  E+ ND S VF P S+YT  + E    G  V+++ A DAD     EV Y F  K  RS  + N FSID  +G ++L    S        N  + T++V+  D GS    PS +   Y T  + +  +N+  P+F        D A Y +I K+      T  P  + V   DDD      I  S+     E+   F ++R  G    + H++  R+ +   +       +TV+A D G+          + +   N   P F       +V R  ++ + +   FA D DA  N +I YS+    T G+      D F  + + SG ITL+KP+  +K  K    +IA D GI  +L+++  + LN+L   Q   + +++  C     +D++
Sbjct:  529 QFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPA--LPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDT-----GDNSRITYSVDNHNFSINS-----NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQ--DDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF-------PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPRED-------VTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI-PMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDEN 1108          

HSP 4 Score: 90.1225 bits (222), Expect = 5.607e-17
Identity = 239/1079 (22.15%), Postives = 435/1079 (40.32%), Query Frame = 3
Query: 3231 NDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMD----PDSGINGFVNYSIE-KLPV-ELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLN------------SSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIA----FHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRL---TATGMESISVFKIDTFSGALYLNQPVDY----ELKPKWNFIITAFDLG----YPA-LHSN-LSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGT------TVGRVYAQDPDTNE------VLYYLQSVHPPDHPFVINPISGILSVSNPIL----QEVSFDLVVMAVDAERQDR----YDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKI----------IINRYTGDVFLTSTTPVE-----FNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLK----------LFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEG---SQITVEVVVIDRGKNGSRIRCTKVFL-NIEDCNDNRPVFANETFIFHAPENTTYGQKIY------VGTVQAHDKDLDS---TLEYIWINEI-----PEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD----------GTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHET-APIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHL-FSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVS-IPEDVPINSEIIQLIASDAD---KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYE-----KTERHALTVSCTDGLHRVT-VEVLINLINVNDETPL 6104
            ++  P F+ Q Y  +++     + ++  V A       D    G + YS+E   P  E  +  ID  +G +   +L+D            +D  +P+L+            S V + ++I+    +   F +  +   + ED+ + + I K+  +D       RI+       FSIN + G I    RLD + +      +   + A D+         A+  +++   + ND S +F   +     ++E  + GT +    A D D     +V Y          + +++F ID  +G + L   V      E +   N  +   D G    YP+  H++  ++ + I ++N+ KP F   ++   I +  +  GT      T+ +V A D D++        LYY QS       FVI+  +G+L+ S  ++         D+ V A D  R DR    + Q SV+V   +DN  + +  +Y   +  +       + T+ A  N    N+   Y L+  +              ++NR +G++ L    P++     FN I     I  E+L+S       S ++ LN+ D      QK   +   P+CK  PG+           + R +A+  G+  S     I+ +        K  +   + +K       GN +++  I+EG    Q+    + +      SR+  TK F+  + D ND  P F  + F     E  T  + +       + TV+A D D D     + Y  + E        F +D+ +G +  +    D E +  +I  ++ SD          G       + I+I+D ND   +F   +Y   + E+    H VI   T+K    + +  +++ ++   G  + F V  D G I  +  +D+E  + Y L++ A+D    +         TT V + I D+NDN P F+  + A + I EDV I   +  + A+DAD   KS  +++ +     D +  +   +G I     LD +      +    +     DG   V   +V +N+ ++ND +P+
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDF-----------DDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM--IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAK--IMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQS--ESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATD--RGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV-SRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIP-EALQS-------SAQVTLNVLDKQ----QKAPKWQTSPDCK--PGITVDENVELNKVILRCRAVSSGD--SRNSDVIYKLTASGGPGNKAESKFRQFNK----FENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPN-EKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVI---TIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNA---------TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPI 1545          

HSP 5 Score: 85.8853 bits (211), Expect = 1.036e-15
Identity = 128/579 (22.11%), Postives = 243/579 (41.97%), Query Frame = 3
Query: 7989 FTGSVEENSDSEISVSNNILSCNGNSKV---SFTLHPKWSQDYLYYN--AETNEIRTAHKPVDR---EVYNN-------LEISVIIADGSGGIIESCPGI-----------IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENN--AFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLT-IKAVALNWISDNETVDVIITASDRGQPPL--FHSITVHFLFITAECELRILKSTFQY------PI---AVLYTSQEGSRVANIAVNHDNL-YGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQ-----LKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPY 9584
            FTG+++E    E++ + ++   NG   V   +        Q+ ++Y    E N   T H  +D    E++ N       +++ ++  + S   + + PG            I + D+NDN+P F    ++G V E+   G  +I I   D D K   L++ L G       F +   +G++F+ + +D E   +Y + +  SDG +     + I + D NDN PQ  ++    T +    +       + N+ ATDAD  +  +S+I Y L  +        +F + + SG++  +KA+  +  +   + + ++ A D     L  +  + V+   I     +   +  F Y      PI    V +   +     +    + N+ YG +   +I  NG S F I    G+I   R+++  I  +  F + V+A    + S   F +    +T+ ++D N  +P    +    S+ E   +G+ ++     D D      V    ++   D F +    T+ +S Q     L+V  PLDYE   Q     L   +   R    + V + ++D +D++P+
Sbjct: 1216 FTGTIDE----EMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD-KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPK---VLFNVHATDADQDEK-SSRIVYRLEGQG----ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPI-FPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLI--NGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFAN----VTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVT---TDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPH 1771          

HSP 6 Score: 79.337 bits (194), Expect = 1.031e-13
Identity = 121/488 (24.80%), Postives = 209/488 (42.83%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE------GQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVV-KVYASDADSG-VNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQG--DCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAI-------VHCQDDDQDPR--------DLIAVSIIGGNDENIFALERTHGNVHILRQI-KAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVF-RNRYQSVTVYRNASINSFIANFFATDLDAGLNGKII-YSIT-KGDY----RDRFAIEKDSGLITLLKPL 1631
            F +++LTG I  +   DRE +   ++ +    +++       G   + + +++ I D NDN P F   K   R+ E+     D+    A   D D+      + I +G     F     GV+     +  V  PLD E  ++Y L +   D           V I +ED NDN+P F   KY   + E ++   +V+  V+A+DAD    +  + Y+ +   +  +  F I + SG+I L +        G      VV+A D     L  Y  V V+V  IN   P F     G      YIE     R+P+         V  +D D DP          ++   +I G  E++F +++  G +  +R + + I +   + + I VRA D G PS++   ++ I++   N   P F + RY+  +V   A I + + +F A D D      +  Y ++ + DY     D+ + +   G++ + +PL
Sbjct: 1271 FRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKA--HDLDKHSNLRYHLIGAGGGRIPF-----GVRTDSGTIF-VKEPLDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGA--DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFG------YIE---ENREPIHSDGVYFMDVQARDFD-DPTTENANIEYGIVRNKLING--ESVFRIDQNTGKIFAMRSLDREISS--EREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEG-SVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPL 1730          

HSP 7 Score: 75.8702 bits (185), Expect = 1.133e-12
Identity = 243/1105 (21.99%), Postives = 434/1105 (39.28%), Query Frame = 3
Query: 3183 KEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINR------HTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVE--LDFVEIDSQSGRLFTNKLVDVVEQEFI----FFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKI-----FKLEIDHQQMVTYRISKCTQKGAFS---------INQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKN--DALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGM---ESISVFK-IDTFSGA-----LYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKE---SRLEFIVQQNVAIGTTVGR----VYAQDPDT----NEVLYYL--QSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRY----------DQQSVKVHIK----HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHN--LNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEG-SQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIF-HAPENTTYGQKIYVGTVQAHDKDLDST----LEY-----IWINEIPEFSLDKTSG-IVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNP-NFIIKFDIVSEWGKHLFSVNPDH-----GIITTQGEIDYE---QDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIP-VFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVE-VLINLINVNDETPLIHNPTTVYLP-------KINQNHNIMIKCSDQD--NLGP 6194
            K  ++   ++I ++D N+N P F   + +  I +       T P T + KV A D DS  NG + YS+     E    FV ID Q+G L  +  V V ++E        + A D G   L    +  V++     +   F++ ++  ++S    +   +     F  +  H   +TY +   T  G            +N+ +G I LI  +  +   F +  ++A DN   +  +  A   L  N++D    +P ++   D      + E+ ++  ++    A    D  N  V Y+LTA+G    ++ S F+  + F        + + + +DYE    +   +TA D+    + S  +  V + ++ND  P+F  +     ++  +  N  +  T G+    V A D D+    NEV Y +  ++       F I+ ++G +   N        D+ ++ V+A   DR           ++ +VKV I     +DN    +   Y   +  +S      + T+KA    K+ N R+  +          +   +G +F+    P++F + D   L+ + S          +T + ++I D ++    F++  Y   + E        LF + A       +D +     I   +    +  + + R+ K +G I +    LDR+   G       V  ID   NG  +    V +N+ D NDN P+F    F +        +   +Y   VQA D D  +T    +EY       IN    F +D+ +G I     +  +  +   FI +++ +D    S      +     D   N   F   RY   + ETAPI   +   +  ++     + +  + +  E      + + D      G++  +  +DYE   Q + + L I  +D    +            V V++VD ND+ P +   T   V   EDVP  + I +  A+D D  D   F I   +D          G +  A  LD E    + L +   D  + +  + V + L +VND  P    P TV  P        +NQ     I+ +D+D    GP
Sbjct:  843 KTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV-KVEATDDDSSANGDIVYSLYYTQSESRKAFV-IDRQTGVLTPSPHV-VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKF-IFNVIADDNGIPEALQSSAQVTL--NVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEI-FPNEKFDREKIDMYILTVEA--SDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRV-KESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKE--PLDFEASDQYHLVLIASDGRHNA----TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATD-----ADQDEKSSRIVYRLEG--QGADEVFRIGKYSGTIELVKA-LDRDPPAGVPSWNFVVQAIDDDGNG-LVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDA---------EAAVHVALVDRNDHAPHIHGATEHRVR--EDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGP---EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGP 1907          

HSP 8 Score: 74.7146 bits (182), Expect = 2.234e-12
Identity = 90/382 (23.56%), Postives = 156/382 (40.84%), Query Frame = 3
Query:  651 LDRETKEKYKLTISVEDKGQPPLKGV-------LEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHI-NQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPR-DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINS---FIANFFATDLD--AGLNGKIIYSITKG---DYRDRFAIEKDSGLITLLKPL--WFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSD 1739
             DRE  + Y LT+   D+    L G        ++V+I++ D NDN+P F   KY  R+ ES   G +V+ + A D D   N            +    F +   SG+I + +P      +Q    L+     H     +A   V +H+  +N   P+F      +T     ++I KV    L  VH  D DQD +   I   + G   + +F + +  G + +++ +       + S+   V+AID+         D+ + +   N   P+F  R           I+S   +  +  A D D     N  I Y I +    +    F I++++G I  ++ L        +  +E+ A D G+ S E  G+ ++ I  +D
Sbjct: 1286 FDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRI---PFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH-----NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKV----LFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSRE--GFANVTIKVTD 1653          

HSP 9 Score: 74.3294 bits (181), Expect = 2.848e-12
Identity = 151/679 (22.24%), Postives = 268/679 (39.47%), Query Frame = 3
Query: 7800 FFS-INRESGQISLNEPLPQLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKC----TNHGYFTG-SVEENSDSEISVSNNILSC----NGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHK--------------PVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALI--------GSWIIDIGVIDADSK------LFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD----------GINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSL-SSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHF--------LFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNS---AILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIR------ISETTVSISELIKVGSNLLQVDVIDPDAGLA----GIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEI--QHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            FF  +NR SG+I+L +P+P     +   + A    +   +       V+++V D   K     T+     G +V+EN    + ++  IL C    +G+S+ S  ++ K +      N   ++ R  +K               +D E  NN  +++   D +  +  +   +++V D+ND  P FT++ F G + E            G  I+ +  ID DS        + +     GEE   F I+   G +F  +  DRE    Y + V  SD          G N   + + I + D NDN P   ++     ++    E       V+ I A D D     +S +RY L  +   RIP    F +  DSG++ +K   L++ + ++   +++ ASD G+     ++ +H          F   +    +++     P  VL+       V     + D     I + +        F IG  +G I   + ++    A +  W + +VQA        V +      + + + D N  SP         I E    I        ++   D  DP    A    GIV+  +I           F  + N+ ++  +  LD EI  + ++ + + A+D G P +   + V IKV D +DN+P+F    +  S+ E
Sbjct: 1034 FFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEAL--QSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDEN----VELNKVILRCRAVSSGDSRNSDVIY-KLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQ----KYIGRVKESEGEGHDVITIKAHDLD----KHSNLRYHLIGAGGGRIP----FGVRTDSGTIFVKE-PLDFEASDQ-YHLVLIASD-GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIP-KVLFN------VHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSW-NFVVQAIDDDGNGLVGYAD----VQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGES------VFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEE 1672          

HSP 10 Score: 73.559 bits (179), Expect = 5.035e-12
Identity = 131/556 (23.56%), Postives = 235/556 (42.27%), Query Frame = 3
Query: 8262 NDNSPIFTLNYFMGFVSENALIGSWIIDIGVI------DADSKLFPLKFSLQGE----ENNAFSINPQNGSVFLAQTVDRE---LKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVI---ITASDRGQP-PLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSS-----YFSIGSKNGQISTSRNVNSAILGQW-----FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGS------NLLQVDVIDPDAGLAG-IVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNP-----LDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL---IVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLI 9803
            ++  P F    +   VSE+ L+   ++D+         D  SK  P+ +SL+G+    E   F I+P  G + L + +D +   L   +++KV   +      + + I + D NDN P  ++ +    +     E    N  ++ +TA D D    +NS+I YS+ + N        F +N + G ++ K V L+    NE   V    +TA D G+P  L  S  +H        E  +   T QY   V   +Q G+ V  I    D    E+T+  +  NG S      FSI    G +     V++A L +       ++IVQ  G+  +      +   T+ + I D N   P+         I+++++ G+       +++V+  D D+   G IV     T ++ R + V         Q  V+ P      D E + +  +T+ A D G           ++V+D +DNSP F   ++  S+   + +   ++     D D+  A   E +Y+L+  T++  +  Q+  +F   + +RS   ++I  I
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSK-GPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPL----YTAQVREDIPLNQTILKVTAVDKD--TGDNSRITYSVDNHN--------FSINSN-GEISAK-VRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQA-RDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIME-GTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVI------DRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA--AHNAEITYSLEIDTTAGEE-HQNDLDFFELVNRRSGEITLIKPI 1051          

HSP 11 Score: 64.6994 bits (156), Expect = 2.246e-9
Identity = 119/544 (21.88%), Postives = 230/544 (42.28%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLN-YFMGFVSENALIGSWIIDIGVIDAD--SKLFPLKFSLQGE-ENNAFSINPQNGSVFLAQTVDRELKSKYE----MKVAVSDGINVLEIG---MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGN-IFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPL--FHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFC--SKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE---LDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSK 9722
            +P+D E  +   + +I +DG      +    I + D+NDN+P F    Y    + E+  I   + ++   DAD   K   + + L+G+  +  F I   +G++ L + +DR+  +       +  A+ D  N L +G   + + V D NDN P   + +    ++    E  H + ++ +++ A D DD  + N+ I Y +   N+ I  +S+F +++++G +         IS      + + A+DRG P    F ++T+    +T   +        +Y  +V  T+  G+ V +  A + D    +  F       S YF + +      +S  V        +  + Q  G  +   VS         + + + D N ++P I    T   + E +  G+++ +    D DAG     ++   +    +F++    T      L+V + LD E    Y+L + A+D       Q   V ++ ++++   PY + R  +   RE   ++QL    E+R  D   A    P +T++   S K
Sbjct: 1395 EPLDFEASDQYHLVLIASDGRHNATTNV--YIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGL-VGYADVQVNVRDINDNSPIFPERLFG--YIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIV-RNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIK---VTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGT------LRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCI--FRENTPVNQLGTC-EIRATDRDTAEFG-PPFTMEVSPSFK 1918          

HSP 12 Score: 58.151 bits (139), Expect = 2.089e-7
Identity = 58/230 (25.22%), Postives = 102/230 (44.35%), Query Frame = 3
Query: 8145 AHKPVDREVYNNLEISVIIADGSGGIIESCPGI----IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQ-GEENNAFSINPQN-------GSVFLAQTVDRE---LKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTI 8789
            A + +DRE+ +  E  + +     G+  S  G     IKV D+NDN+P F    + G V E A IG+ ++     DAD +     F+ Q  EE++ F +           G + + Q +D E    +  + + + VSDG +  E  + + + D ND+ P I     ++       E       +   TATD D    + ++ R +  S+ +R      F +++D G+L +
Sbjct: 1613 AMRSLDREISSEREFIIEVRANDRGV-PSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHR-----VREDVPRGTSIGRYTATDRD--AGDTARFRINRQSDPKR-----QFTIDQD-GTLRV 1828          

HSP 13 Score: 56.225 bits (134), Expect = 7.851e-7
Identity = 69/255 (27.06%), Postives = 106/255 (41.57%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLE--GQFLETISIKVRIIDENDNPPIFYPNKLERRIIENI-------ALLTDISLTAATDSDTD----EFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVE--DKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEV-EYQFKKTRS---VLENEFSIDRKSGSIRLTQP 971
            +F + K +G I     +DR+  A      F+ +   +     +    ++V + D NDN PIF P +L   I EN            D+      D  T+    E+G+  N  I   N +  F +     Q  G++    +R LDRE   + +  I V   D+G P  +G   V I V D NDN+P F  ++Y   + E+   G  V+   A DAD      V  YQ  +      V  ++ S     G +R+ QP
Sbjct: 1485 VFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF-PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLI---NGESVFRID----QNTGKIF--AMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQP 1729          

HSP 14 Score: 55.0694 bits (131), Expect = 2.093e-6
Identity = 122/548 (22.26%), Postives = 224/548 (40.88%), Query Frame = 3
Query: 8142 TAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSLQ-----GEEN----NAFS-INPQNGSVFLAQTVDRELKSKYEMKVAVSDGI-NVLEIGMLIT--VTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSEN---QRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVD---VIITASD---------------RGQPPLFHSITVHFLFITAECEL---RILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIIS---GNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKI--LSSVSFCSKRE-TITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLIVLPEV 9650
            + H   DRE     +++V   D G   +I  C   ++V+D+NDNSP F    +   VS    +G+ +I +   D D+     + +SL+     GEE+    + F  +N ++G + L + +  + +      +A  +GI   L+    +T  V D     P+       K   I   E    N  ++   A  + DS+  NS + Y L++      +   K       ++G+  ++ V +  + D E V+   + +TA+D               R    +    TV     T + E+     L+ T   PI           V  I  + D    E+ + I+    G  + +F I    G+I  +   +   +  +  L V+A    +  L   +  +K    + +VI+D N  +P     +    + E    G +++ +   D D      ++  +I +   R   +PF    +S  + V  PLD+E   QY L L+A D    R + T+ V I + D +DN+P F  + +  ++ E D  + +P+V
Sbjct:  932 SPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPG-ITVDENVELNKVILRCRAVSSGDSR--NSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGL-DYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVT---------VKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYI-LTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGGR---IPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD---GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEED--VDIPKV 1455          

HSP 15 Score: 53.5286 bits (127), Expect = 5.393e-6
Identity = 87/337 (25.82%), Postives = 145/337 (43.03%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISVSNNILSCNGN-----SKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYN-----NLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALI----GSWIIDIGVIDADSKLFP---LKFS------LQGEENNAFSINPQNGSVFLAQTVDRELKSKYE--MKVAVSD-GINVLE--IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSE 8726
            F +  +SG I + EPL  +    Y L + AS    N+    Y   +    V DN  +     Y T  +EE+ D    V  N+ + + +     S++ + L  + + +       +  I    K +DR+        N  +  I  DG+G ++      + V D+NDNSPIF    F G++ EN       G + +D+   D D        +++       + GE  + F I+   G +F  +++DRE+ S+ E  ++V  +D G+   E    + I VTD NDN P   K      +  +  E A     V++ +A DAD+   +N    Y LS E
Sbjct: 1382 FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIE---DVNDNAPQFEQQKYATTVIEEDVDIP-KVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELV-KALDRDPPAGVPSWNFVVQAIDDDGNG-LVGYADVQVNVRDINDNSPIFPERLF-GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGE--SVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEK----TRYEGSVEETAPIGAAVMSFSAFDADEEAKDNV-FTYQLSEE 1704          
BLAST of Protocadherin Fat 4 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 143.665 bits (361), Expect = 2.876e-33
Identity = 222/946 (23.47%), Postives = 408/946 (43.13%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTN-KLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFD----KQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSI------NQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYA---QDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNP--ILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTT----PGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEYIWINEIPEFS--LDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD---GTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADK 5894
            R +Y   + A +     K  ++   I + D NDN+P+FS   Y  S++ +    + +  V A D D G N  ++Y I+K     +     SQSG + T   L+     + I  + A DHG P L+SS  V + +  S  S    D     ++   ++ E+  +   + ++ I  Q    YR +K    G+ ++        H  ++ L   LDRE  + H L  +       K  + +      + I D+NDN+P + +  ++  I    T+ G+     TA D D G NG +RY +  T + S     ID  +G +++   +D  +  +  F + A D G PAL ++L V   + +   + P+F K +  +  + ++  IGT + +V A   Q  ++  + Y LQ+    D    ++ +SG + +       ++ S+   V+A +A  +      S+++   +DN        Y   +          +    +  +S        ++L  SS     IN  TG+VF  +  P+      +  ++S +     +     +  + +   D     F ++ Y     E +TT    PG+ +  + A+      S ++Y    IY G  +          +D++TG I V   YLD ++ +   + ++  +     N      T+V + IED NDN P F++        E+    +  YV  VQA DKD   +  + Y  I+  P  S  +D+ +G ++T G  LD+EA   +  +++ +D      +S   + I + D ND    F    Y   + E +P  T++G+V  ++  +  N  I + I +  G   F ++   G + T+  ID E  +H  + I A D       +P   + T +  +S++D+NDN P    +   + +P   P+++ I  ++A D DK
Sbjct:  196 RDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVI--VVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQ----YRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLL-----EKDGQIIIEHPQLLTIGDINDNAPQWHSSQIH--ISLNRTQGGSRT--LTAKDPDLGQNGWIRYSVLDTELVS-----IDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEK-ALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN---QDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESS--SFSINPVTGEVF--AQKPLARGRFHL--VVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKY-----EIRTTEDILPGIAIGSVGAM------SKVKY---SIYSGDQDH------NFSIDEDTGKIYVTR-YLDADVHDTVLLNIQATLPSGESNQ-----TQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYV--VQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLST-GSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN--GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKG-----VPP-RSSTASARISVLDVNDNPPSC-LSITPIVVPAGSPLSTAIGTIVAMDPDK 1073          

HSP 2 Score: 142.124 bits (357), Expect = 8.773e-33
Identity = 172/637 (27.00%), Postives = 273/637 (42.86%), Query Frame = 3
Query: 2814 VDKNVNGRLIELRIELFDG----LSGDLSVSNTEIIIEFHPIFDSPIFFEPFYTFVVKENSLSHTPLRKISLIQSQ---------NIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVK-INPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFL 4676
            +D N+ G  I+ R+   DG    LS DL V    +  E  P    P F +  +   + E++   T L K+    SQ         ++ N    +  +++ G   I            D+E++K Y  TV+A N N  E ST   + I ++D NDN PIF    Y  ++    KP   +  V A D DSG  G V+Y I     E     I+  +G +F  K   +    F   ++A+D G     +S  +++  I+   K+ QF  +  +    +ED  I   I    +     V Y I    Q   FSI++ TG I++   LD +     +L I AT  S          T + + I D NDN P F + +L    + E  K+        A+D D   NG+VRY + ++     S  +ID F+G L     +DYE    +   + A DLG P   SN+++ + + ++ND  P F K S     V +N    T VG+V A+D D+ E    +  +      F I+   G +     I +EV    D+ ++A D     R    S ++ +   N++    L+   I++P  S     I T+ A    K LN   +Y  +  S   + + +  GDV+L
Sbjct:  498 IDCNI-GSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKP----PQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCI--------QKTFDFEKQKSYQTTVIATNAN-SETSTS-LISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILS---ESSSFSINPVTGEVFAQK--PLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQF-SRSKYEIRTTED--ILPGIAIGSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQ-----TQVVIFIEDHNDNPPQFSS-SLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISS--HPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEK-SWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQS--SLFVVKSNGDVYL 1100          

HSP 3 Score: 129.798 bits (325), Expect = 5.332e-29
Identity = 157/567 (27.69%), Postives = 251/567 (44.27%), Query Frame = 3
Query:  120 FLILMILCVKFLSSQYNFRVSENQPINTIVGQVLIKFGFSY--EFF------HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQ---PTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVD--MLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHARIKSTCPTQF 1781
            F ++ ++   F      F V E+  I T +G +  K   S   ++F             +++ +G I T   +D E  +    +I   K    G   ETI I V + DENDN P F    ++  I E   L T  +L   TD D  +F V + + I  GN ++ F L+   V  + Q  L V   LDRE ++KY+L I  +D G+P   G L   I + D NDN+PVFS S+YT  ++ +   G  ++ V A+DAD G N  + Y  KKT +   + F+I  +SG I  T    P S H       ++V A DHGSPSLS+   VT+ V+      P   I ++  ++ A  +E   +     +IV      Q  RD   + +IG +   +   +    +V++L     +       + +      +G    Q  ++   L+ I   N   P + +    +++ R    +  +    A D D G NG I YS+   +     +I+K++G I +   +      +IK  + A D G  +L T    DL ++ +D L    K   P QF
Sbjct:   12 FSLIFLIFPTFCQCLTKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSK--FDIVAVKVEESG---ETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDV-HRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAIS-QSGVITTTASLLPASTH------DVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLG----SIVARVSIAQQYRD-TKLRLIGSS--ALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDG----QIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRTLT---AKDPDLGQNGWIRYSVLDTEL---VSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALST----DLQVV-ADLLDTESK---PPQF 540          

HSP 4 Score: 112.079 bits (279), Expect = 1.113e-23
Identity = 106/381 (27.82%), Postives = 178/381 (46.72%), Query Frame = 3
Query: 3162 LAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHT-KPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPS-PKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYEL----KPKWNFIITAFDLGYPALHS--NLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQD 4280
            L +   D    T   + IFV D NDN+P FS   Y  +++  T  P     K+ A D D+   G + YS+ +    +    +  +SG LF  K++    + ++  +TA D+G+P  ++SV V V I  + P  K  F+K  F   + E+ KI  +I  L  +  +   YRI        FSI++  G + +   +DRE  A H    V  DN      +       +V ++D NDN P+F + A     L +S   G  +G   A+D D G NG+V YR+ +    +I     DT  G++ LN+  D +L       W  ++ A D G+PA  +   + V++ +++ +   P F      E  V ++ ++GT + ++ A +
Sbjct: 2000 LTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSI--FRVAPESGALFM-KVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQ-VEIDNEMMTSQKVQC--KCHVIVLDENDNLPVFTSVAY-YLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDT--GSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPV-YEVHVLEDTSVGTVLQKIRASN 2367          

HSP 5 Score: 107.842 bits (268), Expect = 2.394e-22
Identity = 200/828 (24.15%), Postives = 341/828 (41.18%), Query Frame = 3
Query: 3732 NRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPK--WNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVA-------IGTTVGRV--YAQDPDTNEVLYYLQSVHPPD----HPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAII--LPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNS-------SYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNL--NFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLP----NTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXX---XXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GL--HRVTVEVLINLINVNDETP 6101
             +LDRE    + L I A D         L  +   + IID NDN+P+F        + S +  +G+ L    A D D G N ++ Y +  T   S S F I + SG +         L P    + I+ A D G P+L S+  VT+T+       P  +    + ++V+ N A       +G+ V RV    Q  DT   L    ++ P      H +++  + GIL         + F L              ++  ++ I+H      Q+LT G I    P+    +  I+  + Q  S+ L ++   L +N          + + I++ TG +F+ +T      S +I F +  E   S  L      ++V ++ D  +    F+K  +  +IPE  T  G  L ++ A               +  CG S+RI+      +  + +D  +G + +   + D E     Q + +  VI    N S    + + + ++D NDN P+F    +     E     + + V +    D      + Y  ++E   FS++  +G V     PL   A   F   +   DG   S+ N       + D + +   F+  +Y     E       IG V   +        +K+ I S    H FS++ D G I     +D +  +  +L I AT        LP  E+  T V++ I D NDN P F ++ + +SI ED+ ++     + ASD D  K+  + + I+S +    + ++  TG +ST  +LDYE T  + L V  TD G+      + + I++++VND  P
Sbjct:  189 GQLDREFRDKYELLIEAQDGGKPAKIGQLRCS---IEIIDANDNAPVFSRSRYTASV-SANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAI-SQSGVITTTA----SLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLD----IIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLL-LCGILDRETASEHHLKFLL--------------EKDGQIIIEHP-----QLLTIGDINDNAPQWHSSQIHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGS-EIKFRVRAEDGGSPAL--STDLQVVADLLDTESKPPQFEKALWQVEIPE-DTPIGTCLVKVVA--------------NNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTF-DFE----KQKSYQTTVIATNAN-SETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQK-PL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK-------VKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQAT--------LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAP 940          

HSP 6 Score: 93.5893 bits (231), Expect = 4.693e-18
Identity = 191/830 (23.01%), Postives = 346/830 (41.69%), Query Frame = 3
Query: 3693 FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAI---GTTVGRVYAQ-DPDTNEVLYYLQSVHPPDHPFVINP---ISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKII---INRYTGDVFLTSTTPVEFNSI-DITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMI-RLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNI---EDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE----FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIIT----TQGEIDYEQDNHYILLITATDVSQQSLFLPCLETV-TTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASD--ADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDE 6095
            FSIN  TG I ++  LDREA   H+L I+ TD  S   S  + VT     + D NDN P       +   ++ES++VG +L  + A+D+D G NG+  + L      S+ +      +G L L +    +    W   +   D G P L+  +   + I+N N   P+   ++ LEF+ Q  ++    G   G+  A+  P+   + Y +   +  D  F ++    I   L +   IL+  S  ++      +   R D   V+V+  +DN     +     +  P++      +AT+ A+ +  NL     +L+ +SS        I+++TG + LT+  P++F  + + T  I       DT      T L + + D        N   F  P  +TT     F      PG P + +E +  D    ++  +   ++ I R+  E+     G +++      G +  V V   D   NG     T V +++   E    ++P F    F F   EN+  G  + +G +   +     + E+ +  + PE    FS+DK  G +  +G P+D E  A    ++++ +   TS            D+  N   FT   Y+  + ++      IGQ+   +  +  N  + + I+S    ++ ++NPD G I        ++D   +  + +L+ A D        P    V    V + +   + + P F      V + ED  + + + ++ AS+    ++D LL+ +      L + V   TG ++    LD+E     ++ +S +DG  R  V  L  ++   DE
Sbjct: 1673 FSINSTTGSISVLP-LDREASQEHLLIIILTDGGSRNDSCTVRVT-----VADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVP---ETGDLVLRRLSSLQ---SWKIKLRVVDHGVPGLY--VEKNLEISNRN---PQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGN-IDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQIGTRVD---VRVNNLNDNVPSFPMSKPRRV--PENLRVGSYVATVGAK-DVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTA--PLDFEVLPEHTLTIKATDGSFDTF-----TNLTIFVSD-----INDNAPTFSKPLYQTTVSPATFS-----PGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPES-----GALFMKVLPPAGERYLVTVTATD---NGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIG--LQIGNLSGEE-----SREFHYRIQDPEASKIFSIDKF-GRLFVAG-PIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGH-----PARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVK--TGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVDE 2437          

HSP 7 Score: 88.1965 bits (217), Expect = 1.923e-16
Identity = 139/535 (25.98%), Postives = 223/535 (41.68%), Query Frame = 3
Query: 8076 FTLHP-KWSQDYLYYNAETNEIRT-AHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFS-LQGEENNAFS-----INPQ-NGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGML---ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP------------IAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQ------WFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            F + P + +  +L  +  + EI T AH  +D E  +  +I  +  + SG  I+    +++V D NDN+P F        +SE A +G+      V D D   F + +F  LQG  NN F      +N Q    + +   +DRE + KYE+ +   DG    +IG L   I + D+NDN P  S+     +   N S  +H    ++ + ATDAD  +  NS+I Y +  +    P  S F +++ SG +T  A  L       T DVI+ ASD G P L  S  V          + +L ST   P              ++  S  GS VA +++     Y +    +I   GSS      +  Q      +   IL +          +++  G  I+             L I D N  +PQ   S+  +S++   + GS  L     DPD G  G ++ +++ +      LV    +  + ++ V N +D  I  +    + A D G P  S    V+  +LD +   P F
Sbjct:   57 FVVFPDEQTSKFLKVDERSGEISTIAH--LDYEKRSKFDIVAVKVEESGETIDI---LVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSH----LITVQATDADIGE--NSRISYDI--KKTSAPSNSNFAISQ-SGVITTTASLL----PASTHDVIVVASDHGSPSLSSSAVV---------TITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQ--YRDTKLRLI---GSSAL-CPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL--------LTIGDINDNAPQWHSSQIHISLNR-TQGGSRTLTAK--DPDLGQNGWIRYSVLDT-----ELVSI--DKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQF 540          

HSP 8 Score: 88.1965 bits (217), Expect = 1.923e-16
Identity = 89/382 (23.30%), Postives = 177/382 (46.34%), Query Frame = 3
Query:  633 LRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQ---GDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSF--------FPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIG-GNDENIFALERTHGNVHI---LRQIKAIHNINLQSYTITVR--AIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVK-LDKIKLEIIARDAGINSLETTGYLDLN 1724
            L V  P+DRE +  ++  + ++++     K   +  +IV D NDN PVF+   Y + L +S   G ++ ++ ASD DSG N  V Y+      +  N  +++  +GSI+L +     +++       ++VEA DHG P+ +A   V V  ++++S+         P + ++ +  T       +G V +K                + A + +G  ND  +++L+   G + I     ++    +++ +S  I     ++ +GN  +   V + I +   + + PVF     ++ +  +      +    A D D G++G + YSI+  D +    IE+ +G+I L KPL   + L   ++ ++A  +     +TT YL++ 
Sbjct: 2182 LFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDL--NIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVS-LKMSSWSGSAPFFVLPVYEVHVLEDT------SVGTVLQK----------------IRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGN-GRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSIS--DRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIG 2535          

HSP 9 Score: 86.6557 bits (213), Expect = 5.086e-16
Identity = 107/430 (24.88%), Postives = 183/430 (42.56%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQV--LIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCH-INQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPK-FRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKAN 1424
            +F  S+Y  R +E+      +G V  + K  +S     ++  F++++ TG I  +  +D +   + L+ I   + TL         + + I D NDNPP F  + +E  I E++ L     +  A+D D  + G    Y I S +      +     Q+ GQL    +  LD E    YKL +   D G PP    + + I V D NDN+P F  S YT+ + E++ P   V KV A D DS  N ++ Y+           F ID K G++   +      I+  D ++V E  D G P  S+     + V+ +N   P    I  +        +  G      +  +   D D   + L    +     ++   + +++G+V++ RQ+ A      +   ++V   D G P K     + +RI+K +
Sbjct:  740 QFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNI---QATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNG-EVRYSIISSHPGSSIEID----QFTGQLSTGSL--LDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY----FGIDEKLGNVYTKRSIDREVISHVDISIVAE--DKGVPPRSSTASARISVLDVNDNPPSCLSITPI-------VVPAGSPLSTAIGTIVAMDPD---KGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDE---RHQRLSVIVSDQGVPRKSVVCHVPVRISKGS 1140          

HSP 10 Score: 85.8853 bits (211), Expect = 9.068e-16
Identity = 104/408 (25.49%), Postives = 184/408 (45.10%), Query Frame = 3
Query: 2886 SVSNTEIIIEFHPIFDSPIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFI-----FFITAEDHGIPRLNS--SVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQ-----QMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPV 4073
            SV  + II E  P  D P F +  + F V ENS     +  +S  +S+    +H  I +      +SI   G L++   +D E+R  + F V   N+    +  +    + V D NDN P+F++ +Y+ S+         IG++ A D DSG NG V+Y I     +L+ V ++  +G +  N+  D    EF        + A DHG P   +   V+V +K++    S  FF    +  ++ ED  +   + K+   ++       + Y + +   +G   I+  TG + L   LD E+     + +  +D     G+   AV  L + +  V++ +P+F   +     +  ST  G  +G   A D D G++G V+Y ++    +  S  KI+  +G + L +P+
Sbjct: 2113 SVPVSVIIGEAEPT-DKPGFEKAEFRFEVMENSKIGLQIGNLSGEESRE---FHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILS-GNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKE--HQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSD-----GNGRSAVVPLKIVVEPVDEFAPVFTKSSY-TLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSIS----DRQSTVKIEEHTGIIRLQKPL 2503          

HSP 11 Score: 83.1889 bits (204), Expect = 5.878e-15
Identity = 135/562 (24.02%), Postives = 241/562 (42.88%), Query Frame = 3
Query: 8157 VDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSL----QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILG-QWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVN--PLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLI--KVLDEDDNSPYFISRNF-VASLRELDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILDV 9812
            +DRE+     + VI   GSG  I +   + +V +LNDN P F ++     V EN  +GS++  +G  D D+ L PL++ L     G+    F+I+   G++ L   +D E+  ++ + +  +DG       + I V+D NDN P  SK +   T  ++ + F+ G  F   I A D D        + YSL   +      S+F +  +SG+L +K +        E   V +TA+D G P    S+ V  +   AE   +      ++   V+  S+ G ++ N++        E  + I     S  FSI  K G++  +  ++        F + +     ++++S     K   I L   D N   P        +S+ + +  G  + Q+   D D+G  G V   I++  D   ++V    +  S QL   N   LD      + + + A D G P ++    V +  K+     ++P+F+   + V  L +     VL ++R  + +    +   Y+LK +   K+ +       TLK      +E +I++ L V
Sbjct: 1888 LDREILERYSLKVI-GTGSGQQIGTRVDV-RVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDN-LAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTT--VSPATFSPGQPF-AKIEAHDLD----ARGALTYSLGQGS-----SSIFRVAPESGALFMKVLP----PAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESR---EFHYRIQDPEASKIFSI-DKFGRLFVAGPIDREQRATHEFQVEID---NEMMTSQKVQCKCHVIVL---DENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGND--LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLK-EHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSV 2416          

HSP 12 Score: 75.0998 bits (183), Expect = 1.909e-12
Identity = 117/516 (22.67%), Postives = 217/516 (42.05%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLET-ISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGST--DKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKA-IHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHARIKSTCPTQFILDDS 1796
            L +++K TG I   N ID  ++ S+ I+  +  +      L T + +   ++D    PP F     +  I E+  + T +    A +S   + G S   +    N+D+   +  +     G + ++  +  D E ++ Y+ T+   +        ++ + +  +D NDN P+F P++Y + + E   P   ++ V ASD DSG   EV Y      S     FSI+  +G +   +P    + +G   LVV A D G  S      + + VI  ++  P+F R  Y   T  D    I IG V                    +  SI  G+ ++ F+++   G +++ R + A +H+  L    + ++A      S QT V  +I I   N   P F +    +++  +  ++       A+D D   NG++ YSI          I++ +G ++    L +      KL + A D GI    +   L +++L  +      + +  T  +L++S
Sbjct:  482 LVSIDKETGRIFVPNTIDC-NIGSE-IKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNS---QCGNSKRIRYSLQNQDEHLTVDTMS----GTVCIQ--KTFDFEKQKSYQTTVIATNANSETSTSLISIRL--KDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESS----SFSINPVTGEVFAQKP----LARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV---------------GAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVL----LNIQATLPSGESNQTQV--VIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENS 955          

HSP 13 Score: 70.4774 bits (171), Expect = 3.804e-11
Identity = 103/460 (22.39%), Postives = 193/460 (41.96%), Query Frame = 3
Query: 8241 IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDA---DSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGML-ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSL-TIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTD------DRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            +  ++D     P F    +   + E+  IG+ ++ +   ++   +SK   +++SLQ ++ +  +++  +G+V + +T D E +  Y+  V  ++  +     ++ I + D NDN P          + +   E       ++ ++A+D D       ++ Y + SE+      S F +N  +G +   K +A           ++++A D G     +S  +H   I  + +      T Q+  +          +  IA+       ++ + I SG+    FSI    G+I  +R +++ +      L +QA      +  S  S +  + + I D N   PQ   S   +SI E +K+      V   D D    G V+ +II+S        D+F+           QL   + LDYE    Y L + A DLG P +S    + I VLD +DN+P F
Sbjct:  527 VADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKR--IRYSLQNQDEH-LTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIF----YPNEYHLTVREGPKPEEPLLVVSASDMD--SGTFGEVSYHILSES------SSFSINPVTGEVFAQKPLARGRFH------LVVSAKDGGGQSSENSANIHITVIDKDTK------TPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVL-LNIQA------TLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFT----------GQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF 942          

HSP 14 Score: 69.707 bits (169), Expect = 6.955e-11
Identity = 129/553 (23.33%), Postives = 228/553 (41.23%), Query Frame = 3
Query:  144 VKFLSSQYNFRVSENQPINTIVGQVLIKF-GFSYEFFHK--EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDT----DEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNL-PGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSI--RLTQPTSCHINQGDCTLV-VEAFDHGSPSLSAYCYVTVHVIRINSF----FPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGN-PSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWF-VKLDKI-----KLEIIARDAGINSLETTGYLDLNILQS 1736
            ++FL   Y   + E  P    + ++  +  G +Y       +  F+++   GVI T+  +DRE L    +++     T  GQ + T  + VR+ + NDN P F P    RR+ EN+ + + ++   A D D       F VS++    SG     F +     Q+ G + L    PLD E   ++ LTI   D           + I V D NDN+P FS   Y   ++ +   PG    K+ A D D+     + Y   +  S +   F +  +SG++  ++  P       G+  LV V A D+G PS S    V+V +          F K    +    +    ++IG ++ +     H +  D +   + ++   G          R      I R+ +A H   ++        IDN    S++      + +   N   PVF +    +++  + +    I    A+D D+G NG++ Y I  G+  +   +  D+G I L +  W   +LD+      ++ + ARD G  +    G + +++  S
Sbjct: 1830 LEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGNIDSAFSVDS-EGVIRTNLELDREILERYSLKVI---GTGSGQQIGT-RVDVRVNNLNDNVPSF-PMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDS----SGQTPTHFNID----QFTGTIHLTA--PLDFEVLPEHTLTIKATDGS---FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSI---FRVAPESGALFMKVLPPA------GERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFG----------RLFVAGPIDREQRATHEFQVE--------IDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNE--WNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMS 2332          

HSP 15 Score: 65.855 bits (159), Expect = 9.745e-10
Identity = 117/475 (24.63%), Postives = 196/475 (41.26%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGE-------ENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE---IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTI---------KAVALNWIS------DNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFIS 9593
            I++ D+NDN PIF  N +   V E       ++ +   D DS  F       GE       E+++FSINP  G VF  + + R    ++ + V+  DG          + ITV D +   PQ S+      + I T+E     I + ++ A          S+++YS+ S +Q       F ++ED+G + +           V LN  +       N+T  VI        PP F S  V    I+   +L++       P  V+  S +  +            GE+ + IIS +  S   I    GQ+ST   ++     + + L V+A    I       S   T+ + + D N  +P+   S  T+ + E     + + +V   D D+   G + +  IT+  + F +      GN Y  + +   D E+     ++++A D G P +S T+   I VLD +DN P  +S
Sbjct:  629 IRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTF-------GEVSYHILSESSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSR----SKYEIRTTEDILPGIAIGSVGAM---------SKVKYSIYSGDQ----DHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVE---ISIREDLKL-----HEPFYVVQASDKDKKKN----------GEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEAT-RNYKLRVKATDLGIPPR----SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQI-VYRITNGSEYFGI--DEKLGNVYTKRSI---DREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLS 1047          

HSP 16 Score: 61.2326 bits (147), Expect = 2.434e-8
Identity = 87/348 (25.00%), Postives = 140/348 (40.23%), Query Frame = 3
Query: 2580 GGYSNEYFSKCFINLPVK----PKFEFEKYYFQTNQNVRSA-SIGMIKIMGNSSSVFANITGRFHQHFYYIIQEQIVVLKDSFVDKNVNGR-LIELRIELFDGLSGDLSVSNTEIIIEFH----PIFDSPI----------FFEPFYTFVVKENSLSHTPLRKISLIQSQ-----NIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFI----FFITAEDHGIPRLNSSVKVYVKI 3536
            GG S+E  +   I +  K    P+F   KY  +T +++    +IG +  M   S V  +I      H + I ++   +    ++D +V+   L+ ++  L  G S    V    I IE H    P F S +            EPFY     +         + S+I S       ID +   +   SL                  DYE  + Y   V A +     +S+ + + I V D NDN+P F    Y   +  ++ P T +GKV A D DS  NG + Y I       ++  ID + G ++T + +D   +E I      I AED G+P  +S+    + +
Sbjct:  717 GGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM---SKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVV---IFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLL-----------------DYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN---GSEYFGIDEKLGNVYTKRSID---REVISHVDISIVAEDKGVPPRSSTASARISV 1035          

HSP 17 Score: 60.077 bits (144), Expect = 5.627e-8
Identity = 115/476 (24.16%), Postives = 206/476 (43.28%), Query Frame = 3
Query: 8385 KFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE-IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTI----KAVALNWISDNETVDVIITASDRGQPPLF----HSITVHFLFITAECELRILKSTFQYPIAVLYTSQEG-SRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQ----LKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKIL 9767
            +F  QG     FSIN   GS+ +   +DRE   ++ + + ++DG +  +   + +TV D NDN+PQ+     ++  +  +S    G++ +    A+D D  Q+     ++S              LL + SGSL +      + L  +S  ++  + +   D G P L+      I+       A+  L  LK T+      L T  EG  R   IA     L G +T+ I+ GN  S FS+ S+ G I T+  ++  IL ++   +I    G +I + V          + +++ N   P   +S+    + E ++VGS +  V   D D  LA +    +  S+         PT+ N  Q    + +  PLD+E+  +++LT+ A D  F   +  +I    V D +DN+P F    +  ++         P  + E   + +R   +Y+L   +SS  ++        +K+L
Sbjct: 1663 RFRFQGNAPK-FSINSTTGSISVL-PLDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRV--GDV-LHRFRASDMDIGQNG----KFSFE------------LLEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTY------LSTIDEGLPRGQFIAKLQPELAG-LTYSIVEGNIDSAFSVDSE-GVIRTNLELDREILERYSLKVIGTGSGQQIGTRVD---------VRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVD-NLAPLRYFLVSDSSGQT------PTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIF---VSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVL 2089          

HSP 18 Score: 58.5362 bits (140), Expect = 1.978e-7
Identity = 77/347 (22.19%), Postives = 152/347 (43.80%), Query Frame = 3
Query: 5538 VTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVL-INLINVNDETPLIHNPTTVYL-----PKINQNHNIMIKCSDQDN--LGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDTIHNTIK---NVSLIVLDRNRSSKNYTAFIKLERFEKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFY 6545
            +T K+     N  I++ ++      L S++ + G I     ID    +     + A D        P L T    V+  ++D     P F+     V IPED PI + +++++A+++   +         N D  +TV+ ++G +      D+EK + +  TV  T+     +  ++ I L +VND  P+ + P   +L     PK  +   +++  SD D+   G +SY I++ S    +  ++ +TG+V F    L     ++ +S  D    + +   N+ + V+D++          K  +F +S  +I++  D  I+P         + S+  +S+  Y+ Y
Sbjct:  460 LTAKDPDLGQNGWIRYSVLD---TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGS-----PALST-DLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFY-PNEYHLTVREGPKPEEPL-LVVSASDMDSGTFGEVSYHILSESS---SFSINPVTGEV-FAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKD---------TKTPQFSRSKYEIRTTED--ILPG------IAIGSVGAMSKVKYSIY 774          
BLAST of Protocadherin Fat 4 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 138.658 bits (348), Expect = 1.069e-31
Identity = 125/429 (29.14%), Postives = 209/429 (48.72%), Query Frame = 3
Query: 3192 STKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI---DHQQMVTYRISKCTQK--GAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE---VLYYL--QSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDR 4445
            S+ V + I V D ND++P         ++  +      +G+V+A+D DSG NG + YS+E      DF+ ID  SG + T KL+D      +   +TA D G P LN+S  + V +     +   FDK+ +   ISE+M    +I  L+    D  Q +TYRI +  ++      I     I+ +   L R+     V  I ATD    +G     V N++++  DVN ++P F ND   +  + E + +G  +    A D D G N ++ Y +     +S   F+ID  SG + ++  +D E +  ++ I+TA D   P L+++  + V + +IND  P+F   S     + +++ +GT+  +V A D D      V Y+L   S  P    F ++  SG L VS+ + +E  F ++V+ + A  +DR
Sbjct:  101 SSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG---SEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRV-EISATDQGGLQGR---CVVNVFID--DVN-SAPYF-NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-----DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS-YAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE-QFAVIVLPIFA--RDR 508          

HSP 2 Score: 115.546 bits (288), Expect = 1.066e-24
Identity = 108/389 (27.76%), Postives = 184/389 (47.30%), Query Frame = 3
Query: 3144 QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVEL-DFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYV-KINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI-DHQQMVTYRISKCTQKGA-FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLT-ATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE 4295
            +YS  V A +      +T   + + ++D NDN+P F  + Y  +I+      + I  + A+D D   +  + Y IE+   E+   ++I  Q   L  +  +   + +    I+A D G  +    V V++  +N +P    +F+   F   I E   I   +  L+  DH +    RI         F I+  +G I + + LDRE  A   + + A+D++S   +     T + V + D+NDNSP F + +    I SE   VGT     +A D D G NG V Y L  ++   SI +F++D  SG L ++  +D E        I A D G P+L +   +T+T++++ND  P F + S  +  + +N  +G+TVG + A+D D  +
Sbjct:  187 RYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAP----YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLN---TSTQIEVILDDINDNSPQFTSSSYAATI-SEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLS-YDLYIAENSPVGSTVGTIVARDADEGD 564          

HSP 3 Score: 112.079 bits (279), Expect = 1.146e-23
Identity = 97/388 (25.00%), Postives = 183/388 (47.16%), Query Frame = 3
Query: 3198 KVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGA---FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYL-AVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFS---GALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQ----NVAIGTTVGRVYAQDPDTNEVLYYL 4310
            +  V +F+ D N ++P F+   +   I  H+     +  + A D D G N  + YSI+       F  ID  SG +  +  +D  ++  F   +TA DH  P LN+S ++ V ++    +   F   ++   ISED+ +     ++     +I    +V Y +++ +   +   F +++ +G + + ++LDRE  A  VL I A D    +G+  L A + + + + DVNDN+P F+  + + +I +E++ VG+ +G   A D D+G N  + +R+   G     +F I+  +   G + +    +++ + K N            L S + V + ++++ND KP        +F++      NV +   +G + A DPD N  L Y 
Sbjct:  307 RCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS----QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARD----RGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYI-AENSPVGSTVGTIVARDADEGDNADISFRIF--GGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALK-----DFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYF 677          

HSP 4 Score: 107.842 bits (268), Expect = 1.828e-22
Identity = 146/611 (23.90%), Postives = 275/611 (45.01%), Query Frame = 3
Query: 3654 VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFV----INPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSV-KVHIKHDNEDEIQVLTYG-----AIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPG-NPISDLEYYIFDIYCGISERIKLPN-TMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD----LDSTLEYIWINEIPEFSLDKTS---GIVTT-SGVPLDHEAVA-YFIGKIQVSDGTFTST 5423
            V Y ++  +  G  +I+  TG + L  R+D +      + I A D +    S  + +T   +N+ID+ND++P     A     L E+  +G  +G   A D D G NG ++Y      ME    F ID  SG +   + +D E   +++  +TA D+G P+L+++ ++ V + +IND  P F+K+      + + +  G+ +  + A D D ++ + Y   +   D        I     ILSVS  + ++     V + + A  Q     + V  V I     D++    Y      ++ +P+ S     + TLKA+ + +  N+R +Y + +S + +  I+  +GD+ ++S    E +    + +++     S  L      +++L+  + ++  F  + Y   I E     G    ++ A+     P   ++Y+       ++E    P+  + RLD+ +G + V +  LDRE  + + I + +   DRG   S    +++ L + D NDN P F   ++  +  EN+  G    VGT+ A D D     D +       +   F +++ +   G+V   +    D+EA A  F  ++Q S G  +ST
Sbjct:   51 VHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLT---INVIDINDHAPTLIA-AQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY-----SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK-EYNVTISEEMPRGSQIITLKAVDNDEDQKITY--RIEEADREVFSILDIGDQGAILSVSGELKRQDH--KVRVEISATDQGGLQGRCVVNVFI-----DDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR--IDPSSGDISVSSDLDRE-DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISE-DIPVGTSFLQVSAIDADIGPNGIVDYF-------LNESSSSPSIQLFRLDRTSGTLRVSS-KLDRE--QFAVIVLPIFARDRG-TPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGST--VGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSST 624          

HSP 5 Score: 105.916 bits (263), Expect = 7.422e-22
Identity = 143/523 (27.34%), Postives = 232/523 (44.36%), Query Frame = 3
Query: 8061 NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVII--ADGSGGIIESC-PGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP---LKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLEIGMLITVT--DSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQE--GSRVANI-AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQAC--GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            N KV +++        L  +  T E+ T  + +D +   N  I+ +I   DG+   + S  P  I VID+ND++P       M  + EN  IG  +  +  ID DS   P   +K+S++G E+  F I+  +G +   + +DRE  ++Y +KV   D G   L     I V   D NDN P   K+  N T    + E   G+  ++ + A D D+ Q    +I Y +   ++ +     F + +      I +V+      +  V V I+A+D+G         V  +FI    ++        +P +V        G  V  + A +HD   G+    + S + S +F I   +G IS S +++       FS+IV A    +  L++ +       I +++ D N  SPQ   S    +ISE I VG++ LQV  ID D G  GIV    +  +    S+  F  +  S  L+V + LD E      L + A D G P  S  S + + + D +DN+P F
Sbjct:   48 NGKVHYSMASSSGIGGLTIDYSTGEV-TLRERIDAK---NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSG--PNGIIKYSMEGSED--FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTI---SEEMPRGSQ-IITLKAVDNDEDQ----KITYRIEEADREV-----FSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG---LQGRCVVNVFID---DVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDR--GDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTST------QIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF 533          

HSP 6 Score: 100.908 bits (250), Expect = 2.414e-20
Identity = 122/540 (22.59%), Postives = 228/540 (42.22%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLI---KFG----FSYEFFHKEGLFNL--NKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVE--AFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDR---FAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            F S  YN  + EN  I  ++  V      FG      Y      G+  L  +  TG +     ID ++  S +  +   K   +     T+ + + +ID ND+ P     +    + EN+A+  ++    A D D+   G+   Y +E G+ED  F +           L++  + LDRET  +Y L ++  D G P L     + ++++D NDN+P F   +Y V ++E    G +++ + A D D   +Q++ Y+ ++    + +   I  +   + +    S  + + D  + VE  A D G   L   C V V +  +NS  P F  ++  S     +  IG     P+  +  +D D+     I  SI   +    F ++ + G++ +   +      +  ++++ V A D+ +P   T+  + + ++  N   P F +   + T+  +  + +      A D D G NG + Y + +         F +++ SG + +   L   +   I L I ARD G  SL     + L +
Sbjct:   16 FASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKN--SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIK-YSME-GSED--FIID------EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSV----SGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYFN-DHPFSVKIPEHSPIG----YPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLD---REDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 523          

HSP 7 Score: 95.9005 bits (237), Expect = 8.327e-19
Identity = 114/417 (27.34%), Postives = 188/417 (45.08%), Query Frame = 3
Query: 3204 FVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVK-INPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGA--FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYL-AVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKP---KWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVD 4427
             V I V D NDN+P+F++ SY  +I  +      I  V A D D G NG V+YS+      +  + ID  +G +   + +D         I A+D   P L+S+V + +  I+ +  +      Q     + E++ I E++ ++    +      I K + +G+  F I++ +G+I     LDRE  A + L + A D     G+  L   T + V + D+NDN+P F     N  I  E  +   I+   T   +D+  + ++ YR+     E  S+  I    GA+     V  ELK    K    I+A D G   L     V V I ++N   P FN +      + ++  IG  V  + A+D D  +    + S+      F I+P SG +SVS+ + +E   +F ++V A D
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-SSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMI-TLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARD----MGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQII---TLKAVDNDEDQKITYRIEEADREVFSILDIGD-QGAIL---SVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFN-DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF-FRIDPSSGDISVSSDLDREDRATFSVIVTASD 399          

HSP 8 Score: 95.9005 bits (237), Expect = 9.603e-19
Identity = 110/414 (26.57%), Postives = 181/414 (43.72%), Query Frame = 3
Query:  399 IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN--NYKIESGNEDDRFALSGVGVQYR-GQLLLRVVRPLDRETKEKYKLT--ISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY-IEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLI-RINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITL 1619
            +++ ++D NDN P+F  +     I+ENI +   I+   ATD D   FG +   +Y + S +      + G+ + Y  G++ LR     +R   +   +T  I  +D  QP L   + + I V D ND++P    ++  + L E+   G EV +VYA D DSG N  ++Y  + +      +F ID  SG I+ T+           +L V A D G+PSL+    + V +  IN   P F        DK  Y + I +   +   I+  +  D D    I   I    D  +F++        IL     +   +     + + A D G    +  V++ I  +N A    P F +   SV +  ++ I   +    A D D G N +I+YSI    +   F I+  SG I++
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED---FGTNGKVHYSMASSS-----GIGGLTIDYSTGEVTLR-----ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE-----DFIIDEDSGLIKTTKLLD-RETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF--------DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEA-DREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVFIDDVNSA----PYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF---FRIDPSSGDISV 379          

HSP 9 Score: 91.2781 bits (225), Expect = 1.936e-17
Identity = 94/347 (27.09%), Postives = 159/347 (45.82%), Query Frame = 3
Query:  651 LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE-FSIDRKSGSIRLTQPTSCHINQGDCTLVVE---AFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALE---RTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFR------NRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLD 1649
            LDRE +  + + ++  D   PPL    ++E+I++D NDNSP F+ S Y   ++E    G   ++V A DAD G N  V+Y   ++ S    + F +DR SG++R+    S  +++    ++V    A D G+PSLSA   +T+ +  +N   P F +++Y        YI         +  +  +D D+     I+  I GG D  +F +E     +G V IL + +  +      +   ++A  +G  S  +TV + I ++  N   P  +      NR+ +V + R      FI  F     D   N  + Y + + D       EK +G I L+K  W   +D
Sbjct:  383 LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRV----SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSY------DLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA-SSGQLS--STVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQI---GFIPAF-----DPDQNATLEYFLEENDL---IEAEKYTGKI-LVKQEWKRNMD 704          

HSP 10 Score: 88.5817 bits (218), Expect = 1.378e-16
Identity = 118/452 (26.11%), Postives = 201/452 (44.47%), Query Frame = 3
Query: 5127 VFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGK------------IQVSDGT---FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDL--LMTVNPITGVISTAGILDYEKTERHALTV--SCTD--GLH-RVTVEVLINLINVNDETPLIHNPTTVYLPKINQNHNIMIKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDTIH-----NTIKNVSLIVLDRNRSSKNYTA 6401
            V + + D NDN PVFA++++     EN T      + TV+A D+D  +       N    +S+  +SGI    G+ +D+      + +            I+  DG     +ST  + I + D ND        +    + E   I   +G+V   +  + PN IIK+ +    G   F ++ D G+I T   +D E    Y L +TA D+   SL        +TT+ V + DINDN P FD     V+I E++P  S+II L A D D+   + + I   + ++  ++ +     ++S +G L   K + H + V  S TD  GL  R  V V I+  +VN       +P +V +P+ +     +I    +D+    +  I+ S    Q   +D  +G +S +  L   +    S+  + + H     NT   + +I+ D N +S  +T+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITI--PAVIATVKATDEDFGT-------NGKVHYSMASSSGI---GGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSL------NTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKVRVEISATDQGGLQGRCVVNVFID--DVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS 427          

HSP 11 Score: 88.5817 bits (218), Expect = 1.486e-16
Identity = 88/320 (27.50%), Postives = 140/320 (43.75%), Query Frame = 3
Query:  735 VEIIVEDYNDNSPVFSPSKYTVRLNES-NLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEK--DSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            VEI V D NDN+PVF+   Y V + E+  +P   +  V A+D D G N +V Y    +  +     +ID  +G + L +           T V+ A D   P+LS+   +T++VI IN   P        +  K   +E      + +  V+  D+D  P  +I  S+ G  D   F ++   G   +++  K +       Y++ V A D G PS  T+  + + +   N   P F  +  +VT+       S I    A D D   + KI Y I + D R+ F+I    D G I  +      +  K+++EI A D G
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAV-IATVKATDEDFGTNGKVHYSMASSSGI--GGLTIDYSTGEVTLRERID--AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLI-----AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSG---LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEAD-REVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG 302          

HSP 12 Score: 82.8037 bits (203), Expect = 7.860e-15
Identity = 98/365 (26.85%), Postives = 165/365 (45.21%), Query Frame = 3
Query: 5061 QITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGT---FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKF---DIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPIT---GVIS--TAGILDYE-KTERHALTVSCTDGLHRVTVEVLINLINVNDETPLIHN 6113
            ++ VE+   D+G  G + RC  V + I+D N + P F +  F    PE++  G  +     + HD+  ++ + Y  I+    F +D +SG ++ S   LD E  A F   +  SD       ++  I +++DD ND    FT   Y   I E  P+ T   QV+  ++   PN I+ +   +  S     LF ++   G +    ++D EQ    +L I A D    SL      +  + + +++ D+NDN P F+     + I E+ P+ S +  ++A DAD+ D   + F I    D  L  +       GV+   T    DYE K  +    +  + G    TV V I++ +VND  P + +
Sbjct:  291 KVRVEISATDQG--GLQGRCV-VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYS-IDSSQFFRIDPSSGDISVSS-DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL------SAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKD 643          

HSP 13 Score: 63.929 bits (154), Expect = 4.439e-9
Identity = 77/329 (23.40%), Postives = 145/329 (44.07%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPV--ELDFVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL------EIDHQQMVTYRISKCTQKGAFSIN---QHTGIIHLINR--LDREAIA---FHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDA--LNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQ 4067
            R  +S  V A +      +T   + + + D NDNSP F++ SY  +I+      T+  +V A+D D G NG V+Y + +      +    +D  SG L  +  +D  +   I   I A D G P L+++ ++ + ++    +   F++ ++   I+E+  +   +  +      E D+   +++RI        F I    +  G++ ++ R   D EA A   F  L   +   SST          + +++ DVNDN P  K+    +N F   ++ ++   +GF  A D D   N  + Y L     E   + + + ++G + + Q
Sbjct:  388 RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNAD-ISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSST--------VPVRIHVSDVNDNKPALKDFVILMNRF---DNVQMARQIGFIPAFDPDQ--NATLEYFL-----EENDLIEAEKYTGKILVKQ 697          

HSP 14 Score: 62.7734 bits (151), Expect = 8.119e-9
Identity = 44/162 (27.16%), Postives = 83/162 (51.23%), Query Frame = 3
Query: 9216 ITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLREL----DQLIVLPEV-RDEDSIMASRNE 9686
            +T+ + D N ++P +  ++  +++ E + +G  + +V  ID D+G  GI+K ++  S D       F  + +S  +K    LD E   +YSL + A D+G P  + ++ + + + D +DN+P F  + +  ++ E      Q+I L  V  DED  +  R E
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE 260          

HSP 15 Score: 61.2326 bits (147), Expect = 2.415e-8
Identity = 121/543 (22.28%), Postives = 227/543 (41.80%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEEN-NAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVL---EIGMLITVTDSNDNRPQI--SKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETV---DVIITASDRGQPPLFHSITVHFLFITAECELRILKSTF---QYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGS--SYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE-LDQLIVLPEVRDEDSIMASRNEPSYTL-KSKTSSKVQLFQ-SKTNFTLKILKRSTNESVINLILDVFG 9818
            I V+D+NDN+P+F  + +   + EN  I + I  +   D D      + +S+         +I+   G V L + +D +  S     +   DG        + + I V D ND+ P +  ++++I     +   E   G ++ +       D+    N  I+YS+            F+++EDSG   IK   L    D ET     + +TA D G P L  S T+  +      ++     TF   +Y + +      GS++  +    ++   +IT+ I   +    S   IG +   +S    V+  +  Q   + V+   T        C     + + I D N  +P       +V I E   +G  ++ +   D D G    +  +I +S   R      P++G+   + V + LD E +  +S+ + A D   P  + ++ + + + D +DNSP F S ++ A++ E +       +V   D+ +       Y L +S +S  +QLF+  +T+ TL++  +   E    ++L +F 
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEV-GRVYAI-------DEDSGPNGIIKYSMEGSED-------FIIDEDSG--LIKTTKL---LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLK----DINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILS----VSGELKRQDHKVRVEISATDQGGLQGRC----VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRID----PSSGD---ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFA 505          

HSP 16 Score: 55.0694 bits (131), Expect = 2.006e-6
Identity = 125/534 (23.41%), Postives = 219/534 (41.01%), Query Frame = 3
Query: 8097 SQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSIN--PQNGSVFLAQTVDRELKS---KYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFI-----TAECELRILKSTFQYPIAVLYTSQEGSRV-ANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIV-----QACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPL-----DYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL 9632
            S+D++  + ++  I+T  K +DRE      + V   D G+  +  S    + + D+NDN+P F    +   +SE    GS II +  +D D     + + ++  +   FSI      G++    +V  ELK    K  ++++ +D   +    ++    D  ++ P  +    +  F +   E +     V+ + A D D  + +N++I YS+ S          F ++  SG +++ +       D  T  VI+TASD   PPL  S  +  +       + +       +T    I V  +  + S + A+I  N     G + +F+   + S    +   +    T R V+S +  + F++IV     +  GT  LS+ S       ITL +SD N  +P        + I+E   VGS +  +   D D G    +   I    D +     F    ++ Q  VV  L     DYE +       L    G  + S T  V I V D +DN P    ++FV  +   D +
Sbjct:  162 SEDFII-DEDSGLIKTT-KLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ-KITYRIEEADREVFSILDIGDQGAIL---SVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFN----DHPFSVKIPEHSPIGYPVITLKAEDHD--RGDNARIVYSIDSSQ-------FFRIDPSSGDISVSSDLDR--EDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPN-----GIVDYFLNESSSSPSIQLFRLDRTSGTLR-VSSKLDREQFAVIVLPIFARDRGTPSLSAAS------EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKL----FDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPAL--KDFVILMNRFDNV 654          
BLAST of Protocadherin Fat 4 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 275.404 bits (703), Expect = 7.702e-73
Identity = 298/1098 (27.14%), Postives = 518/1098 (47.18%), Query Frame = 3
Query: 2934 SPIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLS--IIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFT------NKLVDVVEQE-----------------FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQ----TFFQNISEDMKITEKIFKLEIDH--QQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHP----FVINPISGILSVSNPILQEV--SFDLVVMAVD----AERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSR----FMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPI-------------SDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWIN-EIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD 6038
            +P+F    Y   + E +  +T    ++       DN  +S  IIE +    + +F DG L++ + LD EER  Y+ TV   +     +S+ V VVI V D NDN+P F+  ++ FSI  +   +T +GK+ A+D D G N  +++++       DF  ID+++G + T        LV V                      +   T  D+GIPRL   VKV V +     +   F +     T  +  SE   IT  +F  + D      V Y ++K  + G F+++  TG + L  RLDRE+   H L +VA D  +       +  ++ + ++D NDN+P F   +    +L E++  GT L  + A+D D G+N QV + ++A        F ID+ +G+LYL++P+DYE    +   ITA D G P+L + +   V + + ND  P F   + +  I ++ + + T +  V A DPD+  N  + Y  S   P  P    F IN  +G++     I +E   +F L V+A D    +ERQ    ++ V V ++  N++    ++  A ILP      +  +T   Q ++K+ +S       Y + +   +   + R TG   +T T   +F   ++ + ++L+S       +  S+++ + I  P +   + +     +P+ +    L      ++Y   PI             +++EY++ ++      R ++ + +  +D + G +S     LDRE     +  VEV  I  G    R   TKV + + D ND+ P F +  F+++  E+   G  I   T++AHD D   ++ ++ ++    +F L+ ++G +  +   LD E  + +  +I+VSDG   + A   I + D ND    F    Y F I E A     +GQ+  +++    N  + + +VS+W   +FS+NP  G++T    +DYE+  HYIL++ A D  Q SL      + T TV  +++D+NDN P+FD    +  + E+VPI +E++ + A D D  +  L+ + I + + D    ++   G I T   LD E    + LTV+  D
Sbjct: 1046 TPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQ--TQDFT-IDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITH-VFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKD--AALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVL-ETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRD--TFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQI-KEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQ-LSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTG--IITFTPGPQFKQ-EVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESS-----VPQFEQRSKLS----GSVYENEPIGTSILTVTAHLASAEIEYFVTNV-TATGSRGQV-DRLFDIDAKLGILSTA-AELDREAGP-EEYEVEVYAIALGGQ-PRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTI--STLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDT-LDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSL------STTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDS-NGTIRTRRNLDREHRSTYTLTVTARD 2105          

HSP 2 Score: 263.848 bits (673), Expect = 2.579e-69
Identity = 175/530 (33.02%), Postives = 262/530 (49.43%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLAS--DLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVG-----VQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSC--------HINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGIN 1691
            + + +  +F V E QP  T VG +  K  FSY F      F L+ +TG + T+ ++DRE +    DL+        L  Q    I ++++++D NDN P F    +     E+    T + L AATD+D  E GV++ Y+I +GN D++F L           Y   L L     LDRE++  Y+L IS  D G PP  G L+V + + D NDN P+F  S Y V LNE+ LPG  VV V ASD D G N ++ Y   +T    E++F+++ ++G I  T+  +C          +Q  C   V A DHGSP      YVTV+++  N   P     +     K A ++   V    +A V  +D D       +V I+ GN+   F LE    ++HI+R    +    +  Y +TV A+D G P++ TT  ++I +N  N + PVF     S  +   A   SF+A+  ATD D G+N ++ Y I  G+    F+++  +GLI    PL     D ++L I ARD G N
Sbjct:   63 RAVDTSADFEVLEGQPRGTTVGFIPTKPKFSYRFNEPPREFTLDPVTGEVKTNVVLDREGMRDHYDLV-------VLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSY---LHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAET----EHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEA-ADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPN 577          

HSP 3 Score: 184.111 bits (466), Expect = 2.596e-45
Identity = 262/1079 (24.28%), Postives = 479/1079 (44.39%), Query Frame = 3
Query: 3162 LAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVE-------LDFVEIDSQSGRLFTNKLVDVVEQE----FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL---EIDH--QQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKV-GTILGFYTANDIDDG-LNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDA---ERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSI-----DITFLISLESLRSDTLIKYHSTKLVLNIGDPH---NLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNP-ISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDL--DSTLEYIWINEI-PEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGT---FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADK---SDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTE-------RHALTVSCTD-GLHRVTVEVL--INLINVNDETPLIHNPTTVYLPKINQN-----HNIMIKCSDQDNLG--PLSYDIMT 6215
            LA  K  +  ST V V I ++D ND  P+F + +   +I  +   NT +  V A+D D G NG+++Y +++   E       L F  ++   G+L   ++VD +++E    ++  ITA D G P  ++  ++ ++I     +   FD + +  +++E+  I   + ++   ++D      + Y I    Q   FSI++ TG++ +   L+ E ++ + LT+ A D +    +   A   L +NI+D+NDN P F +      ++  +    G  +    A D D   LN QVRY L     +   +F+I+  SG + L +P+D E + ++   + A D G P L     V V + +IND  P F  +S     V++N+  GT V    A D D     ++ + L   H   H F I+  +G +S +  + +E +  + L +MA D+   E +      ++ V   +DN  +    TY  + +P+     E +   +A       N+   Y +         IN  TG V    +T +E  +      D+T+ I + ++           +L + +  P       +  N +F    + +  PG  + ++ A  P    +  + Y I     G S         +R+D  +G +SVG   LD E+    +I +E      G   S    T + LN+ D NDN PV   E  I++A           +  V+A D+D   +  + Y   N+    F + ++  I T   + LD E +  +   ++  D      T TA++++ + D ND    FT   +  ++ E A I + + +VT  +     N    +      G+  F + P  G IT  G +D EQ + YIL + A+D + ++          T + ++I D NDN P F+ +  + S PE     + + Q+IA+D DK   + ++ + +  P+   + +++P TG + +   + ++ ++        +ALTV  TD G   +  E L  IN+++ ++  P        YL  + Q+       + +  +D+ +LG   + Y +MT
Sbjct: 2139 LAHQKQQRLSST-VKVTILIKDVNDEVPVFISANET-AIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPF-SLNPTDGQL---RVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTA--ELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSD---LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQS-YHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHM--HRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYN-VAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVV----STKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVR--PGKMITKVSATSPKKGLVGKIRYAIAGGIMGDS---------LRVDPNSGLLSVGQDGLDYELTHLYEIWIEAA---DGDTPSLRSVTLITLNVTDANDNAPVM--EQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTR--MRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEK-FRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRA---------ETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSP--MFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQ--AEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMT 3165          

HSP 4 Score: 174.096 bits (440), Expect = 2.639e-42
Identity = 251/1082 (23.20%), Postives = 460/1082 (42.51%), Query Frame = 3
Query: 3144 QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFI-FFITAEDHGI-PRLNSSVKVYVKINPSPKSKQFFDKQTFFQNIS--EDMKITEKIFKL--EIDHQQ----MVTYRISKCTQK---GAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFK--------NDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYL--NQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTI-TNINDEKPRFNKESRLEFIV------QQNVAIGTTVG--RVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVM------AVDAERQDRYDQQSVKVHIKHDNED----EIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIY----LDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDL--DSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVS--DGTFTSTXXXXXXXXXXXXQ-----------------------CHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLINV--NDETPLIHNPTTVYLPKINQN 6149
            +Y+ TV+A+++    ++T   ++I V D ND+ P+F    Y   ++      + +  + A D D+G+N  V+Y I     EL +  +D  +G + T   +D   ++ +   I+A D G  P+   +    + ++ + ++ QF  ++   QN++  ED    + I  L    DH Q     VT+ ++   ++     F+++  TG +     LDRE ++ + ++++A D  +   +   A   +++N+ DVNDN P F          D  ++  L +  +   IL   TA+D DDG N  + YRL + G     +F++D  SGA+ L  + P     KP +  +++A D G      +  V + + + +   +    +    EF +      Q+N      VG  +V + +   N  + Y          F I+  SG ++ + P+ +E   ++ L ++      +  A     Y Q  V + I   N++     +   +   I LP+++   ++I   + +     +NSR  Y L N+   +  I   TG ++L      E  S+    L++ ++       K   + L+ ++ D H   F    Y   +PE  T    + F L A               DI  G + RI         ++  G    G ++    LDRE  E     + V   D G+  SR     V +++ D NDN P F N TF F  PEN       +VG + A D+D+  ++ L +   ++  +F++D  +G + T   P D EA+       + S  DG+   +     ++ +A                             F    YH  I E A   T I  V  +++    N  + + +        F+++   G ++    +D E    + L++ A D    +L  P     + T++V  +D NDN P F  +   VS+ E  P  +E+++  ASDAD+     ++F I + N      ++ ITG +     LDYE    + L ++ +D G   ++  VL N++ V  ND  P+   P+T  + +I + 
Sbjct:  459 KYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILS-GNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQRE---QNVTLGEDAP-PQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAP--TPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE---GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVND-HTPVFDHTSYETSLPET-TKVNTRFFALAAT--------------DIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDRE--ERDYYALTVSCRDAGQP-SRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAP--ADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTL-RPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDA---ALKHPLSSNASITIVV--LDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIF--PSTAIVRQIKEG 1501          

HSP 5 Score: 159.458 bits (402), Expect = 7.443e-38
Identity = 239/1003 (23.83%), Postives = 425/1003 (42.37%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVE-QEFIFFITAEDHGIPRLNSSVKVYVKI-----NPSPKSKQFFDKQTFFQNISEDMKITEKIFK-----LEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDID-DGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPV-----DYELKPKWNFIIT--AFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYA---QDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPIL--QEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNED--EIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDK-IIINRYTGDVFLTSTTPVEFNSIDITFL-ISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIR----LDKETGWIS--VGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDL--DSTLEYIWINEIPE--FSLDKTSGIVTTSGVPLDHEA--------VAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQV-TLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD---KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKT 6005
            Y   + A + +     +   + + V D NDN+P+     Y   +     P   I  V A D DSG NG V Y ++    + D     ++SG ++T   +D  E  ++ F + A D G+P +  +  V + +     NP PK  + F       N++E+ +I   + +     L++      +Y  S+   +  F I   +G I +   LDRE    ++L +VA+D +      + A T + + I D NDN+P F++ +  +F   E  +   ++G   A D D  G N  + Y L     +   +F ID  +G ++  + V      Y   P+  + +T  A D G P L+S   V + I + ++  P+F +   L  + Q  V  G  + RV+A   QD  TNE+ Y L + +     F +    G +++  PI       ++LVV A D     + D+  V + +  +N D     V +Y  +I+P++      I T+ A  +    N    Y +   +  +   ++  TG + +     ++++ I    L I+++ L    L       ++L   + +   F   +Y   IPE K   G  +F+  A    +P + + +Y F           LP+   R    +++  G IS  V   Y +R I      T+++    +  + S      +++++   N+  P F    F F   E +  G +  VG VQA DKD   D  + Y+ +    +  F +D  +G++  +   LD E         +A   G I+ +D    +    +I+     +    F    Y   I E AP+ T +  V  +       N    + I++   K  F ++   G I+T   +D E+ + Y L+I A D       LP  +T + TV + + D+NDN P F    L   I E+ P  + I+ LIASD D         ++++       ++V+  +GV+ +    D E T
Sbjct: 2776 YEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQN---DFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNP-PKFTRLFSL-----NVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGE-KFRIEPQSGNITVAGHLDREQQDEYILKVVASDGA------WRAETPITITIQDQNDNAPEFEH-SFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSL----QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVR-GQRIVRVHANDKQDLGTNEMDYSLMTFNL-SSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSY-QVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQ--LDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPV-GTFVFQAHAADKDSPKNAIIHYAF-----------LPSGPDRHFFIMNQSNGTISSAVSFDYEERRIY-----TLQIKA--KNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTR--VGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVA-RHLDRETQNRVVLTVMAKNYGSIRGND----TDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTG-----LPP-QTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMT 3720          

HSP 6 Score: 156.377 bits (394), Expect = 7.017e-37
Identity = 212/915 (23.17%), Postives = 379/915 (41.42%), Query Frame = 3
Query: 10617 LSVDR-KGIIRIRKSIDKESVDSLT----VQSSIQFKGKSELLTLTVNVNDENDSESKSRITDIFIGIAENAFQL-TRIAQLLPIDPDITGDFQCRL--DTLNVPLGILITPDCWLHIINTSSAIRSINNSYMRILHHDGYHNAVVSSFRMKVNLLNNKNIQTNWIVFKIPNL----FITSXXXXXXXXXXXXXXXNVDVALMAI--------ETVKNYLVIWPRSPNREKALQVVEQFKDKLEVVLKIEIQEITI--RLCNR-KLCNSHGLCSIGIQVNYEQLFTDEDSITANIIYIYPSVNFNIKCLCDDGFLGEKCALLAK-CRQQVCHNGGVCGVNRNG-EAVCECAPGYTGYNCEYDINECEKTNLCTPHGNCNNIRGG--FKCECQLNWIGNGLCTQPFNYCSSNPCSELGTERCIPILGGFKCRCHFGNFGDHCQYSAISFPAESYMEMDFQKIS--KMSLEFSTILKDTPL----XXXXXXXXXXXXXXXXXGSIRLSIFEDSALVSQRDSNKDLSNGNWWKLDXXXXXXXXXXXXXACED-WNQCDHTIDQFRTIRQRFDVSSSMGRNNVDSNSIIRVLIGSIQK----LKLSGVQY---FVGCARNLQFFNGSL---IRNEQKGVLFDSCPRYRNGILPCSNSDLECGNVGKCIDEWFASRCECPPGYQPPSCTPGYSSYALAPNTIISF-----VKRPK--SDSTNSNSPKNFDSYLKRKRSVSPEYT---------MISIRIKT-RDRNSIIFMALSSFHSYTLVQLENGLVKVVDKYAGSYQEMLHKVVTVNDDKIHTITVTRHSTGTVSVTVDFVVAQVNWLQSHDILG-HSVNEVYLAGLPDLKKIENSLSFPNFVGCISDVRFNNKTMPLRGLSENFNVSIIQGSVTSGCSSDICRQSG 13175
            LSVDR  G++R   S D+E    L     V+ S + K KS+ L LT+ V D+ND+ S +R   I + +         ++A + P D DI GD++CRL  +     L + I   C L   + ++ I S+         +DG H  V S   +     NN+ +  N +   + N+    F+ +  + +  +    +S   +V L ++          ++  + +     + ++   ++E+ ++K     ++  +E+ +    C+   +C + G+CS  +++     F  +DS    ++   P V  +  C C  GF GE+C+     C    CH+   C   R G +  C C     G +CE + ++   +  C   G+C     G  + C C+  + GN  C    + C  NPC   G   C+ +  G+KC C  G +G HC+  +  F   SYM      ++   +S+ F+T   ++ L           S  + + L  G    S       +S   + ++L++G W K+        + +SV  C D  + C   +    +     D    +G  N +   +   +IG +      L+  G  +    VGC  ++     +L   +  +QKG+L   C   R    P   ++   G  G+CID W +S C+C    Q P C+       L     + F      +R +   +  NS S    +  ++ +R+VS   T         M+S+  +T +D+  I++ A +    +T + L  G +    K   +    + +  T+ND K H +++   S      ++  +V         DI G H   + YL  L        ++    FVGC+++V  NN+  PL G    F      G + SGC  DI + + 
Sbjct: 3700 LSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHL-LTITVLDQNDNPSTTRSLHIAVSLFNGDLPSNVKLADVRPNDIDIVGDYRCRLQKNPAQSQLQLAIPRACDLITTSHTTPIASV----FSYTGNDGKHGDVSSKVSVAFQSFNNETL-ANSVSIMVRNMTAYHFLANHYRPILEMIKSRMSNEDEVILYSLLEGGSGNSTNLQLLMAVRLAKTSYQQPKYLIERLREKRSAFSELLQKEVIVGYEPCSEPDVCENGGVCSATMRLLDAHSFVIQDSPA--LVLSGPRVVHDYSCQCTSGFSGEQCSRRQDPCLPNPCHSQVQC--RRLGSDFQCMCPANRDGKHCEKERSDVCYSKPCRNGGSCQRSPDGSSYFCLCRPGFRGN-QCESVSDSCRPNPCLHGGL--CVSLKPGYKCNCTPGRYGRHCERFSYGFQPLSYMTFPALDVTTNDISIVFATTKPNSLLLYNYGMQSGGRSDFLAIELVHGRAYFSSGGARTAISTVIAGRNLADGGWHKVTATRNGRVMSLSVAKCADSGDVCTECLPGDSSCYA--DEVGPVGTLNFNKQPL---MIGGLSSADPILERPGQVHSDDLVGCLHSVHIGGRALNLSLPLQQKGILA-GC--NRQACQPALAAERCGGFAGQCIDRWSSSLCQCGGHLQSPDCSDSLEPITLGEGAFVEFRISEIYRRMQLLDNLYNSKSAWLDNQQMRERRAVSNFSTASQIYEAPKMLSMLFRTYKDQGQILYAATNQM--FTSLSLREGRLVYYSKQHLTINMTVQETSTLNDGKWHNVSLFSESR-----SLRLIVDGRQVGDELDIAGVHDFLDPYLTIL--------NVGGEAFVGCLANVTVNNELQPLNGSGSIFPEVRYHGKIESGCRGDIGQDAA 4578          

HSP 7 Score: 155.221 bits (391), Expect = 1.406e-36
Identity = 142/495 (28.69%), Postives = 223/495 (45.05%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVN--HDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILS---------SVSFCSKRE---------------------TITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSL---VPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            + V+D ND+ P F    F+  VSE+  IG  I  +   D D+ L  + F L    +  F + P  G + L  T+DRE KSKYE+++ VSDG+   E    I V+D+NDN P     +    +  +  E A     V  I A DAD  Q  N+Q+ Y + S+        +F LN  +G LT+ A  L++      + +I+ A D GQP L  +ITV+   +       I      Y   V       + V  ++         G I + I +G+  S F I S NG I T RN++      +  ++  + C  +  S          + + S R+                      +T++I D N   P + IS    +I E + + + ++ V  +D D G  G +   +  + D+       +PF  N    QL+VV+ LD E++  Y L + A D G P +S  S +LI++LDE+DNSP F  + + AS+ E
Sbjct: 1811 VTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT-LGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTV----YSFDIPENAQRGYQVGQIVARDADLGQ--NAQLSYGVVSDW----ANDVFSLNPQTGMLTLTA-RLDYEEVQHYI-LIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDP-MSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDS-NGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVP-VFISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAE 2289          

HSP 8 Score: 154.066 bits (388), Expect = 3.330e-36
Identity = 243/1045 (23.25%), Postives = 440/1045 (42.11%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFIT--AEDHGI--PRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIF---KLEIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQ-PVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPR-----FNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE---VLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS-FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHN--LNFQKNDYFFQIPECKTTPGL--KLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWI---------------SVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDK------DLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQ---CHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEIL-SPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCT--DGLHRVTVEVLINLINVNDETPLIHNP 6116
            + +Y+ T++A++      +    V + VQD NDN P+F  QSY  ++  +    T +    A D D G+N  + +++  L   +    IDS++G + T   +D  E+  ++ +T  A+D  I  PR  SSV + + ++    +   FD  T+   + E +   E +F    L++D  +  +V Y IS   Q   F IN  TG++     L  +  +   LT     ++  +G + L+       I+   +  P F   A ++F +SE  + G ++   +A     GL G++RY + A G+   S  ++D  SG L + Q  +DYEL   +   I A D   P+L S   +T+ +T+ ND  P      +N E   E    Q +A+      V A D D+ +   V+Y LQ+    D  F I     I +      +E+  +  VV AVD          SV +H+   N++  +     ++ + +++     +  + +       N+   Y    +  +K  I   +G++ +      E     I     L+ + SD   +   T + + I D ++    F+ + Y F  PE + +  L  ++        G P S + Y            ++ P+ M  +D  TG +               S  N+Y            + V+  D GK      C  V +NI D ++N P F    ++   P++   GQ+I    V A+DK      ++D +L    ++ I  FS+ +  G +T    P+       +   ++ +D      ++   ++     +      F+ + Y   + E  P+ + I  V   +  T PN ++++ I     +  FSV+   G I  Q ++DY+    Y L IT  D+     + P       T++  + D+NDN PVF+       IPE+ P+ + + Q  A+D D  K+ ++ +  L S  D     +N   G IS+A   DYE+   + L +     D        + ++++ VN+  P    P
Sbjct: 2454 QSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL--LGEHMHRFHIDSETGEISTATTLD-REETSVYHLTLMAQDSSITEPRA-SSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQH-YFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAI-AGGIMGDS-LRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAV------VKASDRDSGDNGNVIYRLQNDF--DGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYI-----LKVVASDGAWRAE-TPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQG-PNSVISY-----------SLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMY-----------ALTVLATDNGKPPLYSECL-VNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIV--RVHANDKQDLGTNEMDYSLMTFNLSSI--FSVGRHDGWITLVK-PIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLG----YHPLSSVAMLTII--LTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQP 3442          

HSP 9 Score: 153.68 bits (387), Expect = 3.807e-36
Identity = 257/1086 (23.66%), Postives = 450/1086 (41.44%), Query Frame = 3
Query: 3198 KVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKP------NTTIGKVFAM----DPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPK-------------------WNFII---TAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQS---VKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLK-NSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPEC----KTTPGLKL-FRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTM-IRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLN--IEDCNDNRPVFANETFIFHAPE-NTTYGQKIYVGTVQAHDKDLDSTLEYIWINEI---PE--FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFT---------HDRYHFHIHETAPIHTVIGQVTLKNSTTNPN-FIIKFDIVSEWGK--HLFSVNPDHGIITTQGEIDYEQD-NHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQNH-------NIMIKCSDQDNLGPLSYDIMT 6215
            +  V I + D NDN+P+       F+++R ++P      N  +G+   +    D D+G+N  ++YS+   P +     I   +G L+  + +       I   + A D G P L+S + + V I         FD  ++  ++ E  K+  + F L     ++     ++Y I +   +  F +    G + +   LDRE   ++ LT+   D      S   +V  + +++ID NDN+P F N     F + E+    T +G  TA D D G N ++ + L++   +    F IDT +G +   +P D E   K                    N+++   T  D G P L   + V V +T++ND  P F + +     + +  + GT +  V+ QD D   N  +YY  +       F ++  +G LS+   + +E      L+V+A DA  +      +   + V  ++DN  E    +    +L  S    E +   +A    + +NS+ ++ +   +  D   I+  TG ++L    P+++   DIT   +L    SD      ST ++ N+     L    ND     P      +   G+ L   +  +   +P S L   +   Y    +  +LP      ++ ETG I      +DRE I+  ++T  VV  DR +   R   T+  +   +ED NDN PVF +       P+ +T+ G    V  +Q H KD DS+   +   EI   P+  F L + +GI+T +  P   + V Y +  ++ +D    S      +           +           +    ++E  PI T I  VT   ++     F+         G+   LF ++   GI++T  E+D E     Y + + A  +  Q        T  T V V+++D ND+ P F  T    ++ ED+ I   I  L A D D    + F ++  +D   + + P TG +     LD E   ++ L +  +DG+        I + + ND  PL  +  TVY   I +N         I+ + +D      LSY +++
Sbjct:  925 QCIVNIAIIDLNDNAPV-------FALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ--FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPD-GYLFVRAPLDREERDYYALTVSCRDAGQPSRS---SVVPVVIHVIDENDNAPQFTNSTF-TFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQD----FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLR-APYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTE-LMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHK--PLDYE--DITSY-TLNITASDCGTPSLSTTVLYNV-----LVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVS--YAISKQEPQLPQGRHFGINTETGVIHTLR-EIDRESIDTFRLT--VVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAV--MQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQL-TLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQP------RTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFL-LEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFED--TVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVS 1963          

HSP 10 Score: 151.369 bits (381), Expect = 1.915e-35
Identity = 260/1106 (23.51%), Postives = 477/1106 (43.13%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYF----FSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFI----FFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVT-NLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFI---VQQNVAIGTTVGRVYAQDPDT---NEVLYYLQSVHPPDHPFVINPISGILSVSNPIL---------QEVSFDLVVMAVDAERQDRYDQQSVKVHI--KHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKII-INRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVL-----NIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNG-SRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDST----LEYIWINEIPE---FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVS--DGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD---KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVT--VEVLINLINVNDETPLIHNPTTVYLPK-----INQNH----NIM-IKCSDQD---NLGPLSYDIMTSSKDIQNIYVDRITGKV 6266
            Y+  + A+++ ++  S+K  + + ++       +F T +Y     F+++   +P   I KV A  P  G+ G + Y+I    +  D + +D  SG L   +  D ++ E       +I A D   P L S   + + +  +  +    ++  +   + E+    + I  ++   +       V YR+      G F I + +G I+   RLDRE I  +   + A D    +G  ++  T ++ ++++D NDN P F    L +  ++E+ ++G+ +   T++D+D G N    Y  +    E    F+I+  SG + +   +D E + ++   + A D    A  +   +T+TI + ND  P F + S   F    +QQ++A+   VG++ A D D    N V+ Y  S+  P   F I+P +G +     +           E  + L V+A D  +   Y +  V ++I   H+N  + +   Y A  LP+ +   ++I  + A        +   Y L   +   I  + R+ G + L     V  N+    + + + +       +   T++V+     N+  P    F  N Y   +PE +      L          P   L Y I     G +ER         +D+ TG I +    LD ++I+  +  + + V D G +  S +    + L   D NDN PVF ++ +  + PEN   G  ++    QAH  D DS     + Y ++   P+   F +++++G + +S V  D+E    +  +I+    D +  S AN+ + +   N+    F    +HF + ET+ + T +G V   +  +  +  + + +V       F ++ + G+I     +D E  N  +L + A +       +   +T    V++SI D ND  P F       +I E  P+ +++  + A D D   +++   + I++ N      ++  TG ISTA  LD E+T  + L +   D GL   T    V I L +VND  P        + P+     I++N     +IM +  SD D   N GP +Y ++   K    + VDR +G V
Sbjct: 2670 YTIVISAMDQGEQSLSSKAELTVILRP----PELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAG-GIMGDSLRVDPNSGLLSVGQ--DGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQN-DFDGTFEITE-SGEIYTRMRLDREEIGDYAFVVEAVD----QGVPHMTGTASVLLHLLDKNDNPPKFTR--LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEK---FRIEPQSGNITVAGHLDREQQDEYILKVVASD---GAWRAETPITITIQDQNDNAPEF-EHSFYSFSFPELQQSIAL---VGQIIATDRDKQGPNSVISY--SLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAP-LPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNT---RYELVVRATDRGVPPQSDETRVVIVVTGENMDTPR---FSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSI----SGGNERQDF-----SVDERTGGIVIQQ-QLDYDLIQ--EYHLNITVQDLGYHPLSSVAMLTIILT--DVNDNPPVFNHKEYHCYIPENKPVGTFVF----QAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTI-SSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGS----IRGNDTDEAQVIISIQDGNDP-PEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGP-------TFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLI-GGKHKSWLSVDRNSGVV 3709          

HSP 11 Score: 142.895 bits (359), Expect = 7.428e-33
Identity = 252/1116 (22.58%), Postives = 473/1116 (42.38%), Query Frame = 3
Query: 3141 KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLF----TNKLV--DVVEQE----FIFFITAEDHGIPRLNSSVKVYVK-INPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVT-NLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFD-----------------LGYPA-------------------LHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE---VLYYLQSVHPPDH------PFVINPISGILSVSNPILQEV--SFDLVVMAVDAER--QDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMY--LLKNSSYDKIIINRYTGDVFLTSTTPVE-FNSIDITFL---ISLESLRSDTLIKYHSTKLVLNIGD--PHNLNFQKNDYFFQIPECKTTP-GLKLFRLQALYPGNPI--SDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGK---NGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINE-IPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN----FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNH----YILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTA-GILDYEKTERHALTVSCTDG----LHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQNHN-----IMIKCSDQDN 6185
            ++Y   V A+    + ++++  V + V D ND+ P F    + ++++   +   TI  + A DPD+   G V            F+ +D   G+      T KL+  D +++E    +   I   D G+    +   + V   N +P     F+   +  +I E+ +   ++ ++     ++     ++Y +        FS+N  TG++ L  RLD E +  ++L + A DN    G   L+ T  +Y N++D+NDN+PIF   + ++ +  E+  + T +   +A DID G NG + Y +TA  ++  S F ID+ +G +   + +D E +  +   +TA D                 L Y +                   L S + VT+ I ++NDE P F   S  E  + +NVAI T V  V A D D      + Y ++     D       PF +NP  G L V + + +E+  S+ L + A D     Q    Q  +++  ++DN        Y A +   +S     +  + A    +  N R  Y  +L + ++D   I+  TG V +      E  +   +T      +LE+   DT       +L +NI D   +   F  + Y  ++ E    P G  +  + A     P   S + Y++ +   G S+       + R++  +G I++    LDRE  + S+ T+ +V +D G     G+ I    V + ++D NDN PVF  +++     EN   G  +        D+ L++ L +  + E +  F +D  +G ++T+   LD E  + +   +   D + T      + +  +    ++    F    Y+  + E       +      +     N ++ + I S   +H F +N   G+++T+ E+  +  +H    Y ++I+A D  +QSL          TV++   ++         +  A+S  EDV     I ++ A+   K     + + I        + V+P +G++S     LDYE T  + + +   DG    L  VT+ + +N+ + ND  P++     +Y  ++ +  +      ++K SD+D+
Sbjct: 1787 EEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVT-----------FLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSD-GVQYTEAYATIQVSDTNDNPP---LFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDN----GQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVF-ENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVD--SEFGIDS-NGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVF--ISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASI-GAMVLQVSATDVDEGANGRIRYSIVLGDQNHD-FSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDT------AELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKE---GDSD-------LFRINASSGDIALLKP-LDRE--QQSEYTLTLVAMDTGSPPLTGTGI----VRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTA-TTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI-SGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLS----SKAELTVILRPPELFPTFAYMANSHFAMS--EDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTL-ITLNVTDANDNAPVMEQ--LIYNAEVLEEESPPQLIAVVKASDRDS 2839          

HSP 12 Score: 140.584 bits (353), Expect = 3.832e-32
Identity = 155/604 (25.66%), Postives = 273/604 (45.20%), Query Frame = 3
Query: 8124 ETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSL-TIKAVAL---NWISDNETV-DVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYG--EITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRN---FVASLRELDQLIVLPEVRDEDS---------IMASRNEPSYTLKSKT----SSKVQL-FQSKTNFTLKILKR---STNESVINLILDVFGASQENYPKRL 9848
            E+ EI T  + +DRE   +    V   D G   +  +   ++ ++D NDN P FT  + +  V+ENA IGS++I +   D D        +S        F I PQ+G++ +A  +DRE + +Y +KV  SDG    E  + IT+ D NDN P+      + +F     E       V  I ATD  D Q  NS I YSL    Q  P   +F ++  +G + + KAV      ++   E +  + + A+D G+PPL+    V+   + A       +   +Y   +   +  G R+  +  N     G  E+ + +++ N SS FS+G  +G I+  + +        + L+V+A        V   S    + +V++  N+ +P+  ++   V + E   VGS +L V   D D G  G+++ +I    + +   V   T G    + +   LDY++  +Y L +   DLG+   S  +++ I + D +DN P F  +    ++   + +   +      D+DS          + S  +  + + +++    SS V   ++ +  +TL+I  +   S+ ES  NL + V G + E YP+ L
Sbjct: 2861 ESGEIYTRMR-LDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLN-VTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSF----PELQQSIALVGQIIATDR-DKQGPNSVISYSL---QQPSP---MFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQA-EYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQ-VPPNTRYELVVRATD----RGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGG----IVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVN-EFYPQFL 3440          

HSP 13 Score: 134.806 bits (338), Expect = 2.095e-30
Identity = 132/460 (28.70%), Postives = 206/460 (44.78%), Query Frame = 3
Query:  411 IIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQP-------------------TSCHINQGDCTLVVEAF--DHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVH--CQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQI----KAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETT 1706
            I D ND+ P+F     E  + E   + T     AATD D  + G   +Y+I  GN +  F     GV   G L +R   PLDRE ++ Y LT+S  D GQP    V+ V I V D NDN+P F+ S +T  + E+      V K+ A D D G N E+ +    T S    +F+ID ++G I+  +P                    S   +     +++EA   D+G P L     V V V  +N   P+F R  Y        ++ I +   +   I H   QD D+     +  S+  GN+   F L+   G + + R++    + IH++ + +    ++   + N S      + I +   N   P F      V+V   +   + +  F A+D D G+N ++++SI+ G+ RD F I+  +G + L KPL +  +    L I A D G  SL TT
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNG-RISYEIIEGNTERMF-----GVFPDGYLFVRA--PLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSF----TLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPY--------HVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNAS------ITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTT 1472          

HSP 14 Score: 132.494 bits (332), Expect = 1.011e-29
Identity = 248/1046 (23.71%), Postives = 433/1046 (41.40%), Query Frame = 3
Query: 3144 QYSFTVLAVNKN-DKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKP--NTTIGKVFAMDPDSG-INGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKI-TEKIFKLEIDHQQMVTYRIS---KCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPK--------WNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEV--LYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSV-----KVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDIT-FLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTP-GLKLFRLQALYPGNPISDLEYYI-FDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKI-YVGTVQAHDKDL---DSTLEYIWINEIPEFSLDKTSG-IVTTSGVPLDHEAVA------YFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFI----IKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLI--NVNDETPLI-HNPTTVYLPK 6137
            +YS TV A +   +        + I + D NDN P F    Y   +  +T P     +  V A D D+  +N  V Y +++   + D   I++ SG +   K +D  +Q E+   + A D G P L  +  V V++     +   F+ Q++   + E++   T  +     D  + +  ++           F I+  TG I     LDRE  + + LT++A D+S T+     +  NL +++ DVNDN P F +   N  +    +K   + G   A D+DDG N  V Y ++         F I+T +G +        ELK K        +  +I+A D G  +L S   +TV I    +  P F   +   F + ++V  G  + +V A  P    V  + Y  +         ++P SG+LSV    L      L  + ++A   D    +SV      V   +DN   ++ L Y A +L + S   + IA +KA       N   +Y L+N  +D       +G+++    T +  +  +I  +   +E++         +  ++L++ D  N N  K    F +   +    G  + R+ +       SDL+     +     SE    P    R++ ++G I+V   +LDRE  +  +  ++VV  D    G+    T + + I+D NDN P F +  + F  PE     Q I  VG + A D+D    +S + Y      P FS+D  +G + +   V   H          Y +  +   +G          L++      HN              P   V GQ  ++    +   +    + + +++     +FSV    G IT    I    +  Y L++ ATD       +P  ++  T V++ +   N + P F      V +PE+ P+ S I+ + A+D D     +L + I   N+    +V+  TG I     LDY+  + + L ++  D G H ++   ++ +I  +VND  P+  H     Y+P+
Sbjct: 2348 RYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKE--GDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITE--PRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGAR-ALDLDDGENAVVHYTISGRDQH---YFDINTKTGVVS----TKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEES-PPQLIAVVKASDRDSGDNGNVIYRLQND-FDGTFEITESGEIY----TRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLD-KNDNPPKFTRLFSLNVTENAEIGSFVIRVTS-------SDLDLGANANASYSFSEN---PGEKFRIEPQSGNITVAG-HLDRE--QQDEYILKVVASD----GAWRAETPITITIQDQNDNAPEFEHSFYSFSFPE---LQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGK--PPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRG-----VPP-QSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPE 3345          

HSP 15 Score: 130.954 bits (328), Expect = 3.103e-29
Identity = 123/454 (27.09%), Postives = 204/454 (44.93%), Query Frame = 3
Query:  390 TISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDR------FALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE---FSIDRKSGSIRLTQPT--------SCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKP----LAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGI 1688
            T+ + + I D ND  P+F  +  E  I+EN+A+ T +    A D+D    G  +    E+ +ED        F+L+    Q      LRVV  LDRE +  Y L I+  D+G+PP     ++ I + D NDNSPVF P +Y+  + E+   G  V++V A+D D G N  + Y       VL ++   FSI   +G +R+ +          S  +   DC L   A D           +T++++ IN   P F        D      + + T  P    +  V+  D D  P +      +   D ++F +  + G++ +L   K +       YT+T+ A+D G+P    T  + + +   N   PVF  +    TV  N    + +    ATD D GLN K+ +++  G++  RF I+ ++G I+    L   +     L ++A+D+ I
Sbjct: 2150 TVKVTILIKDVNDEVPVFI-SANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQ------LRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSI-----VLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAE--------LTINILDINDNRPTF-------LDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALL---KPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLL-GEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSI 2572          

HSP 16 Score: 120.168 bits (300), Expect = 5.950e-26
Identity = 149/608 (24.51%), Postives = 247/608 (40.62%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIK-----------FGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVED------------------------------------KGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE-----FSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNG--NPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNA--SINSFIANFFATDLDA-GLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYL-----DLN----ILQSDQLHARIKSTCPT 1775
            F  + Y+F + EN      VGQ++ +           +G   ++ +   +F+LN  TG++  +  +D E +    I I   +   +     TI++   ++D NDN PIF P      + EN+ + T++   +A D D+   G+   Y I +G+ D  F +   G        +R  R LDRE +  Y LT++  D                                    + Q  L   ++V I+++D ND  PVF  +  T  + E+      V+ V A D D G N  ++Y  K+ R     +     FS++   G +R+       + +    L + A D G P  S    + + ++  N   P F      S   A    IG +  +    V   D D+     I  SI+ G+  + F++    G   ++R  K ++   L  Y++TVRA D    NP+   T ++ I I   N   P F +      V  N       ++    A D D   LN ++ Y + +GD  D F I   SG I LLKPL   +  +  L ++A D G   L  TG +     D+N    + +    HA ++   P+
Sbjct: 1922 FEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWAND--VFSLNPQTGMLTLTARLDYEEV-QHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIE-YSITAGDVDSEFGIDSNGT-------IRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDREL-RSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQY-SASVAENASIGAMVLQ----VSATDVDEGANGRIRYSIVLGDQNHDFSISEDTG---VVRVAKNLNYERLSRYSLTVRAEDCALENPAGD-TAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGD-SDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPS 2506          

HSP 17 Score: 119.783 bits (299), Expect = 7.778e-26
Identity = 137/550 (24.91%), Postives = 239/550 (43.45%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLI---------KFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTD--ISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLP-GFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDC-----TLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKA-IHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQS-VTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKI-KLEIIARDAGINSLETTGYLDLNILQSD 1739
            F   QY+  V+EN  I  +V QV           +  +S     +   F++++ TGV+  +  ++ E L+   + +      LE    +T  + + I+D NDN P F  +    R++EN        +    A D+DT        Y ++ G+  D F ++       G + L  ++PLDRE + +Y LT+   D G PPL G   V + V+D NDN PVF    Y   + E NLP G  V+   A+D D G+N ++ +          + F ID ++G I     T+  +++ +      TL+ +      P  S+   +T+ V  +N   PKF      +T   A  E  ++++          D  D  + +    I G D++ F +    G V    ++K    + +  +YTI + A+D G  S  +  ++ + +    + FP F     S   +  +      I    AT    GL GKI Y+I  G   D   ++ +SGL+++ +     +L  + ++ I A D    SL +   + LN+  ++
Sbjct: 2278 FDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDS-DLFRINASS----GDIAL--LKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRE-NLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHM---HRFHIDSETGEIS----TATTLDREETSVYHLTLMAQDSSITEPRASS-VNLTISVSDVNDNIPKFD----STTYNVAVPE--RISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPEL-FPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDAN 2804          

HSP 18 Score: 118.627 bits (296), Expect = 1.558e-25
Identity = 129/499 (25.85%), Postives = 220/499 (44.09%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEG--QFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDIS--LTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDAD-SGVNQEVEYQFKKTRSVLENEFSIDRKSG------SIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFR-NRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYL 1715
            +G F + + +G I T   +DRE +       F+ +   +G      T S+ + ++D+NDNPP     K  R    N+    +I   +   T SD D    +N     S N  ++F +        G +   V   LDRE +++Y L +   D      +    + I ++D NDN+P F  S Y+    E       V ++ A+D D  G N  + Y  ++   +    FSID  +G      ++R          +    L V A D+G P L + C V ++++  ++  PKF +  Y+    + A      V  + +  VH  D      + +  S++  N  +IF++ R  G + +++ I+   N     Y + VRA D G P +     ++I +   N+  P F  N YQ V V  N  + S I    ATD D G NG + YSI+ G+ R  F++++ +G I + + L +  + +  L I  +D G + L +   L
Sbjct: 2854 DGTFEITE-SGEIYTRMRLDREEIGD---YAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPP-----KFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIE----PQSGNIT--VAGHLDREQQDEYILKVVASDGA---WRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPM----FSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDA------VRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTR---YELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQ-VIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAML 3320          

HSP 19 Score: 116.316 bits (290), Expect = 8.886e-25
Identity = 117/461 (25.38%), Postives = 196/461 (42.52%), Query Frame = 3
Query:  393 ISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYR---GQLLLRVVRPLDRETKEKYK----------------------LTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVE---AFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYR----DRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARD 1679
            + + + +IDENDN P F  +     I EN    T +    A D D     +  N ++        F LS     +        ++ +RP DRE   K                        L  +V D G P L+  ++V++IV D NDN+P F  + Y V ++E    G  +  V+  DAD G+N +V Y   K       +F++D  +G + L +       +    +VV    A  H    LS+   +T+ V+  N   P+F      S+ + + +E    T   L      D DQ     +  SI  GN  + F ++   G++++    K +   ++ SYT+ + A D G PS  TTV   + +   N   P+F +      +     + + I    A D D+GLNGK+ Y+I+K + +      F I  ++G+I  L+ +    +D  +L ++A D
Sbjct: 1137 VPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRD-----IGRNAELS-------FTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEA--GQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKH---PLSSNASITIVVLDENDNAPEF----TQSSSEVSVLETSP-TGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLH---KPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATD 1572          

HSP 20 Score: 115.161 bits (287), Expect = 2.035e-24
Identity = 156/585 (26.67%), Postives = 247/585 (42.22%), Query Frame = 3
Query:  159 SQYNFRVSENQPINTIVGQVLIKFGFS-YEFF-----------HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQ-FLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVE----IIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFR-INYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGN-------------------PSK-----------------QTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDR-------FAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL 1730
            S+ +  V EN+PI T +  V      +  E+F             + LF+++   G++ T+  +DRE+   +  E+ +Y   L GQ       ++V ++D+ND+PP F        + E++ +   IS   A D DT   G S  + +  G+ D +F L        G+L+L     LDRETK KY+L I V D       GV   E    I V D NDN P+F  + Y+  + E+   G++V ++ A DAD G N ++ Y          + FS++ ++G + LT        Q    L+V+A D+G PSLS    V  +V+ +N   P F  ++Y     +   I    VT      V  +D D     LI  SI  G+ ++ F ++ ++G +   R +   H     +YT+TV A D  +                   P K                  +TV + I I   N   PVF +  ++  +  N +IN+ +    A D D G NG I Y + +    D        F++    G + ++  L         L I ARD G     T   L + IL
Sbjct: 1717 SKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREA-GPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LG-SVTFLLMDGH-DGKFLLE----PSTGKLILNDT--LDRETKSKYELRIRVSD-------GVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGV--VSDWANDVFSLNPQTGMLTLTARLDYEEVQ-HYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVT------VSAKDIDSGNNGLIEYSITAGDVDSEFGID-SNGTIRTRRNLDREHR---STYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRIL 2269          

HSP 21 Score: 112.849 bits (281), Expect = 8.733e-24
Identity = 119/475 (25.05%), Postives = 201/475 (42.32%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ----------EFIFFITAEDHGIPRLNSSVKVYVKINPSPK-------SKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQ-----MVTYRISKCTQKGAFSINQHTG--IIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIG------TTVGRVYAQDPDTN-------------EVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVD 4427
            R  Y   + A +     +   + V + + D NDN PIF    Y  S+N    P T +  V A D D G N  + Y + +   E  F  ++ ++G + T + V+  +Q            +F + A DHG PR +   + YV +N           S +FF        + E+      +  + +           + RI    + G F + +     I+ +   LDRE I  + LT+VA D  +   +      +L +++ DVND+ P+F+    +  +LSE    G+ +   TA D D G+N QV Y +  +G E +  F +D  +G +    P+D E++      I+A D G     +   + V I + NDE P+F++        +QNV +G      T V  + A D D               E LY LQ        F ++ ++G L+   P+ +E    +++ V+A D
Sbjct:  233 RGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAE--TEHQFT-VNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDG--RTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPART---TTAHLIIDVNDVNDHEPVFEKSEYS-AVLSELAPTGSFVASITATDEDTGVNAQVHYDIL-SGNE-LKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQR-------EQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQ--------FALDALTGQLTTRRPLDREKMSQYEISVIARD 681          

HSP 22 Score: 111.694 bits (278), Expect = 2.103e-23
Identity = 126/505 (24.95%), Postives = 222/505 (43.96%), Query Frame = 3
Query: 8250 VIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVID---ADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE---IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPV-------KSLFLLNEDS--------------GSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITA-ECELRILKSTFQYPIAVLYTSQEGSRVANIAVNH--DNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE---LDQLIVLPEVRDEDS 9665
            + D+ND++P+F    +   + E   + +    +   D    D+     +  ++G     F + P +G +F+   +DRE +  Y + V+  D         + ++I V D NDN PQ +    N TF  +  E A  + FV  +TA D D  +  N+++ ++LSS+ Q   +       K+L   + ++              GSL   ++A N++    TV      SD G P L   + V  +     +     L++   Y + +   + EG+ + ++      + L G++ + +  GN +  F++ S  GQ+S  R ++     +   LIV A    +   +S      +IT+V+ D N  +P+   S + VS+ E    G+ L++    D D G+   V  +I  S  +R     F  +  +  L +  PLDYE    Y+L + A D G P  S T +  + V+D++DN P F S   V  ++E   L   IV     D DS
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEI-IEGNTERMFGVFP-DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFT----NSTFTFSIPENAPADTFVGKLTAVDRDIGR--NAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLR-GSMAGNYMLLEATV------SDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAP--YHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQ-EIHHLIVVAKDAALKHPLS---SNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSI--SAGNRRDT--FHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDS 1518          

HSP 23 Score: 110.538 bits (275), Expect = 4.857e-23
Identity = 135/501 (26.95%), Postives = 212/501 (42.32%), Query Frame = 3
Query:  105 RISEKFLILMIL------CVKFLSSQYNFRVSENQPINTIVGQVLIKFG---------FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNN--YKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLP-GFEVVKVYASDADSGVNQEVEYQFKKTRSVLEN--EFSIDRKSGSIR-LTQPTSCHINQGDCTLVVEAFDHGSPS---LSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRI-----NKANIYFPVFRNRYQ-SVTVYRNASINSFIANFFA 1514
            R+ +K  + +I+        +FL + Y+  +SE     T +  V  +           +S    ++ G FNL+  TG +     +DRES     + +      L+       SI + ++DENDN P F  +  E  ++E     T++    A+D+D    GV++   + I +GN  D F +  +     G L L   +PLD E    Y L I+  D G P L   +   ++V D NDN P+F PS   VR  +  +P    +V V A D DSG+N +V Y   K    L     F I+ ++G I  L +     I+    T+V  A D   PS   LS    VTV V  IN   P F  +N      K       K +   +  VH +D D     L+   I+ G  E +F L+R  G +      +    +    Y +T+++ D    S++ + ++ I I       +    P F  R + S +VY N  I + I    A
Sbjct: 1257 RLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQ---GVNSQVVFSISAGNRRDTFHIDSI----TGSLYLH--KPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIF-PSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVV--ATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPK---FSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQE-LFKLQRNTGIITFTPGPQFKQEVR---YQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA 1738          

HSP 24 Score: 108.997 bits (271), Expect = 1.418e-22
Identity = 143/551 (25.95%), Postives = 233/551 (42.29%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVL-------IKFGFSYEFFHKEGL--FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNE---DDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKY---------TVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLT--QPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY----IEIGKVTR-----KPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNIN-----LQSYTITVRAIDNGNPSKQTTVDM-LIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            F  S+Y+  +SE  P  + V  +        +     Y+      L  F+++ LTG+I+T+  +DRE   +  + I         +F  T  +KV I+DEND  P F   +    + E+    T ++L  ATD D    G S  + +    E     +FAL  +     GQL  R  RPLDRE   +Y++++   D+G P P      V + V D NDN P F P  Y          ++L +       ++ V ASD D G N  +EY+ +   S  E  F +D +SG+I L    P S H  +    L+V A D G         V + V++      K  +   G      Y    +E  +  R     + + IV  +  +      I   II G+    F ++   G +   R +      N     L S + +  A  +     Q  V++ +I +N     F + R    ++++  NA++   I      D DAG+N +I YS+T  +   +F I   +G++ L +P+       I +E++A DAG
Sbjct:  494 FEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYT-QLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNG-SVTFALAPSVERLYPLQFALDAL----TGQLTTR--RPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLE---SGGEGLFQLDARSGAISLRGDAPASMHW-KPHYKLLVSARDAGQRRSQQDAIVEI-VLK-----SKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTN-NPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAG 1025          

HSP 25 Score: 107.842 bits (268), Expect = 3.114e-22
Identity = 169/704 (24.01%), Postives = 291/704 (41.34%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLP-QLVSVYTLRIRAS-------------LKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGS-VEENSDSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD------GINVLE---------------------------------IGMLITVTDSNDNRP---QISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSE-----NQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLF-ITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNH--DNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFN------LYSPQI-RISETTVSISELIKVGSNLLQVDVIDPDAG-LAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE---LDQLIVLPEVRDEDSIMASR 9680
            F +   +G++ LN+ L  +  S Y LRIR S             +   N     ++DT  S  + +N  +    GY  G  V  ++D              N+++S+ +   W+ D    N +T  +    +    EV + + I     +G   +  +      V+DLNDN+PIF    +   V EN  I + ++ +   D DS    L ++S+  G+ ++ F I+  NG++   + +DRE +S Y + V   D        + LE                                 + + I + D ND  P     ++  I +   INT         V+ + A D D+ +  N  I Y +         Q  P+   F LN   G L +       +  +  ++  ITA DRG+PP   S     L  I  E +   +    QY  +V   +  G+ V  ++     +   G I + I+ G+ +  FSI    G +  ++N+N   L ++ SL V+A    + +     ++   +T+ I D N      L SP + R+ E TV  +     G  +L V+  D D   L   V+  +     D F +     N +S  + ++ PLD E Q +Y+LTL+A D G P  + T IV ++V D +DN P F  +++ A++RE       ++ P   D+D  + ++
Sbjct: 1868 FLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQR----GYQVGQIVARDAD-----------LGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGID-SNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINT--------VVIAVKAVDNDEGR--NGYIDYLMKEARDEDMGQSDPLP--FSLNPTDGQLRVVDALDRELRSSYLLN--ITARDRGEPP--QSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRY-SLTVRAEDCALENPAGDTAE---LTINILDINDNRPTFLDSPYLARVMENTVPPN-----GGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRI-----NASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAK 2525          

HSP 26 Score: 102.449 bits (254), Expect = 1.139e-20
Identity = 188/811 (23.18%), Postives = 320/811 (39.46%), Query Frame = 3
Query: 3711 TGIIHL--INRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWN-----FIITAFDLGYPALHSNLSVTVTITNINDEKP----RFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT-------------NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS-FDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAII---LPKSSFYREKIATLKAQSNSKNLNSRFMY-LLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAP--------ENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE--FSLDKTSGIVTTSG-VPLDHEAVAYFIGKIQVSDGTFTSTXXXX-----XXXXXXXXQCHNFTHDRYHFHI---HE---TAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLA---VSIPEDVPINSEIIQLIASDADKS-DLLLFEILSPNDDLLMTVNPITGVI 5972
            T  +HL     LDRE+   + L I A D  S     YL V    V I+DVNDN PIF +   N   L+E+   GT +    A+D D G N ++ Y L  T  +     +    S    +N P    +K   +     F + A D G P       VTV + + ND  P    RF  +      V +N   GT V  V  +D D+             NE+ ++        H   +N   G+L       +E+  ++L V+A+D     R     + + +   +D+E   +   Y A++    P  SF    +A++ A      +N++  Y +L  +      ++  TG   + +T P++   I  T  +S+ +       K+  T+L + I D ++   Q +     +   +  P   +  L      +  ++     F +   +     L      LD  TG ++     LDRE +  SQ  + V+  D+G    +     V+LN+ D NDN P F    +I+           +     ++I +    +   D D+ L    +    E  F LD  SG ++  G  P       ++   +   D     +         +       +C       Y F +   HE    +  +  +G V +K++    N  I++DI+       F ++   G ITT   +D E+  +Y L I A+  S  S     +      V ++I+D+NDN PVF   R +   +S+PE+  +  EI      D D   +  +   L+ N +    + P+TGV+
Sbjct:  217 TSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVN---VTILDVNDNPPIFDHSDYN-VSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVN---GVLD-----REEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSF----VASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTG--LIVTTGPLD-REIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSV-TFALAPSVERLYPL---QFALDALTGQLTTRRP-LDREKM--SQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVL 1001          

HSP 27 Score: 101.679 bits (252), Expect = 2.262e-20
Identity = 122/513 (23.78%), Postives = 221/513 (43.08%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALI--GSWIIDIGVIDADSKLF--PLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG---MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSEN---------------------QRIPVKSLFLLNEDSGSLTIKAVALNW-ISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQ---WFSLIVQAC--GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITS-TDDRFSLVPFPTNGNSYQLKV-VNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELD---QLIVLPEVRDEDS 9665
            I ++D+NDN P F  + ++  V EN +   G +++ +   DAD+      +++ L+  +++ F IN  +G + L + +DRE +S+Y + +   D  +    G   + + V D NDN P    +  + T   N     H    V+   ATD D+    N+++R++L  E+                     +   V  L L+ +DS     +A ++N  IS ++  D I         P F S T +          RI K  F +          G+R    A++ D+    +  + ISG    YF I +K G +ST   + +         +++++ A   G + LSS      +  +T+++    L+     ++ +  ++SE ++ G  + +V    P  GL G ++  I      D   + P     NS  L V  + LDYE+ H Y + + A D   P     +++ + V D +DN+P      + A + E +   QLI + +  D DS
Sbjct: 2372 INILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTH----VLTPRATDKDEGL--NAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNI---------PKFDSTTYNVA-----VPERISKGEFVF----------GAR----ALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSS------KAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDP-----NSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDS 2839          

HSP 28 Score: 98.5969 bits (244), Expect = 1.729e-19
Identity = 119/467 (25.48%), Postives = 213/467 (45.61%), Query Frame = 3
Query: 3144 QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQ-----MVTYR-ISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSN----LSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT----NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVDAERQDRYDQQSVKVHIKHDNED 4493
            +Y   V A ++    +S +  VVI V   N ++P FS  SY   +  +    +TI  V A D D+G NG + YSI       DF  +D ++G +   + +D  + QE+   IT +D G   L+S   + + +     +   F+ + +   I E+  +   +F+     +      ++ Y  +     +  F +NQ  G I      D E    + L I A +  S+  S      NLYV+++ VN+  P F      +F +SE++ VGT +G   A D D G +G+V Y L   G  +   F+IDT +G +Y+ + +D E + +   ++T     Y ++  N      V ++I + ND  P F K      I  +   +GT V  V A D D     N+  Y + + +     F I+  +G +S ++ + +E   +++LV+ A+D     +    +V + ++  N++
Sbjct: 3194 RYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDF-SVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMES----YANLYVHVLGVNEFYPQFLQPVF-HFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLL--VGSSNDKGFRIDTNTGLIYVARHLDRETQNR--VVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTI-SEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGN-LKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDN 3647          

HSP 29 Score: 98.2117 bits (243), Expect = 2.628e-19
Identity = 142/559 (25.40%), Postives = 232/559 (41.50%), Query Frame = 3
Query: 8058 GNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYE----------------------MKVAVSD-GINVLE--IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDV---IITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP--------IAVLYTSQEGSRVANI-AVNHD-NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVN-SAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTV-SISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTS---IVLIKVLDEDDNSPYFISRN 9599
            GN++  F + P     YL+  A          P+DRE  +   ++V   D G        P +I VID NDN+P FT + F   + ENA   +++  +  +D D  +   L F+L  +  + F+I+ +NG +   +  DRE   K                        ++  VSD GI  L+  + + + VTD NDN P    E +   + +  SE A     + ++   DAD+    N  + YSL+  N+       F L+  +G L+     L    D E+ ++   I+ A D        +   H L   A   + +L      P        ++VL TS  G+ +    A + D  +  ++ F I +GN    F I S  G +   + ++   I     ++    CGT  LS+    +      LV+ D +  +P I  S   V  I E I + + ++ V   DPD+GL G V   I            F  N  +  +  +  +D E    + LT++A D   P + Q S   +V + V D +DN+P F+S N
Sbjct: 1091 GNTERMFGVFPDG---YLFVRA----------PLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQD-FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAP----EFLRAPYHVTISEGASEGTHITHVFTQDADEGL--NGDVYYSLAKGNE----AGQFNLDSATGQLS-----LGRRLDRESQEIHHLIVVAKD--------AALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYN-----VLVVDDND--NPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMN 1605          

HSP 30 Score: 97.8265 bits (242), Expect = 3.642e-19
Identity = 142/638 (22.26%), Postives = 269/638 (42.16%), Query Frame = 3
Query: 7866 VYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISVSNNILSCNGNSKVSF--TLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSG----GIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD----SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVD----RELKSKYEMKVAV------------SDGINVLEIGMLITVTDSNDNRPQIS-KEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETV---DVIITASDRGQPPLFHSITVHFLFITAEC---ELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDN--LYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPR-KSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLIVLPEVRDEDSIM 9671
             Y + +R  +  VN     + +  ++IS  ++    T       +  +  ++ ++    I++ N ++K     T +P     YL+     N        +DRE   + ++++   DG      G ++     + ++D+NDN PIF  + +   ++E AL G+ ++ +   D D    SK+    + L  E  + F++NP+ G +   + V+      +KS    K  V             DG   + + +L    D+ND+ P IS +   +   V    E A     V  +   D+D   +  + +R    +E         F L E   +  +  V +N + D E +   ++ + A D+G P    + T H +    +    E    KS +   ++ L  +  GS VA+I    ++  +  ++ + I+SGN   +FS+    G I T+  ++  I      L + A         ++      + ++I D N  +PQ    E  V++ E     + +  +   D D G  G V   +  S + R   + F  +  + QL    PLD E   QY ++++A D G P  +S T+ V + V D +DN P F  R+++ SL + D  I L +  +++ I+
Sbjct:  137 TYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGN--------LDRESRGSYQLNISARDGGSPPRFGYLQVN---VTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKI---TYYL-AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLL----DTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNE------LGHFRLEE---AADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPA--RTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPT--GSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIR-DTVELSISARDGGPNPKFAYTQ----LKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVE-RLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERIL 736          

HSP 31 Score: 95.1301 bits (235), Expect = 2.025e-18
Identity = 115/472 (24.36%), Postives = 203/472 (43.01%), Query Frame = 3
Query:  291 VILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN--NYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLEN-EFSIDRKSGSIRLTQPTSCH-INQGDCTLVVEAFDHGSPS-LSAYCYVTVHVIRIN----SFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRD--LIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRI-------------NKANIY-FPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPL 1631
            ++  + ++DRE +    + +    +    +   T  + + + D ND+ P+F  ++    + E     + ++   ATD DT   GV+   +Y I SGNE   F++  +        L+    PLDRE ++  +L+IS  D G  P     ++++I+ D ND +P FS  +  V L E   P   V  + A+D D G N  V +    +   L   +F++D  +G +   +P     ++Q + +++  A D G+P+  SA   V ++V  +N     F+P+  I  +        I++ K   K   ++H    D+D  D  LI   +  G  E +F L+   G + +     A  +     Y + V A D G   +++  D ++ I              +A  Y F +  +  Q     RN+  N  +        +   N  I Y I +GD    F I+  SG IT  +PL
Sbjct:  445 IVRVNGVLDREEIGKYNLTVVAMDQGTPAR-TTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDT---GVNAQVHYDILSGNELKWFSMDPL------TGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVI--ARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADD--DDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGG-EGLFQLDARSGAISLRGDAPASMHWKPH-YKLLVSARDAGQ--RRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQ----RNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPL 894          

HSP 32 Score: 93.9745 bits (232), Expect = 4.918e-18
Identity = 98/359 (27.30%), Postives = 157/359 (43.73%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSS--VKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLE-ID-----HQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQ-VRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNIND 4184
            R+ Y+  + A N  D    +   + + V   N+  P F    + F ++  +   T +G V A D DSG +G V Y +     +  F  ID+ +G ++  + +D   Q   +  + A+++G  R N +   +V + I       +F  K  +   ISE   +  K+  ++ ID          +Y I     K +F I+  TG I   +RLDRE  + + L I A D   T          +++ + DVNDN P F  + LN +I SE+   GT +    A+D D   NG    Y+L   G +  S   +D  SG +      D E+ P    II   D G P   S   +T+T+ + ND
Sbjct: 3403 RRIYTLQIKAKNP-DSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGF-RIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFI-KHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAID---TGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYI-SENEPAGTSIMTLIASDPDLPRNGGPFTYQLI--GGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQND 3752          

HSP 33 Score: 93.9745 bits (232), Expect = 5.086e-18
Identity = 113/430 (26.28%), Postives = 194/430 (45.12%), Query Frame = 3
Query:  411 IIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQI-KAIHNINLQSYTITVRAIDNGNPSKQTT--VDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGL-NGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGI 1688
            +  EN + P F  N  +  + EN  + + I    ATD DT   G+   Y I  GNE   F++     +  G ++++  + LD +  ++Y L I+V+D G  PL  V  + II+ D NDN PVF+  +Y   + E+   G  V + +A+D DS  N  + Y F    S  +  F I  +S     +  +  +  +   TL ++A +  S S+ +Y  + VHV+ +N F+P+F +  V   D +    +G  TR  +  V   D D      +   ++G +++  F ++   G +++ R + +   N       +TV A + G+     T    ++I I   N   P F   Y + T+   A + + +    A D D    N +  YSI  G+ +  F I+  +G I+    L   +     L I A D G+
Sbjct: 3219 VTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLR-YSISGGNERQDFSVD----ERTGGIVIQ--QQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLP--SGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS-SMESYANLYVHVLGVNEFYPQF-LQPVFHFDVSETSAVG--TR--VGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQN----RVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDP-PEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGL 3628          

HSP 34 Score: 92.8189 bits (229), Expect = 9.137e-18
Identity = 118/489 (24.13%), Postives = 208/489 (42.54%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVN-YSIEKLPVELDF--VEIDSQSGRL------FTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLD---------REAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPI----FKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGA--LYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQ 4502
            R  Y   VL+      + +  + V I V D NDNSP F   S   S +      T +    A D D G NG  + Y I    V+  F  V   + SG         T  L       +   I+A D G P     ++V V I     +   FD   +  +++E       +  +     ++     +TY +++   +  F++N  TG+I    R++           +    V T+ A D+ S +      VT   VN++D ND+ PI    F  D      + E+   GT++      D D GLNG+   R+  +G E +  F+++  +    + +N  +D E   K+N  + A D G PA  +   + + + ++ND +P F K S    ++ +    G+ V  + A D DT    +V Y + S +     F ++P++G++  + P+ +E+  + +L + A D     ++    +KV I  +N++  Q
Sbjct:  124 RDHYDLVVLS-----SQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ--FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVT---VNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIV-SGNE-LGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEK-SEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKW-FSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQ 598          

HSP 35 Score: 91.2781 bits (225), Expect = 2.999e-17
Identity = 113/467 (24.20%), Postives = 208/467 (44.54%), Query Frame = 3
Query: 8241 IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP---LKFSLQG-EENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLE-IGML-ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLY-GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRET-ITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLV--------PFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            +I V   N ++P F++N +   V EN  +GS I+ +G  D D+   P   L++S+ G  E   FS++ + G + + Q +D +L  +Y + + V D G + L  + ML I +TD NDN P  +    +K +     E      FV    A D D  +  N+ I Y+        P +  F++N+ +G+++  AV+ ++         I   +       + ++ VH L +  E   + L+  F + ++   TS  G+RV  + A + D+   G + + ++  +    F I +  G I  +R+++     +    +V     K   S+      E  + + I D N   P+      T +ISE   VG+ +  V  ID D           + + +++FS           F  +  + ++   + LD E    Y+L + A D G P ++ ++ V I++ D +DN P F
Sbjct: 3216 VIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTG--PNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFN----HKEYHCYIPENKPVGTFVFQAHAADKDSPK--NAIIHYAFLPSG---PDRHFFIMNQSNGTIS-SAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVN-EFYPQFLQPVFHFDVS--ETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNR----VVLTVMAKNYGSIRGNDTDEAQVIISIQDGN-DPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKD-----------VRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTF 3651          

HSP 36 Score: 87.8113 bits (216), Expect = 3.341e-16
Identity = 103/391 (26.34%), Postives = 168/391 (42.97%), Query Frame = 3
Query: 8241 IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG----MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIIT--ASDRGQPPLFHS--ITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTI 9377
            +I+++D NDNSP+F    +   V+ENA IG+ ++ +   D D      +++S+  G++N+ FSI+   G V +A+ ++ E  S+Y + V   D       G    + I + D NDNRP           + NT     G +  VN  A DA D+   NSQ+RY L   +       LF +N  SG + +    L  +   +  +  +T  A D G PPL  +  + V    I     +  L+S   Y   V      G+ V    A + D        F + G     F I S+ G+IST+  ++      +  +L+ Q        + S       +T+ +SD N   P+   +   V++ E I  G  +     +D D G   +V  TI
Sbjct: 2265 LIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVN--AYDA-DTPPLNSQVRYFLKEGD-----SDLFRINASSGDIAL----LKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQS---YHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSV-----NLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI 2635          

HSP 37 Score: 84.3445 bits (207), Expect = 3.394e-15
Identity = 116/521 (22.26%), Postives = 227/521 (43.57%), Query Frame = 3
Query: 8154 PVDREVYNNLEISVIIADGSGGIIESCPGIIKVI--DLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-----SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLEIG---MLITVTDSNDNRPQISKE-----IINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILK------STFQYPIAVLYTSQEGSR------VANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQI---RISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            P+DRE+ + +E+S+   DG G   +     +KVI  D ND +P F+       + E+A   + +  +   D D     S  F L  S++      F+++   G +   + +DRE  S+YE+ V   D G    +     + + V D NDN PQ         + +    I   +       ++++TA+D DD   +N+ I Y L S  +      LF L+  SG+++++  A   +       ++++A D GQ     S     + I  + +L +L+        +++ +   +  Q  S+      +  +   +      I + II G+ +  F I +++G+I+T+R ++      +  +++  +  +   ++ S    +  + + I D N  +P     R SE T+S+ E   VG  +    V D DAG+   +  ++  + + +F + P      +  L +  P+  E      + L+A D G P  S    + + + D +D++P F   ++  SL E
Sbjct:  556 PLDREIRDTVELSISARDG-GPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDG--DNALIEYRLESGGE-----GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQ---RRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPV-----TGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPE 1060          

HSP 38 Score: 82.8037 bits (203), Expect = 1.016e-14
Identity = 91/348 (26.15%), Postives = 157/348 (45.11%), Query Frame = 3
Query: 5121 TKVFLNIEDCNDNRPV-----FANETFIFHAPENTTYGQKIYVGTVQAHDKDLD--STLEYIWINEIPEFSLDKTSG--IVTTSGVPLDHEAVA-YFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN--FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADK-SDLLLFEILSPNDDLL----MTVNPITGVISTAGILDYEKTERHALTVSCTD----GLHRVTVEVLINLINVNDETP 6101
            T V +N+ D ND+ P+     F +   +    EN   G  +    V+  D  L+  +++  +  NE+  F L++ +   IV  +GV LD E +  Y +  + +  GT   T    ++ID  +   H   F    Y   + E AP  + +  +T  +  T  N  + +DI+S      FS++P  G+I T G +D E  +   L I+A D      F        T + V I+D ND  P F      V++ ED P  + +  + A+D D+ ++  +   L+P+ + L      ++ +TG ++T   LD EK  ++ ++V   D         T  V +N+ +VND  P
Sbjct:  366 TYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGV-LDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKF------AYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDP 706          

HSP 39 Score: 78.5666 bits (192), Expect = 2.084e-13
Identity = 89/326 (27.30%), Postives = 136/326 (41.72%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLI------KFGFSYEFF---HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYK-KTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVN-QEVEYQF--KKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRIN 1085
            +FL   ++F VSE   + T VG V        + G  Y        +  F ++  TG+I  +  +DRE+    ++ +      ++ G   +   + + I D ND PP F  +     I E   + T ++   A D D        +Y I +GN    F +    VQ  G++       LDRE    Y L I   D G PP  G   V I +ED NDN P F+P      ++E+   G  ++ + ASD D   N     YQ    K +S L    S+DR SG +R T      +       ++E  D G P   +   +T+ V+  N
Sbjct: 3438 QFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKID---VQT-GEI--STASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWL----SVDRNSGVVRSTTSFDREMTP-ILEAIIEVEDSGKPKQKSQHLLTITVLDQN 3751          

HSP 40 Score: 74.7146 bits (182), Expect = 2.862e-12
Identity = 88/341 (25.81%), Postives = 153/341 (44.87%), Query Frame = 3
Query: 5025 NIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEY--IWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDG----TFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDI---VSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVF---------DTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEI-LSPNDDLLMTVNPITGVISTAG 5984
            N  LDRE I    +TV  V +D+G   +R     + +++ D ND+ PVF    +     E    G   +V ++ A D+D  +++ + Y  +  NE+  FS+D  +G++ T+G PLD E        I   DG     F  T  + ++I D ND+   F+    +  + E AP  T++  +T  +     N  + F +   V       F+++   G +TT+  +D E+ + Y + + A D        P  ++ T TV +++ D+NDN P F               + + ++V     ++ + ASD D  D  L E  L    + L  ++  +G IS  G
Sbjct:  449 NGVLDREEIGKYNLTV--VAMDQGTP-ARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGS--FVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTG-PLDREIRDTVELSISARDGGPNPKFAYT-QLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQG-----APTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRG 777          

HSP 41 Score: 72.0182 bits (175), Expect = 1.962e-11
Identity = 106/430 (24.65%), Postives = 186/430 (43.26%), Query Frame = 3
Query: 8385 KFSLQ-GEENNAFSINPQNGSVFLAQTVDRE-LKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNET---VDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLY--GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRET----ITLVISDFNLYSPQIRI-----SETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTD-DRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLREL 9623
            KFS +  E    F+++P  G V     +DRE ++  Y++ V  S     +E+   I V D NDN P+  +  I  +F    SE A     ++   ATDAD  + N    +Y + + N     + +   N  SG  +   +      D E+     + I+A D G PP F  + V+   +       I   +  Y +++  T+  G+ V  +  + ++L    +IT+++        F++  + G IST+  VN        S   Q      + +    S R+     +T+ + D N + P I            ++ E    G+ +  V V D D+GL G   + I++  +   F L       + + ++V   LD E   +Y+LT++A D G P ++ T+ ++I V D +D+ P F    + A L EL
Sbjct:   91 KFSYRFNEPPREFTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYPIEV--RIKVLDVNDNSPEFPEPSIAISF----SESATSGTRLLLDAATDADVGE-NGVTDQYEIVAGNVDNKFRLVTTANP-SGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHS-DYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL--AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRL---EEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSEL 506          

HSP 42 Score: 71.2478 bits (173), Expect = 3.352e-11
Identity = 108/498 (21.69%), Postives = 201/498 (40.36%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADS---KLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE--IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSL--SSENQRIPVK--------SLFLLNEDSGSLTIKAVALNWIS----DNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHD--NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGL-AGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASL--RELDQLIVLPEVRDED 9662
            I + D+NDN P+F    +  ++ EN  +G+++      D DS    +    F   G + + F +N  NG++  A + D E +  Y +++   +  + +E    + + V   N+  PQ     +   F  + SE +     V  + ATD D  +  + ++ Y L  SS ++   +         +  L  E    + +  +A N+ S    D +   VII+  D   PP F  I  ++    +E            P+        G++V  + A++ D      + ++ II+GN    F I  + G+IST+  ++       ++L++ A  T +           T+ + + D N   P          ISE    G++++ +   DPD     G     +I      +  V    + NS  ++     D E+       +   D G P++    ++ I VLD++DN     S +   SL   +L   + L +VR  D
Sbjct: 3322 IILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQF----LQPVFHFDVSETSAVGTRVGAVQATDKDSGE--DGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEF--IKHYYTSTISEAA----------PV--------GTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREET-STYNLVIGAIDTGLPPQTGSA----TVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSV----DRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPSNVKLADVRPND 3784          

HSP 43 Score: 68.5514 bits (166), Expect = 2.131e-10
Identity = 94/379 (24.80%), Postives = 150/379 (39.58%), Query Frame = 3
Query:  651 LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQ-------GDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQD-PRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDA-GLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIK-------LEIIARDAGINSLETTGYLDLNILQS 1736
            LD E    Y++ I   D   P L+ V  + + V D NDN+PV     Y   + E   P   +  V ASD DSG N  V Y+       L+N+F      G+  +T+    +          GD   VVEA D G P ++    V +H++  N   PKF R+  +  T+ A   EIG        ++     D D   +  A      N    F +E   GN+ +   +          Y + V A D    + +    + I I   N   P F + + S +        + +    ATD D  G N  I YS+ +      F+I+  +G +   K + F     ++       L ++A D G   L +   +++NI+ +
Sbjct: 2768 LDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYR-------LQNDF-----DGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENA---EIGSF------VIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQ---DEYILKVVASDG---AWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS--PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDA 3117          

HSP 44 Score: 62.7734 bits (151), Expect = 1.145e-8
Identity = 111/511 (21.72%), Postives = 209/511 (40.90%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIKFGFSYEFFHKEGL-------------FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETIS----IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHIN---QGDCTLVVEAFDHGSPSLSAYCYVTVHV-IRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGK-IIYSITKGDYRDRFAIEKDSGLI 1613
            +F  + Y   V EN+P    VG  ++  G + +     G+             F++++ TG      I+ ++ L  DLI+ +    T++      +S    + + + D NDNPP+F   +    I EN  + T +    A D D+ +  + +   + SG +   F ++    Q  G +   V    D E +  Y L I  ++     ++    + + V   N+  P F    +   ++E++  G  V  V A+D DSG +  V Y    + +  +  F ID  +G I + +    H++   Q    L V A ++GS   +      V + I+  +  P+F  +Y  ST      E   V  K   +     D +   +  + SII GN +  F ++   G +    ++         +Y + + AID G P +  +  + I +   N   P F     +  +  N    + I    A+D D   NG    Y +  G ++   +++++SG++
Sbjct: 3228 RFSVNSYQVIVPENEP----VGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTG-----GIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMN----QSNGTISSAVS--FDYEERRIYTLQIKAKNPDSS-MESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSN--DKGFRIDTNTGLIYVAR----HLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTST----ISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREET---STYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVV 3709          

HSP 45 Score: 62.003 bits (149), Expect = 1.844e-8
Identity = 53/165 (32.12%), Postives = 77/165 (46.67%), Query Frame = 3
Query: 9228 ISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE---LDQLIVLPEVRDEDSIMASRNEPSYTLKSKT 9713
            I+D N ++P    +    S+ E  KV +    +   D D G  G +   II    +R   V FP   + Y L V  PLD E +  Y+LT+   D G P +S    V+I V+DE+DN+P F +  F  S+ E    D  +      D D  +    E S+TL S+T
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGV-FP---DGY-LFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRD--IGRNAELSFTLSSQT 1196          

HSP 46 Score: 58.9214 bits (141), Expect = 1.638e-7
Identity = 62/236 (26.27%), Postives = 94/236 (39.83%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLI----------KFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLP 824
            +F+   Y   +SE  P+ T V  V            +F +S    + +  F ++  TG I T++ +DRE  ++  + I      L  Q   + ++ + + D NDN P F P  L   I EN    T I    A+D D    G    Y++  G      ++       R   ++R     DRE     +  I VED G+P  K    + I V D NDN          V L   +LP
Sbjct: 3544 EFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQ-TGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVD------RNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLP 3772          

HSP 47 Score: 54.6842 bits (130), Expect = 3.505e-6
Identity = 56/195 (28.72%), Postives = 85/195 (43.59%), Query Frame = 3
Query: 8016 DSEISVSNNILS---CNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQ---GEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG---MLITVTDSNDN 8570
            D ++   NN  S    NGN K SF +           + +T EI TA + +DRE  +   + +   D G      S    I++ D+NDN P FT     G++SEN   G+ I+ +   D D       F+ Q   G+  +  S++  +G V    + DRE+    E  + V D     +     + ITV D NDN
Sbjct: 3571 DKDVRTQNNQFSYSIINGNLKQSFKI-----------DVQTGEISTASR-LDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          

HSP 48 Score: 53.1434 bits (126), Expect = 8.948e-6
Identity = 52/171 (30.41%), Postives = 74/171 (43.27%), Query Frame = 3
Query: 5643 ITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEK---TERHALTVSCT-------------DGLHRVTVEVLINLINVNDETPLI 6107
            + T G +D E    Y L I+A D      F          V V+I+D+NDN P+FD +   VS+ E     + ++ ++ASD D  D           +   TVNP TGVIST   ++  +    +  A   SC              DG   VTV    NL++ ND  P+I
Sbjct:  222 LETTGNLDRESRGSYQLNISARDGGSPPRF------GYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTV----NLLDTNDHDPII 382          
BLAST of Protocadherin Fat 4 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 194.897 bits (494), Expect = 1.494e-48
Identity = 294/1191 (24.69%), Postives = 504/1191 (42.32%), Query Frame = 3
Query: 2745 TGRFHQHFYYIIQEQIVVLKDSFVDKNVNGRLIELRIELFDGLSGDLSVSNTEIIIEFHPIFDS-PIFFEPFYTFVVKENSLSHTPLRKISLIQSQ----NIDNY-------HLSIIE-ESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPN-----TTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNK--LVDVVEQEF-IFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYL---------QSVHPPD--HPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHI--KHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSN---SKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECK--TTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYI-----------WINEIPE------FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTF-----TSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIV---------SEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVF------DTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGIL-----DYEKTERHALTVSCTD 6038
            T   H  ++ I  +  ++   S +D      + +L +   DG    LS + T +++  H + D+ PIF + FY   V EN      + K+S          + NY       HL+  E  S  G+  I          ELD+E R  Y F VLA ++     ST   + + + D NDN P+F  + Y  S+    K +     T I  V A DPD G  G V+Y I     E     ID  +G +F  +  ++ V  Q   +  I+A D G  R N+   V++ I  + +    F+K  +   + ED+     +  +     ++ H+  V Y I      G FSI  ++G I +   LD EA +  +L I AT             T + + + DVNDN+P F+  ++    + ES ++G  L    A+D D G +GQV Y L     + +  F ID  SG L L+Q +DYE   +   I+TA D G P+L +NL++ V + ++ND  P F K+      V ++ +I   + +V A D DT     + Y +          S+   D    F I P SG + +  P+ +E    + L V+A D      + +  V V +   +DN+ + Q   Y   I  + +  R  +  +   S+    +N   R+  L  NSS+    ++  TG++  ++  P++    ++  L+ +E+    T ++     + +++ D ++   +  D    +   +    PG ++ R++A+       D        Y  +  R    + +  +D  +G I    + LD E  E S   + V   D G N  R     + + + D NDNRP F + + +F   E+   G    VG++   ++  D     +            +N + +      F +D+ SG +  + + LD E  + F  +I+  D T      +S   + I + D ND    +  D     + E  P+ T+I   T  ++ T  N  +++ ++          E    LF ++   G ++ Q  +D+E    Y+L++ A D  Q S     L+T + TV + I+D ND+ P F           ++ I +   I   +  ++A D D  D   L +EI   N +    +N  TG+I     L     D EK  R  L +   D
Sbjct:  546 TPETHAQWFQIDPQTGLITTRSHIDCETE-PVPQLTVVARDGGVPPLSSTAT-VLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICI--------AGELDFERRSSYEFPVLATDRGGL--STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI-VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP----VYGHTQVNIEVEDVNDNAPEFEA-SMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL--FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKD-EYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRI--EENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQ---VHPVTGEI--STREPLDRELRELYDLV-VEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVD-----RDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRT-RVVLDHE--ERSIYRLGVAASD-GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGH--VVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARL-LDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALD--QSSNVTERLQT-SVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKD 1692          

HSP 2 Score: 172.555 bits (436), Expect = 8.364e-42
Identity = 244/1054 (23.15%), Postives = 437/1054 (41.46%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINP-SPKSKQFFDKQTFFQNISEDMKITEKIFKLEI---DHQQ--MVTYRISKCTQK---GAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTA---------NDIDDGLNG-QVRYRLTATGMESI-SVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYP--ALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE--------VLYYLQSVHPPDHP---FVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQS---VKVHIKHDNEDEIQVLT-------YGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYD-KIIINRYTGDVFLTSTTPVEFNSIDITF---LISLESLRSDTLIKYHSTKLVLNIGDPHN---------------LNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGK-------NGSRIRCTKVFLNIEDCNDNRPVF-ANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWI----NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD-GTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSE--WGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEILSPNDDLLMT--VNPITGVISTAGILDYEKTERHALTVSCTD 6038
            R +Y  TVLA +        K  V++ V D NDN P F    Y F I  + +  + +G V A D D G N  + YS+  LP+   F ++   +G + T + +D   +E +   + A D G P  ++ V V + ++  +  + +  D Q    ++ E+     ++ ++     DH Q   +TY I K       G FSI+  +G+I     LD E  + + L + A+D  +        V  L V ++D+NDN P F + +L  F + E   +G ++G  +          N +++     +V Y L     + I + F ID  SG L + + +D E++ ++   I A D         S ++V + + ++ND  P + ++  ++  V +   +GT +    A D DT          + Y+ Q     +     F ++ ++G LS+  P+  E    + L+V A+D         Q+   V++ I   N+     ++         ++ +  ++   E +A + A       N +  Y +   + + +  IN  TG + L  + P     ++      LI           K  S  L L +   HN                N     +  Q+   K+  G +   L    P    +DL  +  D   GI        T  + D+E+    V  +Y+ R+    S ++   V   R         NG       +++ + D NDN P F     +    PEN+  G    + TV A D D     + I+     N   +FS+D +SG +  S  PLD E  + +  +IQ SD G   S      +     DQ  N   F   +Y   + E AP+ T + Q++  ++    N  + + + +E  W    F+++   G+ITT G++D E    Y  ++ ATD  +  +      + T  V ++++DINDN P+F+       +P  +     ++++ A DAD   +  +++ + + N  +     +NP TG +S +  L  E  +   L V   D
Sbjct: 1116 RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL--LPINSSF-QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE---TVRMLRVEVLDLNDNRPTFTSSSLV-FRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDP-IDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQV-TAKSLHGAENANLSYEIPAGVANDL--FHVDWQRGII------TTRGQFDRESQASYVLPVYV-RDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG---VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL--SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQW---QFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEV-----RSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARD 2138          

HSP 3 Score: 170.244 bits (430), Expect = 4.359e-41
Identity = 145/487 (29.77%), Postives = 223/487 (45.79%), Query Frame = 3
Query:  273 LNKLTGVILTSNIIDRESLAS-DLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGV----GVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDL-IAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSI--TKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTG 1709
            +++ TG I T   +DRE+ AS  L+ I L  +         I + V + DENDN P F    +     EN       +L  A D D + +  +  Y I SGN +D F LS      GV Y   L L++   LDRET   Y L I   D G PPL+G + V I ++D NDN P+F+ S+Y   + E+   G  V++VYASD D+  N  VEY   + +S  E  F ID ++G+I + +       +    LVV A DHG   L    +V++ V  +N   P   + ++ S D +  I       + +A +   D D       + V++ GG+    FAL     +++++     +    + +YT++V A D G P    +  + +RI   N   P F        V   A   + +    A D D GLN  + YS+  T   +   F I+  +GLIT    +        +L ++ARD G+  L +T 
Sbjct:  125 IDRATGEIRTKVKLDRETRASYSLVAIPLSGRN--------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYN-TQRYNIVSGNVNDAFRLSSHRERDGVLY---LDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKEL-HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFL-SDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH--FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTA 595          

HSP 4 Score: 168.703 bits (426), Expect = 1.016e-40
Identity = 251/1069 (23.48%), Postives = 463/1069 (43.31%), Query Frame = 3
Query: 3153 FTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEK--------IFKLEIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLI--NRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD---TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDV-----------FLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIK---LP-NTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTK--VFLNIEDCNDNRPVFAN-ETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEYIWINEIPE-----FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWG--KHLFSVNP-DHGIITTQGEIDYEQDNHYILLITATDV-SQQSLFLPCLETVTT--------TVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD---KSDL-----LLFEILSPNDDLLMT---VNPITGVISTAGILDYEKTERHALTVSCTDGLHRVT------VEVLINLINVNDETPLIHNPTT 6122
             TV+A +      S+   V++ + D NDN PIF    Y  S+  +      I KV A DPD G+N  VNY+I +    L   E+ S SG +     +D   +  + F + A D G   L+++  + +++     ++  F  + +  ++ E  K + +        +   + D+     V+YRI    + G F I++ TG I ++  + L       H+L I ATD  + + +    V   +++IID     PIF+  A  N+ + E    GT++G   A   D      VRY + +   +    F I+T SG + + +P+D+E K +    I A  LG P ++ +  V + + ++ND  P F + S +   V ++  +G  +   +A D D   + +V Y L         F I+  SG L +S  +  E S    L+V A D          ++ V ++  +DN    +   Y ++ + +S     +I  + A       N+R  Y + ++  D +  +  + DV           ++    P++  + D  + +++ +  + T   +  T++++ + D ++ +  FQK+ Y F+I E          R  ++      SDL+        G +  I+   LP N+  ++   TG IS     LDRE+ E   + VE         G+ +R  +  V +++ D NDN P  A+ +  +    E    G ++    V+A D+D   ++++ Y  +          FS+D TSG++ T  V LDHE  + +   +  SDG       + +L  +  D   N   FT     F + E A +  V+G ++       P  +++  +   +   +  +++NP    +I    +ID    N  +  +   +V S+  L +  L+T  +        TV + + D+NDN P +    + + + E  P+ + I    A+DAD     DL       F  L+ + +  M+   ++ +TG +S    LD+E  + + L V   D    VT      V V + +++ ND  P   +P +
Sbjct:  579 LTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVV---FLSIIDAMQRPPIFEK-ARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY--FSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEF-EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVK-ESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEY-SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD-RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEEN--------LRRGSVVGVVTASDLD-------LGENAAIRYSLLPINSSFQVHPVTGEISTRE-PLDRELRELYDLVVEAR-----DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVV--RVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTR-VVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSIS---PIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNS 1607          

HSP 5 Score: 159.458 bits (402), Expect = 7.430e-38
Identity = 248/1120 (22.14%), Postives = 446/1120 (39.82%), Query Frame = 3
Query: 3141 KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQ-----------SGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMK---ITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLT-ATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYA-QDP---------DTNEVLYYLQSVHPP-----DHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIK----HDN-----EDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLK--NSSYDKII----INRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPIS----------DLEYYIFDIYCGISERIKLPNTMIRLDKETGWIS-VGNIYLDREIIE-GSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE------FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHI------------------------------HETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS-DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG----LHRVTVEVLINLINVNDETPLIHN-PTTVYLPKINQNHNIMIKCSDQD-NLG 6191
            ++++  V A +      ST + +++ VQD NDN P+F    Y  +++     N  I +V A D D+G N  + Y I    V+     I S            SG ++    +D      +   + A D+G P  ++  +V V++  +  +   F K  +   I E+++   +   +   ++D  +    R S      +F ++  TG I     LDRE    + L + A D  +   S  + V    +++ DVNDN+P   +   +   + E    GT +    A D D G N  + Y +      +   +F ID  SG +     +D+E +  +   + A D G P   +   + V + ++ND +P F   S L F V+++ A+G  VG +   + P         ++ E L    +++P      +  F I+  SG L V+  + +EV   F L + A+D    +     ++ V I+    +DN     +D I +    A   P  +      AT      + +L  R +      N S ++ +    ++  TG + L +  P++F ++    LI     +S  + +   T + + +     L+   +   F  P         LF   A   G  ++          D     ++I  G  E         R++ +TG I  V ++    E +E G +  + +   D G+   +     + L ++  ++N P F    +     EN   G  +   T ++     ++ L Y    EIP       F +D   GI+TT G   D E+ A ++  + V D    ST +   +    +      T +  HF +                               E   IHTV+      +    PN  + + I      + FS++   G ++ +  +D EQ + Y L I A+D  Q     P        + + + D NDN P F  ++   S+ ED P+ + ++Q+ A DAD   +  L   L+        ++  +G+I+T G LD E    +   V  TDG    +   TV V IN++++ND  P+    P    +P + Q    ++K    D +LG
Sbjct: 1000 QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPV---RIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSS-LVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT--PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQA--PLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRL---RILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGE------GRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSY----EIPAGVANDLFHVDWQRGIITTRGQ-FDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVA----SDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQ-----PKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLG 2087          

HSP 6 Score: 143.28 bits (360), Expect = 5.728e-33
Identity = 115/394 (29.19%), Postives = 190/394 (48.22%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELD-FVEIDSQSGRLFTNKLVDVVEQEF-IFFITAEDHGIPRLNSSVKVYVKI----NPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI-DHQQMVTYRISKCTQKGA---FSINQHTGIIHLI---NRLDREAIAFHVLTIVATDNSSTKGSEYL-AVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD 4286
            YS  + A++         + V I +QD NDN PIF+   YF ++  +    T++ +V+A D D+  NG V Y+I +   + +    ID ++G ++ NK +D   +E     + A+DHG   L ++  V +++    +  P     F        ISE  +  E + ++ + D      Y     T  G    F++      I+L+     LDRE ++ + L++VATD    KG+  L A  ++++ I DVNDN P F+ D  +  ++ E    GT +    A+D D+GLN  + Y L  T       F+ID  +G +     +D E +P     + A D G P L S  +V VTI ++ND +P F+ +S     V +N  +G  + +V A DPD
Sbjct:  252 YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATD----KGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVM-EVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFD-QSFYNVSVAENEPVGRCILKVSASDPD 639          

HSP 7 Score: 139.813 bits (351), Expect = 5.737e-32
Identity = 154/546 (28.21%), Postives = 234/546 (42.86%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFGFS--------------YEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENI-----ALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRP--LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVG-STDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIY------------SITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            F  S YN  V+EN+P    VG+ ++K   S               E F     F +   +G I  +  +D E  +S    +     T  G    T  IK+++ D NDN P+FYP + +  + E+      A  T I    ATD D   FG   +Y+I +GNE   F +     +  G++   VVRP  L   T+  + L IS  D G         V + + D     P+F  ++Y   + E    G  V  V A+  D      V Y         +  FSI+  SG+IR+ +P   H  +    L ++A   G P +  +  V + V  +N   P+F  + V  S  ++A  E+G     PL   H  D D      +  S++  + + +FA++   G++ IL Q   +   + Q +T+ V A D G PS  T + +L+ +   N   PVF     SV V  + SIN+ I    A+DLD G N +I Y            SI+  D    F I  +SG I L  PL     D+ +L ++A D G
Sbjct:  611 FDQSFYNVSVAENEP----VGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVL---ATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFG-QVSYRIVAGNEAGIFRID----RSTGEIF--VVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP--DGYFSIETNSGNIRIAKPLD-HEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESA--ELG----APLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHL-ILSQ--HLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNG 1129          

HSP 8 Score: 139.043 bits (349), Expect = 1.031e-31
Identity = 216/959 (22.52%), Postives = 400/959 (41.71%), Query Frame = 3
Query: 3366 IEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQT----FFQNISEDMKITEKIFK-LEIDHQQMVTYRISKCTQKGAFSINQHT---GIIHLINR----LDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNK---ESRLEFIVQQNVAIGTTVGRVYAQDPDTN-EVLYYLQSVHPPDHPFVINPISG---ILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKI---IINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVL-NIGDPHNLNFQKNDYFFQIPECKTTP-GLKLFRLQALYPGNPISDL-EYYIFDIYCGISERIKLPNTMIRLDKETGWISV-GNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETF---IFHAPENTTYGQKIYVGTVQAHDKDLDS----TLEYIWINEIPEFSLDKTSG-IVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPL 6104
            + +  VE D   ID  +G + T   +D  E    + + A    IP    +++V V +     +   F + +    F +N   ++K T    + L+++      Y I       AF ++ H    G+++L  +    LDRE    + L I A D  +     ++ V    + I DVNDN PIF N +     + E+  VGT +    A+D D   NG V Y +     +   +F+ID  +GA+Y+N+ +D+E K     ++ A D G   L +   V++ +T++ND +P  N           + ++   G  V R+   DPD+  E      +++  D  F +        ++ V  P+ +E+  ++ L V+A D      +  +S+ + I   +DN  E +   Y A ++  +      +  L A    + LNS   Y L  +         I+  TG +   S    E   +    +++    R   +    ST  VL  I D ++     +  F+ +   +  P G  + ++ A  P   ++ +  Y I + +  ++E          +   +G I + G +  +R     S     V+  DRG   +      + + + D NDNRPVF    +   +  +P+ ++      +  V A D D  +    +   +  NE   F +D+++G I       L        +  I  +DG    +    ++     D       F   RY++++ E  P  TV+G V   +        +++ I S      FS+  + G I     +D+E  +  +L I AT      L  P +    T V + + D+NDN P F+ + + +S+PE   + + +    A D D   S  + + ++  +   L  ++  +G +  +  LDYE ++RH L V+ TDG        + +L+++ +VND  P+
Sbjct:  114 VAEAGVETDLA-IDRATGEIRTKVKLDR-ETRASYSLVA----IPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVN---ITIQDVNDNQPIF-NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVL-AHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVA----RDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE--------FEVRSASGEICIAGELDFERR----SSYEFPVLATDRGGLST---TAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT------LGEPPVYG-HTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPV 1035          

HSP 9 Score: 124.02 bits (310), Expect = 3.582e-27
Identity = 142/547 (25.96%), Postives = 247/547 (45.16%), Query Frame = 3
Query: 8040 NILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSL---QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLEIGMLIT--VTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVAL---NWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQ---YPIAVLYTSQEGSRVANIAVNHDNLYG---EITFFIISG--NGSSYFSIGSKNGQISTSRNVNSAILG-QWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            NI+S N N     + H +     LY + + +        +DRE      + +   DG    +     + I + D+NDN PIF  + +   V ENA +G+ ++ +   D D+    L ++++   Q ++   F I+P+ G++++ + +D E K  +E+ V   D G   LE    ++  VTD NDN+P I+   ++       SE A    FV  I+  D  DS++  + +  +L+  +        F L     S+ +  V L     I  N T+ V+  A+D+G PPL  S ++ FL IT   ++      F+   Y   V+  +  G+ V  + + HD   G    +T+ +       + +F I  + G I+T  +++         +++ +  G   LSS +      T+ + I D N   P    S   VS++E   VG  +L+V   DPD G+  +V  TI    +    L  F     S ++ +   LD+E +  Y   +LA D G    S T+++ +++ D +DN P F  R +  SLRE
Sbjct:  212 NIVSGNVNDAFRLSSH-RERDGVLYLDLQISGF------LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDP-DSKTEYANVNVTLNGGDGH------FALTTRDNSIYLVIVHLPLDREIVSNYTLSVV--ATDKGTPPLHASKSI-FLRIT---DVNDNPPEFEQDLYHANVMEVADPGTSVLQV-LAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTA------TVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI---GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRE 726          

HSP 10 Score: 123.635 bits (309), Expect = 5.136e-27
Identity = 151/590 (25.59%), Postives = 245/590 (41.53%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFG---------FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTL-EGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFG-VSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKK----------TRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY---IEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVH----ILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQS-VTVYRNASINSFIANFFATDLDAGLNGKIIYSITKG---DYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHARIKSTCPTQFILDDSNLLHSFSHI 1823
            F  ++YN+ V E+ P  T+VG V+   G         +S      +G F++   +G I  +  +D E+ +  L+ I   + TL E        + + + D NDN P F  + +   + E+  L   +    A D D+   G V+ +   ESG     FA+        G L+L   + LD E+ +++ L ++  D G P L   L + + V+D NDN PVF   +Y+V ++ES     ++++V ASD D+G N  + Y+             + S +   F I   SG I L  P      +    L V A D+G+P+  A   V V V+  N   PKF+        K+ Y   IE        + +V   D D      I  S++  N    F +    G +     + R+++ +       Y + V A D G P +   V + I ++  N   P   +  +  V+V       + +    A D D G N  I YSI KG   D    F+I+  SG+I     L   +    +L + A D G    ET   L + +L  +       S+     + +D+ L H    I
Sbjct:  827 FEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNI---QATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGK--GLFAIDA----RSGHLILS--QHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRE-TRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ--------KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS--FQVHPVTGEISTREPLDRELREL-------YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSI 1387          

HSP 11 Score: 121.709 bits (304), Expect = 2.029e-26
Identity = 145/615 (23.58%), Postives = 256/615 (41.63%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADGSGGIIESCPG----IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDG----INVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQ---YPIAVLYTSQEGSRVAN-IAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQI-----------------------------------------STSRNVNSAILGQWFSLI------VQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNF--VASLRELDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILD 9809
            +P+DRE ++   + +  +D   G  +S  G     I V D NDN+P F L+ + G V E+A +G+ ++ I  +DAD  +   L +SL  E    F+I+ Q+G +     +DREL++ Y   V  +DG    +    + + I V D NDNRP   +      ++            ++ + A DAD     N++I YSL++EN  +  K  F +N  +G+L+      +     + + + + A D+G PP      +  L   A     +L+  FQ   Y + +   S  G+R+   +A+  D    ++ F   +GN     S+ S +G+I                                         + S     A+    F+L       ++       +   F +    + + + D N  SP+    +   ++SE    G+ + QV   D DAG    ++  I+    D  + V  P      +  +V  LD EI+  Y L ++A D G P+ + T+ + ++++D +DN P F   N   V+   EL  +I      D D+       P+ T +    S V +     N ++  L R + + V+   LD
Sbjct: 1907 RPLDREQHSRYTLQIQASDR--GQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER----YPYIGQVPALIQPGQTLLKVQALDAD--LGANAEIVYSLNAENSAVSAK--FRINPSTGALSASQSLAS--ESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLR--FQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN-AFVIEPAFSGIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTY------PALTYRLGAESTVDI----ENMSIFALDRYSGKLVLKRRLD 2494          

HSP 12 Score: 114.775 bits (286), Expect = 2.466e-24
Identity = 132/493 (26.77%), Postives = 201/493 (40.77%), Query Frame = 3
Query:  252 HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKV--RIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFR-----INYVGSTD--------KAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            ++ G+F +++ TG I      D  S+ +  + +     T  G         V   IID    PPIF   +    + E+I   T +    A   D         Y I SG+ D  F++        G +  R+ +PLD E K +  L I     G+PP+ G  +V I VED NDN+P F  S   + + ES   G  +   +A D DSG + +V Y   K     +  F+ID +SG + L+Q      +Q   TL+V A D G PSLS    + V V  +N   P F      +N   S           A+ ++ G   R    IV    D+      +  SI   +    F +    G +++      +       Y +TV A DNG P+      +++R+  AN   P F+       +  N    S +    A+DLD G N  I YS+        F +   +G I+  +PL     +   L + ARD G
Sbjct:  763 NEAGIFRIDRSTGEIFVVRP-DMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVR-YSIYSGDPDGYFSIE----TNSGNI--RIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGLFAIDARSGHLILSQHLDYESSQ-RHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDN------VTNSISSSDVSQHFGIFPNSGWIYLR---APLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP--INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQG 1232          

HSP 13 Score: 112.464 bits (280), Expect = 1.181e-23
Identity = 126/502 (25.10%), Postives = 213/502 (42.43%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKI-----ESGNEDDRFALSGVGVQYR-------GQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDEN---IFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGL----------NGKIIYS---ITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARD 1679
            +GLF ++  +G ++ S  +D ES     + +      +       ++I V + D NDNPP+F  ++    + E+ ++   I    A+D DT      NN +I     ++G ++   ++S   V          G + LR   PLDRET+++Y+LT+   D G P       V + V D NDN P F  SKY  R+ E+   G  V  V ASD D G N  + Y      S     F +   +G I   +P    + +    LVVEA D G+P  SA   V +HV  +N   P+         +    +   +     +  V   D D      I  SI+ G D +   +F+++ T G   ++R    + +     Y + V A D GNP ++T   + + +   N   P F +      V  +A++   + +    +  A +          + ++ Y+   +TK      F I++ SG + + + L      + +LEI A D
Sbjct:  976 KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVP-SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDT-----GNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRA--PLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS----SFQVHPVTGEISTREPLDRELREL-YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI----ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSG---VIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALD 1457          

HSP 14 Score: 112.079 bits (279), Expect = 1.707e-23
Identity = 261/1209 (21.59%), Postives = 469/1209 (38.79%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKND----KEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFT-NKLVDVVEQEFIFFITAEDHGIPRLNSS-VKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLE-----IDHQQMVTYRISK--CTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPI--FKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQP--VDYEL--KPKWNFIITAFDLGY------------------------------------------------PALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPI-SGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKI------IINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVL-------NIGDPHNLNFQKNDYFFQIPECKTTPG--------LKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVS------DGTFTSTXXXXXXXXXXXXQCHNF----THDRYHFHIHETAPIHTVIGQVTL--KNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQD-NHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDL--LLFEI-LSPNDD---LLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLINVNDETPLIHN-------PTTVYLPK---INQNHNIMIKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKV---------SFNPGLLYANSINVSL--SCSDTIHNTIKNVSLI 6362
            R+Q+S   L +  +D    K +     + IFV+D NDN+P F    Y  S+       T++ ++ A+D D G+N  + YS+     +  F  ID QSG + T  KL   ++  + F + A D G   + S+ V V + +     ++  F++  +   +   ++  + + K++     +     + Y ++         F IN  TG +     L  E+     L +VA D  +   S  L +  L +   +    +P+  F+N+     +L E++  GT L         DG   +V++   A   + I    +D+ SG + +N+P  +DY+    P  + +     L Y                                                P L S   + + + + ND  P+F+++  +  + + N   GT V +V+A D D  +N  L Y       D+ FVI P  SGI+  +  + +E+   + L ++A D          +++V I   N+++        + + +++     I ++ A  N  +      Y L   S   I       ++RY+G + L      E           L+ + SD     H  + VL       N   P  L  Q   YF  +P               L +    A   GN  S + Y I     G S           +    G +SV    L   +       V ++  D GK   +   T + +   D    R  F    +     E    G  +    +Q     LD +L  I  NE   F L ++  IV     PLD E    +  ++ +S        +  ++++ I +I    D   NF       +Y   I E AP+   I Q+     +    PN  + +DI S   +H+F+++   G++     +DY+     Y L+I A D   Q               + + D NDN P F  T     + E+ P+ S + +  ASD DK     L + I  +P+D+    +  V+  +G++++A + DYE+ +R+ + +  +D G  + +V V + + + ++ TP           P  V LP+   + Q     +  +D D+ GP    +   S    +  V+R +G V             G LY +  ++SL  S S   HN++ +++++
Sbjct: 1911 REQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-ETQWQFA-IDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS-LGLIELLIG--EAPQGTPVLRFQNETYR-VMLKENSPSGTRL-LQVVALRSDGRRQKVQFSFGAGNEDGI--LSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNK-GTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISA--NDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ-----EYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNN-SKVIYIIEPAQEGFS-----------VHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALK-SSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV----LQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVK--PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSL-----QPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQ-----VTATDSDS-GPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVV 3069          

HSP 15 Score: 112.079 bits (279), Expect = 1.722e-23
Identity = 144/563 (25.58%), Postives = 258/563 (45.83%), Query Frame = 3
Query: 8028 SVSNNILSCNGN----SKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADS-KLFPLKFSLQGEENNA-FSINPQNGSVFLAQTVDRELKSKYEMKVAVSDG-INVLE--IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRY------------SLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVD---VIITASDRGQPPLFHSITVHFLFITA-ECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGE---ITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQA--CGTKILSSVSFCSKRETITLVISDFNLYSPQIR-ISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTD-DRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +V  ++++ +G+    S V ++++      Y      +  IR A KP+D E  + + +++    G   +       I+V D+NDN+P F  +     V E+A +G+ +      D DS     + +SL  E     F+I+ ++G + L+Q +D E   ++ + V  +DG +  L   + +L+ V D NDN P   K+     + +N SE    N  ++ + A+D D    NN++I Y            S+SS +    V   F +  +SG + ++A       D ET D   + + A+D G P       V    + A + + +  KS +++ I      + GS V  +  +  +L GE   I + ++  N S  F +    G+IST   ++   L + + L+V+A   GT + S+      R  + + +SD N  +P+I    E  VS+ E    G+ +++V  +D D G    +  +I+   D D   L          + +VV  LD+E +  Y L + A D G P +    ++ ++VLD +DN P F S + V  +RE
Sbjct:  844 TVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIA-KPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKD----EYSVNVSESRSINAQIIQVNASDLD--TGNNARITYRIVDAGVDNVTNSISSSD----VSQHFGIFPNSGWIYLRAPL-----DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIE--ENLRRGSVVGVVTASDLDL-GENAAIRYSLLPINSS--FQVHPVTGEISTREPLDRE-LRELYDLVVEARDQGTPVRSA------RVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVRE 1376          

HSP 16 Score: 109.768 bits (273), Expect = 8.110e-23
Identity = 146/563 (25.93%), Postives = 233/563 (41.39%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIK-------FGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIF--LYKKTLEGQFLETISIKVRI--IDENDNPP-IFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSG-VNQEVEYQFKK----------TRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFD---HGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLA-IVH---CQDDDQDPRDLIAVSII------GGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAID---NGNPSKQTTVDMLIRINKANIYFPVF------RNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLD-----KIKLEIIARDAG 1685
            KF  S+Y FR+ EN    ++VG V              Y        F ++ +TG I T   +DRE     L E++  + +   +G  + +  + VRI   D NDN P I  P +    + E     T++    A D D  +   S  Y I  G + D   L  +     G +  RVV  LD E +  Y+L ++  D G PP + V  + + V D NDN P F+ S    R+ E    G  V  +   +  +  V   VE  F+           T+ ++E  F IDR SG++ + +     + Q +  L + A D     +P  SA   V + V  +N   P++  + +        +++ + T  P+  I+H     D D      +   +I        + E   +L R       L     +    +Q Y + V+A+D   N     QT+V + +RI  AN + P F        +  S+ +     I   +A+  A D D+G NG++ Y IT G+   RF I   +G+I L+K L     D     +  L I A+D G
Sbjct: 1152 KFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRE-----LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQ-NASITYSIVKGRDSDGHGLFSID-PTSGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREV-QSEFRLEIRALDTTASNNPQSSAIT-VKIEVADVNDNAPEWPQDPID-------LQVSEAT--PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHG 1694          

HSP 17 Score: 107.842 bits (268), Expect = 2.687e-22
Identity = 114/437 (26.09%), Postives = 178/437 (40.73%), Query Frame = 3
Query:  396 SIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRP-LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINS----FFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILR------QIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIA 1673
            SI +RI D NDNPP F  +     ++E     T +    A D D +    +  Y +    E           Q   Q  L   R  +D ET+   +LT+   D G PPL     V + + D NDN P+F  S Y V + E+   G  ++KV ASD D GVN  V Y   +    L  EF +   SG I +         +      V A D G   LS    + + +  +N     F+P+     +  + KA+     + +  P+  V   D D      ++  I+ GN+  IF ++R+ G + ++R      + + +H +N       + A D GN        + + I  A    P+F     +  V  +    + + +  A   D      + YSI  GD    F+IE +SG I + KPL      ++ L I A
Sbjct:  489 SIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRD-EGLNSALTYSLAETPE-----THAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHL-TEFEVRSASGEICIAGELDFE-RRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKAS----SQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLN-------ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQA 904          

HSP 18 Score: 105.916 bits (263), Expect = 1.098e-21
Identity = 130/504 (25.79%), Postives = 208/504 (41.27%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN--NYKIESGNEDDRFALSGVGVQYRGQLLLR-------VVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNES-----NLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE---FSIDRKSGSIRLTQPTSCHI-NQGDCTLVVEAFDHGSPSLSAYCYVTVHVI---RINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILR----QIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLET 1703
            F ++  TG+I T + ID E+     + +      +      T ++ V I D NDN PIF  +     + EN  +   I   +A+D D    GV+   NY I            G G ++  +  +R       +   LD E +  Y+  +   D+G   L     +++ + D NDN PVF P +Y V L ES           +V V A+D D G   +V Y     R V  NE   F IDR +G I + +P    +  Q    L + A D G+   +A   V + +I   +    F K R NY    D      +G V      + H        R  +  SI  G+ +  F++E   GN+ I +    + K+   +N+Q+          G P       + I +   N   P F      ++V  +A + + +    A D D+G +G++ YS+ K   +  FAI+  SG + L + L +    +  L + A D G+ SL T
Sbjct:  554 FQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDC---GVNAMVNYTI------------GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSY-----RIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAH--------RSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL--------GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLST 1018          

HSP 19 Score: 105.531 bits (262), Expect = 1.447e-21
Identity = 117/482 (24.27%), Postives = 212/482 (43.98%), Query Frame = 3
Query:  261 GLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISI-KVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDR--FALSGVGV----------QYRGQLLLRVVRPLDRETKEKYKLTISVED--KGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEY-------QFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGS---PSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRD--LIAVSIIGGNDENIFALERTHGNVHILRQI-KAIHNINLQS-YTITVRAIDNGNPS-KQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLIT 1616
            GLF+++  +GVI T  ++D E  +  +  + +          ET+ + +V ++D NDN P F  + L  R+ E+ AL   +   +  +   D   V  N  +E   ED R  + L+ +            ++ G L+  V R LDRE + +++L I   D      P    + V+I V D NDN+P +      ++++E+   G  +    A+DAD+G N +++Y       Q  +++    + F +D  +G++ L  P      Q +  L+V+A D  S     L     V + ++  N   P F ++   S  K A + I   TR    + H    D+D  D   +   I GGN E  F +    G + +++ +  A  ++     + + + A D+G P  K++++++ + +  ++   P F       T+  N    SF+    A  L    N  + Y I  G   D F ++   G+IT
Sbjct: 1306 GLFSIDPTSGVIRTRVVLDHEERS--IYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPAD---VVRN-SVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLV--VARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQ-EYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF-VSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIIT 1777          

HSP 20 Score: 103.605 bits (257), Expect = 5.574e-21
Identity = 126/540 (23.33%), Postives = 222/540 (41.11%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDD-RFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLK-GVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHI------------------LRQIKAIH----------------NINLQSYTITVRAIDNGNPSKQTTV---------------DMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKD-SGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL 1730
            F+++  +G  L++  +DRE  +   ++I    +          +I + + D+NDN P F  +K    + E+  L T +   +A D+D    GV+        NE   +FA+ G         L+  V  LDRE +  Y   +   D G+  ++   + V+I V D NDN P+F    Y  ++     PG  ++KV A DAD G N E+ Y      S +  +F I+  +G++  +Q  +    +    L V A D G+P  S+   + + +       P  R  +   T +    E      + L +V  + D +  R  +  S   GN++ I +L+   G + +                  L + +A+H                  + ++ T +  A+ N  P++   V               +++I +   N   P F  +    TV    +  +F+A   A D DAG N ++ Y I  G++ + F IE   SG++     L     D  KL+IIA D G+  +  T  + + I+
Sbjct: 1895 FSIDSSSGE-LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD---LGVNARLVYSLANETQWQFAIDGQ------SGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKL-LHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLR--FQNETYRVMLKENSPSGTRLLQVVALRSDGR--RQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIV 2419          

HSP 21 Score: 100.908 bits (250), Expect = 3.157e-20
Identity = 121/509 (23.77%), Postives = 218/509 (42.83%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDL--IEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFY-PN----KLERRIIENIALLTDI-SLTAATDSDTDEFGVSNNYKIESGNEDDRFAL-SGVGVQYRGQLLLRVVRPL--DRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKK-----------TRSVLENEFSIDRKSGSI-----------RLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNP-SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            LF ++ LTG +     +D E++   L  ++       +  +   ++++++RI+D ND+ P F  PN    K     I +   + ++ +   A D D+ + G    Y+I  GN + RF + S  G+      L++ + P   D E   ++ L I  +D GQP P K  L + +IV+  ++N P F  + Y   + E+   G  V++V A       N  + Y+               R ++      DR+S +            R +  +S  + +   +  +    +G     A  Y+TV  +  NS  P+FR             E G +       V   D D+ P   +  SI GGN  N F+++ + G +      +  H+     YT+ ++A D G P S+Q   ++ I +   N   P F+    + +V  +A + + +    A D D G+N +++YS+   + + +FAI+  SGLIT +  L           ++A D G
Sbjct: 1541 LFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNG-QLTYEITGGNGEGRFRINSQTGIIE----LVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNS--PEFRPGSCYGLSVPENSEPGVIH-----TVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHS----RYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-ETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 22 Score: 95.9005 bits (237), Expect = 1.312e-18
Identity = 149/633 (23.54%), Postives = 273/633 (43.13%), Query Frame = 3
Query: 8154 PVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDG---INVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVI---ITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGS------------RVANIAVNH-----DNLYGEITFFIISGNG-SSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTII-------TSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLG--FPRKSQTSI-VLIKVLDEDDNSPYFISRN---------FVASLRELDQLIVLPEVRDEDS---------IMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILDVFGASQENYPKRLPLGRYSRLMIYLIL 9890
            P+DRE  +  +++V+  D G+         I++V+D NDN P F  + +   + EN   GS +  +   D D  +   +++SL    N++F ++P  G +   + +DREL+  Y++ V   D    +    + + I V+D NDN P+I+     +  V++  E       VV + A D D  Q  N+ I YS+  + +      LF ++  SG +  + V      D+E   +    + ASD G PP     TV  L +    +L   + TF     V    ++ +            R A++  N      ++L    T   ++ +   + F I   +G +  +R ++  +  + F L ++A  T   +S +  S   T+ + ++D N  +P+       + +SE   VG+ +      D D G  G ++  +I        S +   SL  F  +  +  L +  PLD+E   +Y L + A D       + QTS+ V +++LD +D++P+F+S N         F++    + +++      DEDS         I     E  + + S+T   ++L +S    T  + K        NLI+   GA     P+     + S L ++LI+
Sbjct: 1110 PLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL-PINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP---QEDVVSVREEQPPGTEVVRVRAVDRDHGQ--NASITYSIV-KGRDSDGHGLFSIDPTSGVIRTRVVL-----DHEERSIYRLGVAASDGGNPP---RETVRMLRVEV-LDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSE-FRLEIRALDTT--ASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSL--FRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQT-GIIELVKSLPPATEDVEKGGR----FNLII---GAKDHGQPEP----KKSSLNLHLIV 1709          

HSP 23 Score: 91.6633 bits (226), Expect = 2.065e-17
Identity = 117/437 (26.77%), Postives = 194/437 (44.39%), Query Frame = 3
Query: 5010 WISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTK-VFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEYIWINEIPE-----FSLDKTSGIVTT-SGVPLDHEAVAYFIGKIQVSDG---TFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHL--FSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSE-----IIQLIASDADKSDL--LLFEILSPNDDLLMTVNPITGVI--STAGILDYEKTERHALTVSCTDGLH---RVTVEVLINLINVNDETPLIHNPTTVY-----LPKINQNHNIMIKCSDQDNLGPLSYDIMTSSKD 6227
            ++ + ++ LDREI+  S  T+ VV  D+G     +  +K +FL I D NDN P F  E  ++HA           V  V AHD+D  L+S L Y  + E PE     F +D  +G++TT S +  + E V      +   DG     +STA +++ I D ND    F    Y+  + E  P+   I +V+  +     N ++ + I  E  KHL  F V    G I   GE+D+E+ + Y   + ATD    S         T  + + + D+NDN PVF      VS+ E    +S+     I+ ++A+D D  +   + + I++ N+  +  ++  TG I      +L       H L +S TDG +        V +++I+     P+       Y     +P+     +++    D  +  P+ Y I +   D
Sbjct:  454 YLVIVHLPLDREIV--SNYTLSVVATDKGT--PPLHASKSIFLRITDVNDNPPEF--EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTY-SLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLT--VVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI-GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLS--------TTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPD 872          

HSP 24 Score: 91.6633 bits (226), Expect = 2.245e-17
Identity = 111/443 (25.06%), Postives = 195/443 (44.02%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDS---QSGRLFTN-KLVDVVEQE----FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISK--CTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTN-LYVNIIDVNDNSP----IFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYL---NQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHP--FVINPISGILSVSNPI 4385
            R  YS   + ++  +      + V++ V+D NDN+P F   S       +T        + A D D        Y+I    V  D   + S   + G L+ + ++   +++E    +   I A D G P L   + V + I     ++  F++  +F  + E+  +   + ++     + D   +V Y I++    ++  F I+  TG I++   LD E    H L +VA D+    G + L  T  + + + DVNDN P    IF +D  +  I SES + G  +   + +D D          +T  G +    F + T   ++YL   + P+D E+   +   + A D G P LH++ S+ + IT++ND  P F ++      V +    GT+V +V A D D   N  L Y  +  P  H   F I+P +G+++  + I
Sbjct:  143 RASYSLVAIPLSGRN------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVN-DAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDH----GEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKI-SESAQPGEFVARISVHDPDSKTE-YANVNVTLNGGDGH--FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQD-LYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI 569          

HSP 25 Score: 91.2781 bits (225), Expect = 2.588e-17
Identity = 105/395 (26.58%), Postives = 171/395 (43.29%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQS-YFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPR-----LNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEY---LAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKP--RFNKESRLEFIVQQNVAIGTTVGRVYA 4274
            RKQ S   +    N +       + I V D NDNSP F   S Y  S+  +++P   I  V A D D G N  + YSI    +   F  IDS SG L    L       +   I A D G P+      N ++ V  + + +P+    F    +  ++ ED  +   + ++     ++     + Y ++  TQ   F+I+  +G+I  + +LDRE  A +   ++ATD     G  Y    A   + +N++D+NDN PIF+       + +   + G  L    A D D G N ++ Y L A      + F+I+  +GAL  +Q +  E     +  + A D G P   S   + + I       P  RF  E+    ++++N   GT + +V A
Sbjct: 1811 RKQRSSDSIGDTSNGQHFDVAT-IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKF-SIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPR----FKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQW-QFAIDGQSGLITTVGKLDRELQASYNFMVLATD-----GGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPA-LIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNET-YRVMLKENSPSGTRLLQVVA 2190          

HSP 26 Score: 84.7297 bits (208), Expect = 3.170e-15
Identity = 146/641 (22.78%), Postives = 288/641 (44.93%), Query Frame = 3
Query: 7791 YQTFFSINRESGQISLN-------EPLPQLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSE---ISVSNNILSCNGNSKVSFTLHPKWSQ-DYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSW-----IIDIGVIDADSKLF-PLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSK--YEMKVAVSDGINV---LEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFI-----TAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHD---NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAG----------LAGIVKLT-IITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            +  +F I+ ++G I+         EP+PQL  V        L    + ++   D + +  ++D         ++  SV EN       + VS +   C  N+ V++T+   +         + + EI  A + +D E  ++ E  V+  D  GG+  +    +++ D+NDN P+F    +   + E+    S      I+ +   D D   F  + + +  G E   F I+   G +F+ +     ++++  + + ++ +DG N+    +  + +++ D+   RP I ++     +V    +   G + V ++ A   D   ++ S +RYS+ S +        F +  +SG++ I A  L+  + ++ + + I A+  G+PP++    V+           E E  +++      I+V  +++ G+ +   A  HD      G++T+ ++  +G   F+I +++G +  S++++     Q  +LIV A    + S     S   TI + + D N   P     E +V++SE   + + ++QV+  D D G           AG+  +T  I+S+D       FP +G  Y   +  PLD E + +Y LT+LA D G P     + V+++VLD +DN P F
Sbjct:  550 HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFD-------QSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGE-LDFERRSSYEFPVLATD-RGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAM-QRPPIFEKARYNYYV--KEDIPRGTV-VGSVIAASGD--VAHRSPVRYSIYSGDP----DGYFSIETNSGNIRI-AKPLDHEAKSQVL-LNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVR------ISVPESAELGAPLY-AAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYES-SQRHTLIVTATDGGVPS----LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIY---LRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKF 1153          

HSP 27 Score: 82.0333 bits (201), Expect = 1.637e-14
Identity = 138/546 (25.27%), Postives = 225/546 (41.21%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIE------IFLYKKTLEGQFLETISIKVRII--DENDNPPIFYPNKLERRIIENIA------LLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALS---GVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKG-QPPLKG----------------------VLEVEIIVEDYNDNSPVFSP-SKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHIL----RQIKAIHNINLQSYTITVRAIDNGN-PSKQTTVDMLIRINKANIYFPVFRNRYQSV-TVYRNASINSFIANFFATDLDAGLNGKIIYSITKGD--YRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQ 1742
            EG F +N  TG+I    ++     A++ +E      + +  K       +  S+ + +I    ++NPP F        I+EN+        +T  SL  A +++        +Y+I +G  +D F +    G+ +  RGQ         DRE++  Y L + V D   Q  L                        V  + I V D NDNSP F P S Y + + E++ PG  +  V ASD D G N ++ Y    T   L N+FSID  SG +   +P          TL ++A D G P S   +C +T+ V   N   P+F+++ Y GS  + A +    V       +   D D      +  S+     +  FA++   G +  +    R+++A       SY   V A D G    +  TV + I +   N   P+F  RY  +  V         +    A D D G N +I+YS+   +     +F I   +G ++  + L       + LE++ARD G     + G ++L I ++ Q
Sbjct: 1653 EGRFRINSQTGII---ELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANL-------SYEIPAGVANDLFHVDWQRGI-ITTRGQF--------DRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSI--TGGNLGNKFSIDSSSGELS-ARPLDRE-QHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQ------ISAVDADLGVNARLVYSL-ANETQWQFAIDGQSGLITTVGKLDRELQA-------SYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFE-RYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQ 2159          

HSP 28 Score: 76.6406 bits (187), Expect = 8.386e-13
Identity = 93/353 (26.35%), Postives = 162/353 (45.89%), Query Frame = 3
Query:  711 PPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRK-SGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPR---DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSV---------TVYRNASINSFIANFFATDLDA-GLNGKIIYSITKGDYRDRFAIEKDSGLITL----LKPLWFVKLDKIKLEIIARDAGINSLETTGYL 1715
            P L    E+ I +ED NDNSP FS  ++   ++E N  G  V +V+A D+D+G N  + Y         +N F I+   SG +R        I +    L + A D G P ++    + V ++ +N   P F  N + +  +A   E+G V    +  +   D D  P     L A S +   + +IFAL+R  G + + R++   + +  Q Y + V A D  + ++     + +R+N  N   PVF  +              +  + S++  +    ATD D+ G N K+IY I     ++ F++   +G++++    L+P      D   + IIA+DAG  +L+++  L
Sbjct: 2300 PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH--DNAFVIEPAFSGIVRTNIVLDREI-RDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEAT--ELGAV----ITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLD--YELQ-QEYELDVIASDAAHEARTV---LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA--QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYF-VRIIAKDAGKPALKSSTLL 2634          

HSP 29 Score: 74.7146 bits (182), Expect = 2.970e-12
Identity = 128/577 (22.18%), Postives = 243/577 (42.11%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMG------FVSENALIGSWIIDIGVIDADSKL-FPLKFSLQGEENNA-FSINPQNGSVFLAQ-----TVDRELKSKYEMKVAVSDG----INVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQ----------------------IRYSLSSENQRIPVKSLFLLNEDSGS-LTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHD-NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLG-FPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL-IVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQ-SKTNFTLKILKRSTNESVINLILDVFGASQENYPK 9842
            ++++D ND++P F      G      F+S+   IG  +  I  +D DS     L + + G      F IN Q G + L +     T D E   ++ + +   D          + + + V  S++N P+  + +   T + N    +    FV+ +TA     +++ N                         R     E+Q   V  +++ + +  S L+  AV     SD+      I  +  GQ   F   T++             +    Y ++V   S+ G     +A + D     ++ + I  GN  + FSI S +G++S +R ++     ++   I  +   +  S    C+    IT+ + D N  +P+ ++S+ T S+ E   +G++++Q+  +D D G+   +  ++   T  +F++     +G S  +  V  LD E+Q  Y+  +LA D G +  +S T  V I VLD +DN P F    ++  +  L Q    L +V+  D+ + +  E  Y+L ++ S+    F+ + +   L   +   +ES   L L+V    + N P+
Sbjct: 1590 LRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGS----FVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDS------IGDTSNGQ--HFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCN----ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAI-----DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ 2144          

HSP 30 Score: 74.3294 bits (181), Expect = 3.425e-12
Identity = 112/457 (24.51%), Postives = 197/457 (43.11%), Query Frame = 3
Query:  342 IEIFLYKKTLEGQFLETIS-IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSV-LENE--FSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINS-------FFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHG--NVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVF-RNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEII 1670
            I + L  +T +  FL + + + + + DENDN P F   +    + E     T ++   A DSD         Y I  GN D+ F +      + G +   +V  LDRE ++ YKL I   D+G P + G   + + + D NDN P F P+   V ++E+   G  +  + A+D D+     + Y+     +V +EN   F++DR SG + L +     + Q +  L V A D      +A+   TV  +R+N        F  +    Y       + I         L  V+  D D +  +   + II    E  F++  ++G  +V++ R   A+ +     Y + + A D G P+ +++  + ++ N        F +N+Y++  +   A + S +       LD  L      +I  G+    F + + S  I L+KPL   + D  KL ++
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGS-NARLRYHIVDGNHDNAFVIEPA---FSGIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ-EYELDVIASD------AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-FSVHPSNGVVSVNMSRLQPAVSSSG--DYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRA-QISEAAPLGSVVLQLGQDALDQSL------AIIAGNEESAFELLQ-SKAIVLVKPLDRERNDLYKLRLV 2717          

HSP 31 Score: 72.7886 bits (177), Expect = 1.183e-11
Identity = 84/319 (26.33%), Postives = 145/319 (45.45%), Query Frame = 3
Query: 7962 VCKCTNHGYFTGSVEE-NSDSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP-LKFSLQGE-----ENNA-FSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVI-----NTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALN-WISDNETVDVIITASDRGQPPL 8873
            V +  N G F   V   +SD+  +        +GN   +F + P +S         TN +      +DRE+ +  ++ +I  D G   +  +    ++++D+NDN P F  N  +  VSE   +G+ I  I   D D+  +P L + L  E     EN + F+++  +G + L + +D EL+ +YE+ V  SD  +     + + V D NDN P    +     F I       SE    +  ++ + ATDA DS+ NNS++ Y +       P +  F ++  +G +++    L   +S +    V I A D G+P L
Sbjct: 2331 VSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSG-----IVRTNIV------LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDA-DSEGNNSKVIYIIE------PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPAL 2628          

HSP 32 Score: 71.633 bits (174), Expect = 2.874e-11
Identity = 124/491 (25.25%), Postives = 204/491 (41.55%), Query Frame = 3
Query: 8331 SWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLN---EDSGSLTIKAVALNWISDNETV---DVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLYGEITFFIISGNGS---SYFSIGSKNGQISTSRNVNSAILGQWFSLIVQA--CGTKILSSVSFCSKRETITLVISDFNLYSPQIRI----SETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVN-PLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQ-----LIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQ 9737
             +I D G ID+     P     +       +I+   G +     +DRE ++ Y +      G N   I +L+TV D NDN P   +  ++  F  NT       +    + A D D  +  N+Q RY++ S N    V   F L+   E  G L +  + ++   D ET     ++I A D G PPL   +TV+           I   + +Y   V   +  G+ V  + A + D     +  + I+   S     F I  + G I  ++ ++     +   L+V A   G + L + +F S R      ++D N   P I +     + +  ISE  + G  + ++ V DPD+          +   D  F+L    T  NS  L +V+ PLD EI   Y+L+++A D G P    +  + +++ D +DN P F    + A++ E+       L VL   RDE    A     +Y+L     +  Q FQ
Sbjct:   97 GYIGDFGGIDSGP---PYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN---IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL----LPARDLD-LEPYNTQ-RYNIVSGN----VNDAFRLSSHRERDGVLYLD-LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQS-RYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPLETTAFVSIR------VTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALT---TRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSAL----TYSLAETPETHAQWFQ 555          

HSP 33 Score: 69.707 bits (169), Expect = 9.520e-11
Identity = 131/498 (26.31%), Postives = 210/498 (42.17%), Query Frame = 3
Query: 8241 IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL-QGEENNAFSINPQ-NGSVFLAQTVDRELKSKYEMK-VAVSDGINVL--EIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQ-RIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP--IAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSY----------FSIGSKNGQISTSRNVNSAIL-------GQWF-SLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTL-LAHDLGFP-----RKSQTSIVLIKVLDEDDNSPYF-ISRNFVASLRELDQL 9632
            +I++ D NDNSP F+   F+  VSE    G+++  +   D+D+     L++ +  G  +NAF I P  +G V     +DRE++  Y++K +A  +G+  +     + + + D NDN+P           ++  SE       + +I+A D D   +    + Y L +E+   I   S+F L+  SG L +K      +     +DVI  ASD        + TV  + +  E +   +    Q P   A+L    E S   +++V+ D L    T     GN S            FS+   NG +S    VN + L       G +F  +I +  G   L S +       + +  +D      Q   ++    ISE   +GS +LQ+     D  LA      I  + +  F L+       S  + +V PLD E    Y L L L+H  G P       S    V+I +LD +DN P F  S  + A + EL  L
Sbjct: 2309 VIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-----PNNLVTVSEATELGAVITSISANDVDTYPA----LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVI--ASDAAH----EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISE--SLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVS----VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTL------LRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA-----IIAGNEESAFELL------QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPL 2768          

HSP 34 Score: 65.855 bits (159), Expect = 1.574e-9
Identity = 52/161 (32.30%), Postives = 80/161 (49.69%), Query Frame = 3
Query: 5655 GEIDYEQDNHYILLITATDVSQQSL--FLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIAS--DADKSDLLLFEILSPNDD--LLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHR---VTVEVLINLINVNDETPLIH 6110
            G +D E    Y LLI A D     L  F+        TV ++I D+NDN P+F+ +R   ++PE+  + + ++Q+ AS  DAD++ L+ + I     D   +  ++P TG I     LD+E  E H L V   D   +    T  V I + +VND  P I+
Sbjct:  242 GFLDRETTPGYSLLIEALDGGTPPLRGFM--------TVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTIN 394          

HSP 35 Score: 64.6994 bits (156), Expect = 2.782e-9
Identity = 49/189 (25.93%), Postives = 90/189 (47.62%), Query Frame = 3
Query: 1179 IVHCQDDDQDPRDLIAVSIIGGNDENIFAL---ERTHGNVHILRQIKA-IHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITK--GDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            ++  +D D +P +    +I+ GN  + F L       G +++  QI   +       Y++ + A+D G P  +  + + I I   N   P+F       TV  NA++ + +   +A+D DA  NG + Y+I +   D    F I+  +G I + K L F   +  +L ++A+D G   LETT ++ + +
Sbjct:  195 LLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRV 383          

HSP 36 Score: 62.3882 bits (150), Expect = 1.498e-8
Identity = 104/504 (20.63%), Postives = 203/504 (40.28%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLE---------RRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGV-----NQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCY-----VTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPL----AIVHCQDDDQD--PRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDML-IRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDR----FAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +F L++ +G ++    +D E      +++       E + +    + VR+ DENDN P+F   +             I E++++  D+    ATD+D++       Y IE   E      S   V      L   V      +   Y + I  +D G+P LK    + +   D       F  ++Y  +++E+   G  V+++     D  +     N+E  ++  ++++++              L +P     N      +V +  HG P +S+        V + ++  N  FP F        D++A  E       PL    A +   D DQ+  P   +   I  GNDE++F ++   G + +  ++   ++   +SY + +RA D+ +     ++    + ++  N   P F        +  N  + S +    A+DLD G  G++ YSI      +     F ++ +SGL+T      + +  +  +E++A D G
Sbjct: 2477 IFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV----LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAV-----SSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIV--------------LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF--------DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLD--YDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 37 Score: 62.3882 bits (150), Expect = 1.629e-8
Identity = 84/285 (29.47%), Postives = 127/285 (44.56%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIV---GQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEG-------QFLETISIKVRIIDENDNPPIF-YPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNN-YKIESGNEDDRFALSGV-GVQYRGQLLLRVVRPLDRETKEK-YKLTISVEDKG-QPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLEN--EFSIDRKSG 950
            +FL +QY  ++SE  P+ ++V   GQ  +    +    ++E  F L +   ++L    +DRE   +DL ++ L      G            IS+ + I+D NDN PIF    K E  I E   L   I+   A D+D +    S   Y I SGN++  F +  V GV       L V   LD ++  K Y+L I   D   Q PL  +    + + D NDN P F  ++Y   L E+   G  V + +ASD D G   ++ Y      S   +   F +D +SG
Sbjct: 2647 QFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLV-KPLDRER--NDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGV-------LFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG 2921          

HSP 38 Score: 60.4622 bits (145), Expect = 5.395e-8
Identity = 87/364 (23.90%), Postives = 151/364 (41.48%), Query Frame = 3
Query: 5523 TVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPD-HGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPND-DL----LMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETP--LIHNPTTVY--LPKINQNHN--------IMIKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFN-----PGLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYTAFI----KLERFEKSPLKI------QSVFDK--LIIPNDDKYVYFLLQS 6509
            T + QV   +S    N  +++ IV     + F + P   GI+ T   +D E  + Y L I ATD       +P + T T T+ V IVD+NDN P F    L V++ E   + + I  + A+D D    L + + + +  D+    +  ++  +G +     LDYE  + + L V  +D  H     + + + + ND  P  L   P   +  LP I++           + +  +D D+ G  S  I       +   V    G VS N     P +  +    V +   D     +K+ +L+ +  N +    + F+    + +  E +PL        Q   D+   II  +++  + LLQS
Sbjct: 2339 TFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEG-----VPQM-TGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQS 2695          

HSP 39 Score: 60.4622 bits (145), Expect = 6.651e-8
Identity = 90/372 (24.19%), Postives = 155/372 (41.67%), Query Frame = 3
Query:  567 SGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLE------VEIIVEDYNDNSPVFSPS-KYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFD-HGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSI-IGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNR-YQSVTVYRNASINSFI-ANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLD 1649
            +GNE+  F L    +Q +  +L   V+PLDRE  + YKL + +     PPL   L       V I + D NDN P+F  S KY   ++E     + + ++ A DAD       E  +  T    E+ F+ID  +G + +              L++ A D H    L +     + +   N   PKF +     T+   ++   +     +   H  D D+ P   +  SI    +DE+ + + R      ++           Q Y + + A D G   K+ +V + + I   + + P F  R Y+ V     A    ++     ATD D+G +G+++Y ++       F + + SG + + + L   KLD
Sbjct: 2683 AGNEESAFEL----LQSKAIVL---VKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPL-----TEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAP--HSHFKVNRSSGAVLIKRKL---KLD 3035          

HSP 40 Score: 58.151 bits (139), Expect = 2.785e-7
Identity = 69/281 (24.56%), Postives = 125/281 (44.48%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETIS-IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNES-NLP-GFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQP--------TSCHINQGDCTLVVEAFDHGSPSLSAYCYVTV 1067
            E +F ++ +TGV+  +N +D +S A     I     +   + L ++   ++ + DENDN P F   +    + EN  + + +    A+D D   FG   NY I     D+  +     V     L+       D E +++Y + +   D G    K  + V + +E  ++ +P F+   Y   L  +  LP G+ V +V A+D+DSG +  V YQ     S     F ++R SG++ + +          + +++  D +LV+ A      SLS+   V +
Sbjct: 2800 EHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFG-QLNYSIGPAPSDES-SWKMFRVDSESGLVTSAFV-FDYEQRQRYDMELLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHS----HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEI 3071          

HSP 41 Score: 57.3806 bits (137), Expect = 4.527e-7
Identity = 65/252 (25.79%), Postives = 111/252 (44.05%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLPQLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSD-----SEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESC--PGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNA----FSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGIN 8522
            FSI+  SG++S      +  S YTL+I+AS +        + +  + +   ++         +TGSV+E++       +IS  +  L  N     S     +W       + ++  I T  K +DRE+  +    V+  DG    + S   P  I V+D+NDN PIF    ++G V      G  ++ +  +DAD      + +SL   EN+A    F INP  G++  +Q++  E      ++V   D  N
Sbjct: 1895 FSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ---FAIDGQSGLITTVGK-LDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNA-ENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGN 2141          

HSP 42 Score: 56.225 bits (134), Expect = 1.300e-6
Identity = 47/191 (24.61%), Postives = 85/191 (44.50%), Query Frame = 3
Query: 9030 EITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNF 9602
            E+ + I SGN    F+I    G +  +  ++     + + LI++AC +        CS  +   L + D N   P+  ++E    ++E   VGS++ +    D D G  G +  +I  +  D  S   F  +  S  +      DYE + +Y + LLA D+G   K  +  V +++   D+ +P F  R +
Sbjct: 2789 EVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSH--HQRPLCSL-QPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTY 2974          

HSP 43 Score: 53.9138 bits (128), Expect = 6.383e-6
Identity = 98/445 (22.02%), Postives = 185/445 (41.57%), Query Frame = 3
Query: 8538 MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVI---ITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP---IAVLYTSQEGSRVANIAVNHDNLYGEITFFI-----ISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTV---------SISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNG------NSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL--IVLPEVRDE-DSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNE 9785
            ++I + D NDN P+ S+    K FV   SE  +   FV  + A D+D    +N+++RY +   N      + F++      +    V  N + D E  D+    I A+D G P +  + T+    +    ++   + TF  P   + V   ++ G+ + +I+ N  + Y  +T+ +     +     S F++   +G++   R ++   L Q + L        +++S +    R  +T+ ++D N  +P     +             ISE + V  +LL V+  D D+       + II    + FS+   P+NG      +  Q  V +  DY ++      ++A D G P    ++++ ++  D       F+   + A + E   L  +VL   +D  D  +A        +     S  +L QSK    +K L R  N+
Sbjct: 2308 LVIELEDENDNSPKFSQ----KQFVATVSEGNNKGTFVAQVHAFDSD--AGSNARLRYHIVDGNH----DNAFVIEPAFSGI----VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIV----DVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE-LQQEYEL-------DVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSV--HPSNGVVSVNMSRLQPAVSSSGDYFVR------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA-------IIAGNEESAFELLQSKAIVLVKPLDRERND 2710          
BLAST of Protocadherin Fat 4 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 194.897 bits (494), Expect = 1.494e-48
Identity = 294/1191 (24.69%), Postives = 504/1191 (42.32%), Query Frame = 3
Query: 2745 TGRFHQHFYYIIQEQIVVLKDSFVDKNVNGRLIELRIELFDGLSGDLSVSNTEIIIEFHPIFDS-PIFFEPFYTFVVKENSLSHTPLRKISLIQSQ----NIDNY-------HLSIIE-ESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPN-----TTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNK--LVDVVEQEF-IFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYL---------QSVHPPD--HPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHI--KHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSN---SKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECK--TTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYI-----------WINEIPE------FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTF-----TSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIV---------SEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVF------DTTRLAVSIPEDVPINSEIIQLIASDADKSD--LLLFEILSPNDDLLMTVNPITGVISTAGIL-----DYEKTERHALTVSCTD 6038
            T   H  ++ I  +  ++   S +D      + +L +   DG    LS + T +++  H + D+ PIF + FY   V EN      + K+S          + NY       HL+  E  S  G+  I          ELD+E R  Y F VLA ++     ST   + + + D NDN P+F  + Y  S+    K +     T I  V A DPD G  G V+Y I     E     ID  +G +F  +  ++ V  Q   +  I+A D G  R N+   V++ I  + +    F+K  +   + ED+     +  +     ++ H+  V Y I      G FSI  ++G I +   LD EA +  +L I AT             T + + + DVNDN+P F+  ++    + ES ++G  L    A+D D G +GQV Y L     + +  F ID  SG L L+Q +DYE   +   I+TA D G P+L +NL++ V + ++ND  P F K+      V ++ +I   + +V A D DT     + Y +          S+   D    F I P SG + +  P+ +E    + L V+A D      + +  V V +   +DN+ + Q   Y   I  + +  R  +  +   S+    +N   R+  L  NSS+    ++  TG++  ++  P++    ++  L+ +E+    T ++     + +++ D ++   +  D    +   +    PG ++ R++A+       D        Y  +  R    + +  +D  +G I    + LD E  E S   + V   D G N  R     + + + D NDNRP F + + +F   E+   G    VG++   ++  D     +            +N + +      F +D+ SG +  + + LD E  + F  +I+  D T      +S   + I + D ND    +  D     + E  P+ T+I   T  ++ T  N  +++ ++          E    LF ++   G ++ Q  +D+E    Y+L++ A D  Q S     L+T + TV + I+D ND+ P F           ++ I +   I   +  ++A D D  D   L +EI   N +    +N  TG+I     L     D EK  R  L +   D
Sbjct:  546 TPETHAQWFQIDPQTGLITTRSHIDCETE-PVPQLTVVARDGGVPPLSSTAT-VLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICI--------AGELDFERRSSYEFPVLATDRGGL--STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI-VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP----VYGHTQVNIEVEDVNDNAPEFEA-SMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL--FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKD-EYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRI--EENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQ---VHPVTGEI--STREPLDRELRELYDLV-VEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVD-----RDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRT-RVVLDHE--ERSIYRLGVAASD-GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGH--VVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARL-LDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALD--QSSNVTERLQT-SVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKD 1692          

HSP 2 Score: 172.555 bits (436), Expect = 8.364e-42
Identity = 244/1054 (23.15%), Postives = 437/1054 (41.46%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINP-SPKSKQFFDKQTFFQNISEDMKITEKIFKLEI---DHQQ--MVTYRISKCTQK---GAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTA---------NDIDDGLNG-QVRYRLTATGMESI-SVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYP--ALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE--------VLYYLQSVHPPDHP---FVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQS---VKVHIKHDNEDEIQVLT-------YGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYD-KIIINRYTGDVFLTSTTPVEFNSIDITF---LISLESLRSDTLIKYHSTKLVLNIGDPHN---------------LNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGK-------NGSRIRCTKVFLNIEDCNDNRPVF-ANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWI----NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD-GTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSE--WGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEILSPNDDLLMT--VNPITGVISTAGILDYEKTERHALTVSCTD 6038
            R +Y  TVLA +        K  V++ V D NDN P F    Y F I  + +  + +G V A D D G N  + YS+  LP+   F ++   +G + T + +D   +E +   + A D G P  ++ V V + ++  +  + +  D Q    ++ E+     ++ ++     DH Q   +TY I K       G FSI+  +G+I     LD E  + + L + A+D  +        V  L V ++D+NDN P F + +L  F + E   +G ++G  +          N +++     +V Y L     + I + F ID  SG L + + +D E++ ++   I A D         S ++V + + ++ND  P + ++  ++  V +   +GT +    A D DT          + Y+ Q     +     F ++ ++G LS+  P+  E    + L+V A+D         Q+   V++ I   N+     ++         ++ +  ++   E +A + A       N +  Y +   + + +  IN  TG + L  + P     ++      LI           K  S  L L +   HN                N     +  Q+   K+  G +   L    P    +DL  +  D   GI        T  + D+E+    V  +Y+ R+    S ++   V   R         NG       +++ + D NDN P F     +    PEN+  G    + TV A D D     + I+     N   +FS+D +SG +  S  PLD E  + +  +IQ SD G   S      +     DQ  N   F   +Y   + E AP+ T + Q++  ++    N  + + + +E  W    F+++   G+ITT G++D E    Y  ++ ATD  +  +      + T  V ++++DINDN P+F+       +P  +     ++++ A DAD   +  +++ + + N  +     +NP TG +S +  L  E  +   L V   D
Sbjct: 1116 RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL--LPINSSF-QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE---TVRMLRVEVLDLNDNRPTFTSSSLV-FRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDP-IDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQV-TAKSLHGAENANLSYEIPAGVANDL--FHVDWQRGII------TTRGQFDRESQASYVLPVYV-RDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG---VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL--SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQW---QFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEV-----RSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARD 2138          

HSP 3 Score: 170.244 bits (430), Expect = 4.359e-41
Identity = 145/487 (29.77%), Postives = 223/487 (45.79%), Query Frame = 3
Query:  273 LNKLTGVILTSNIIDRESLAS-DLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGV----GVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDL-IAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSI--TKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTG 1709
            +++ TG I T   +DRE+ AS  L+ I L  +         I + V + DENDN P F    +     EN       +L  A D D + +  +  Y I SGN +D F LS      GV Y   L L++   LDRET   Y L I   D G PPL+G + V I ++D NDN P+F+ S+Y   + E+   G  V++VYASD D+  N  VEY   + +S  E  F ID ++G+I + +       +    LVV A DHG   L    +V++ V  +N   P   + ++ S D +  I       + +A +   D D       + V++ GG+    FAL     +++++     +    + +YT++V A D G P    +  + +RI   N   P F        V   A   + +    A D D GLN  + YS+  T   +   F I+  +GLIT    +        +L ++ARD G+  L +T 
Sbjct:  125 IDRATGEIRTKVKLDRETRASYSLVAIPLSGRN--------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYN-TQRYNIVSGNVNDAFRLSSHRERDGVLY---LDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKEL-HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFL-SDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH--FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTA 595          

HSP 4 Score: 168.703 bits (426), Expect = 1.016e-40
Identity = 251/1069 (23.48%), Postives = 463/1069 (43.31%), Query Frame = 3
Query: 3153 FTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEK--------IFKLEIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLI--NRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD---TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDV-----------FLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIK---LP-NTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTK--VFLNIEDCNDNRPVFAN-ETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEYIWINEIPE-----FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWG--KHLFSVNP-DHGIITTQGEIDYEQDNHYILLITATDV-SQQSLFLPCLETVTT--------TVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD---KSDL-----LLFEILSPNDDLLMT---VNPITGVISTAGILDYEKTERHALTVSCTDGLHRVT------VEVLINLINVNDETPLIHNPTT 6122
             TV+A +      S+   V++ + D NDN PIF    Y  S+  +      I KV A DPD G+N  VNY+I +    L   E+ S SG +     +D   +  + F + A D G   L+++  + +++     ++  F  + +  ++ E  K + +        +   + D+     V+YRI    + G F I++ TG I ++  + L       H+L I ATD  + + +    V   +++IID     PIF+  A  N+ + E    GT++G   A   D      VRY + +   +    F I+T SG + + +P+D+E K +    I A  LG P ++ +  V + + ++ND  P F + S +   V ++  +G  +   +A D D   + +V Y L         F I+  SG L +S  +  E S    L+V A D          ++ V ++  +DN    +   Y ++ + +S     +I  + A       N+R  Y + ++  D +  +  + DV           ++    P++  + D  + +++ +  + T   +  T++++ + D ++ +  FQK+ Y F+I E          R  ++      SDL+        G +  I+   LP N+  ++   TG IS     LDRE+ E   + VE         G+ +R  +  V +++ D NDN P  A+ +  +    E    G ++    V+A D+D   ++++ Y  +          FS+D TSG++ T  V LDHE  + +   +  SDG       + +L  +  D   N   FT     F + E A +  V+G ++       P  +++  +   +   +  +++NP    +I    +ID    N  +  +   +V S+  L +  L+T  +        TV + + D+NDN P +    + + + E  P+ + I    A+DAD     DL       F  L+ + +  M+   ++ +TG +S    LD+E  + + L V   D    VT      V V + +++ ND  P   +P +
Sbjct:  579 LTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVV---FLSIIDAMQRPPIFEK-ARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY--FSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEF-EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVK-ESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEY-SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD-RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEEN--------LRRGSVVGVVTASDLD-------LGENAAIRYSLLPINSSFQVHPVTGEISTRE-PLDRELRELYDLVVEAR-----DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVV--RVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTR-VVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSIS---PIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNS 1607          

HSP 5 Score: 159.458 bits (402), Expect = 7.430e-38
Identity = 248/1120 (22.14%), Postives = 446/1120 (39.82%), Query Frame = 3
Query: 3141 KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQ-----------SGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMK---ITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLT-ATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYA-QDP---------DTNEVLYYLQSVHPP-----DHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIK----HDN-----EDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLK--NSSYDKII----INRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPIS----------DLEYYIFDIYCGISERIKLPNTMIRLDKETGWIS-VGNIYLDREIIE-GSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE------FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHI------------------------------HETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS-DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG----LHRVTVEVLINLINVNDETPLIHN-PTTVYLPKINQNHNIMIKCSDQD-NLG 6191
            ++++  V A +      ST + +++ VQD NDN P+F    Y  +++     N  I +V A D D+G N  + Y I    V+     I S            SG ++    +D      +   + A D+G P  ++  +V V++  +  +   F K  +   I E+++   +   +   ++D  +    R S      +F ++  TG I     LDRE    + L + A D  +   S  + V    +++ DVNDN+P   +   +   + E    GT +    A D D G N  + Y +      +   +F ID  SG +     +D+E +  +   + A D G P   +   + V + ++ND +P F   S L F V+++ A+G  VG +   + P         ++ E L    +++P      +  F I+  SG L V+  + +EV   F L + A+D    +     ++ V I+    +DN     +D I +    A   P  +      AT      + +L  R +      N S ++ +    ++  TG + L +  P++F ++    LI     +S  + +   T + + +     L+   +   F  P         LF   A   G  ++          D     ++I  G  E         R++ +TG I  V ++    E +E G +  + +   D G+   +     + L ++  ++N P F    +     EN   G  +   T ++     ++ L Y    EIP       F +D   GI+TT G   D E+ A ++  + V D    ST +   +    +      T +  HF +                               E   IHTV+      +    PN  + + I      + FS++   G ++ +  +D EQ + Y L I A+D  Q     P        + + + D NDN P F  ++   S+ ED P+ + ++Q+ A DAD   +  L   L+        ++  +G+I+T G LD E    +   V  TDG    +   TV V IN++++ND  P+    P    +P + Q    ++K    D +LG
Sbjct: 1000 QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPV---RIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSS-LVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT--PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQA--PLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRL---RILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGE------GRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSY----EIPAGVANDLFHVDWQRGIITTRGQ-FDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVA----SDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQ-----PKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLG 2087          

HSP 6 Score: 143.28 bits (360), Expect = 5.728e-33
Identity = 115/394 (29.19%), Postives = 190/394 (48.22%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELD-FVEIDSQSGRLFTNKLVDVVEQEF-IFFITAEDHGIPRLNSSVKVYVKI----NPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI-DHQQMVTYRISKCTQKGA---FSINQHTGIIHLI---NRLDREAIAFHVLTIVATDNSSTKGSEYL-AVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD 4286
            YS  + A++         + V I +QD NDN PIF+   YF ++  +    T++ +V+A D D+  NG V Y+I +   + +    ID ++G ++ NK +D   +E     + A+DHG   L ++  V +++    +  P     F        ISE  +  E + ++ + D      Y     T  G    F++      I+L+     LDRE ++ + L++VATD    KG+  L A  ++++ I DVNDN P F+ D  +  ++ E    GT +    A+D D+GLN  + Y L  T       F+ID  +G +     +D E +P     + A D G P L S  +V VTI ++ND +P F+ +S     V +N  +G  + +V A DPD
Sbjct:  252 YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATD----KGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVM-EVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFD-QSFYNVSVAENEPVGRCILKVSASDPD 639          

HSP 7 Score: 139.813 bits (351), Expect = 5.737e-32
Identity = 154/546 (28.21%), Postives = 234/546 (42.86%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFGFS--------------YEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENI-----ALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRP--LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVG-STDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIY------------SITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            F  S YN  V+EN+P    VG+ ++K   S               E F     F +   +G I  +  +D E  +S    +     T  G    T  IK+++ D NDN P+FYP + +  + E+      A  T I    ATD D   FG   +Y+I +GNE   F +     +  G++   VVRP  L   T+  + L IS  D G         V + + D     P+F  ++Y   + E    G  V  V A+  D      V Y         +  FSI+  SG+IR+ +P   H  +    L ++A   G P +  +  V + V  +N   P+F  + V  S  ++A  E+G     PL   H  D D      +  S++  + + +FA++   G++ IL Q   +   + Q +T+ V A D G PS  T + +L+ +   N   PVF     SV V  + SIN+ I    A+DLD G N +I Y            SI+  D    F I  +SG I L  PL     D+ +L ++A D G
Sbjct:  611 FDQSFYNVSVAENEP----VGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVL---ATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFG-QVSYRIVAGNEAGIFRID----RSTGEIF--VVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP--DGYFSIETNSGNIRIAKPLD-HEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESA--ELG----APLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHL-ILSQ--HLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNG 1129          

HSP 8 Score: 139.043 bits (349), Expect = 1.031e-31
Identity = 216/959 (22.52%), Postives = 400/959 (41.71%), Query Frame = 3
Query: 3366 IEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQT----FFQNISEDMKITEKIFK-LEIDHQQMVTYRISKCTQKGAFSINQHT---GIIHLINR----LDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNK---ESRLEFIVQQNVAIGTTVGRVYAQDPDTN-EVLYYLQSVHPPDHPFVINPISG---ILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKI---IINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVL-NIGDPHNLNFQKNDYFFQIPECKTTP-GLKLFRLQALYPGNPISDL-EYYIFDIYCGISERIKLPNTMIRLDKETGWISV-GNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETF---IFHAPENTTYGQKIYVGTVQAHDKDLDS----TLEYIWINEIPEFSLDKTSG-IVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPL 6104
            + +  VE D   ID  +G + T   +D  E    + + A    IP    +++V V +     +   F + +    F +N   ++K T    + L+++      Y I       AF ++ H    G+++L  +    LDRE    + L I A D  +     ++ V    + I DVNDN PIF N +     + E+  VGT +    A+D D   NG V Y +     +   +F+ID  +GA+Y+N+ +D+E K     ++ A D G   L +   V++ +T++ND +P  N           + ++   G  V R+   DPD+  E      +++  D  F +        ++ V  P+ +E+  ++ L V+A D      +  +S+ + I   +DN  E +   Y A ++  +      +  L A    + LNS   Y L  +         I+  TG +   S    E   +    +++    R   +    ST  VL  I D ++     +  F+ +   +  P G  + ++ A  P   ++ +  Y I + +  ++E          +   +G I + G +  +R     S     V+  DRG   +      + + + D NDNRPVF    +   +  +P+ ++      +  V A D D  +    +   +  NE   F +D+++G I       L        +  I  +DG    +    ++     D       F   RY++++ E  P  TV+G V   +        +++ I S      FS+  + G I     +D+E  +  +L I AT      L  P +    T V + + D+NDN P F+ + + +S+PE   + + +    A D D   S  + + ++  +   L  ++  +G +  +  LDYE ++RH L V+ TDG        + +L+++ +VND  P+
Sbjct:  114 VAEAGVETDLA-IDRATGEIRTKVKLDR-ETRASYSLVA----IPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVN---ITIQDVNDNQPIF-NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVL-AHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVA----RDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE--------FEVRSASGEICIAGELDFERR----SSYEFPVLATDRGGLST---TAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT------LGEPPVYG-HTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPV 1035          

HSP 9 Score: 124.02 bits (310), Expect = 3.582e-27
Identity = 142/547 (25.96%), Postives = 247/547 (45.16%), Query Frame = 3
Query: 8040 NILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSL---QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLEIGMLIT--VTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVAL---NWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQ---YPIAVLYTSQEGSRVANIAVNHDNLYG---EITFFIISG--NGSSYFSIGSKNGQISTSRNVNSAILG-QWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            NI+S N N     + H +     LY + + +        +DRE      + +   DG    +     + I + D+NDN PIF  + +   V ENA +G+ ++ +   D D+    L ++++   Q ++   F I+P+ G++++ + +D E K  +E+ V   D G   LE    ++  VTD NDN+P I+   ++       SE A    FV  I+  D  DS++  + +  +L+  +        F L     S+ +  V L     I  N T+ V+  A+D+G PPL  S ++ FL IT   ++      F+   Y   V+  +  G+ V  + + HD   G    +T+ +       + +F I  + G I+T  +++         +++ +  G   LSS +      T+ + I D N   P    S   VS++E   VG  +L+V   DPD G+  +V  TI    +    L  F     S ++ +   LD+E +  Y   +LA D G    S T+++ +++ D +DN P F  R +  SLRE
Sbjct:  212 NIVSGNVNDAFRLSSH-RERDGVLYLDLQISGF------LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDP-DSKTEYANVNVTLNGGDGH------FALTTRDNSIYLVIVHLPLDREIVSNYTLSVV--ATDKGTPPLHASKSI-FLRIT---DVNDNPPEFEQDLYHANVMEVADPGTSVLQV-LAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTA------TVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI---GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRE 726          

HSP 10 Score: 123.635 bits (309), Expect = 5.136e-27
Identity = 151/590 (25.59%), Postives = 245/590 (41.53%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIKFG---------FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTL-EGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFG-VSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKK----------TRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY---IEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVH----ILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQS-VTVYRNASINSFIANFFATDLDAGLNGKIIYSITKG---DYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHARIKSTCPTQFILDDSNLLHSFSHI 1823
            F  ++YN+ V E+ P  T+VG V+   G         +S      +G F++   +G I  +  +D E+ +  L+ I   + TL E        + + + D NDN P F  + +   + E+  L   +    A D D+   G V+ +   ESG     FA+        G L+L   + LD E+ +++ L ++  D G P L   L + + V+D NDN PVF   +Y+V ++ES     ++++V ASD D+G N  + Y+             + S +   F I   SG I L  P      +    L V A D+G+P+  A   V V V+  N   PKF+        K+ Y   IE        + +V   D D      I  S++  N    F +    G +     + R+++ +       Y + V A D G P +   V + I ++  N   P   +  +  V+V       + +    A D D G N  I YSI KG   D    F+I+  SG+I     L   +    +L + A D G    ET   L + +L  +       S+     + +D+ L H    I
Sbjct:  827 FEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNI---QATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGK--GLFAIDA----RSGHLILS--QHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRE-TRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ--------KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS--FQVHPVTGEISTREPLDRELREL-------YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSI 1387          

HSP 11 Score: 121.709 bits (304), Expect = 2.029e-26
Identity = 145/615 (23.58%), Postives = 256/615 (41.63%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADGSGGIIESCPG----IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDG----INVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQ---YPIAVLYTSQEGSRVAN-IAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQI-----------------------------------------STSRNVNSAILGQWFSLI------VQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNF--VASLRELDQLIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILD 9809
            +P+DRE ++   + +  +D   G  +S  G     I V D NDN+P F L+ + G V E+A +G+ ++ I  +DAD  +   L +SL  E    F+I+ Q+G +     +DREL++ Y   V  +DG    +    + + I V D NDNRP   +      ++            ++ + A DAD     N++I YSL++EN  +  K  F +N  +G+L+      +     + + + + A D+G PP      +  L   A     +L+  FQ   Y + +   S  G+R+   +A+  D    ++ F   +GN     S+ S +G+I                                         + S     A+    F+L       ++       +   F +    + + + D N  SP+    +   ++SE    G+ + QV   D DAG    ++  I+    D  + V  P      +  +V  LD EI+  Y L ++A D G P+ + T+ + ++++D +DN P F   N   V+   EL  +I      D D+       P+ T +    S V +     N ++  L R + + V+   LD
Sbjct: 1907 RPLDREQHSRYTLQIQASDR--GQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER----YPYIGQVPALIQPGQTLLKVQALDAD--LGANAEIVYSLNAENSAVSAK--FRINPSTGALSASQSLAS--ESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLR--FQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN-AFVIEPAFSGIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTY------PALTYRLGAESTVDI----ENMSIFALDRYSGKLVLKRRLD 2494          

HSP 12 Score: 114.775 bits (286), Expect = 2.466e-24
Identity = 132/493 (26.77%), Postives = 201/493 (40.77%), Query Frame = 3
Query:  252 HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKV--RIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFR-----INYVGSTD--------KAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            ++ G+F +++ TG I      D  S+ +  + +     T  G         V   IID    PPIF   +    + E+I   T +    A   D         Y I SG+ D  F++        G +  R+ +PLD E K +  L I     G+PP+ G  +V I VED NDN+P F  S   + + ES   G  +   +A D DSG + +V Y   K     +  F+ID +SG + L+Q      +Q   TL+V A D G PSLS    + V V  +N   P F      +N   S           A+ ++ G   R    IV    D+      +  SI   +    F +    G +++      +       Y +TV A DNG P+      +++R+  AN   P F+       +  N    S +    A+DLD G N  I YS+        F +   +G I+  +PL     +   L + ARD G
Sbjct:  763 NEAGIFRIDRSTGEIFVVRP-DMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVR-YSIYSGDPDGYFSIE----TNSGNI--RIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGLFAIDARSGHLILSQHLDYESSQ-RHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDN------VTNSISSSDVSQHFGIFPNSGWIYLR---APLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP--INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQG 1232          

HSP 13 Score: 112.464 bits (280), Expect = 1.181e-23
Identity = 126/502 (25.10%), Postives = 213/502 (42.43%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKI-----ESGNEDDRFALSGVGVQYR-------GQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDEN---IFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGL----------NGKIIYS---ITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARD 1679
            +GLF ++  +G ++ S  +D ES     + +      +       ++I V + D NDNPP+F  ++    + E+ ++   I    A+D DT      NN +I     ++G ++   ++S   V          G + LR   PLDRET+++Y+LT+   D G P       V + V D NDN P F  SKY  R+ E+   G  V  V ASD D G N  + Y      S     F +   +G I   +P    + +    LVVEA D G+P  SA   V +HV  +N   P+         +    +   +     +  V   D D      I  SI+ G D +   +F+++ T G   ++R    + +     Y + V A D GNP ++T   + + +   N   P F +      V  +A++   + +    +  A +          + ++ Y+   +TK      F I++ SG + + + L      + +LEI A D
Sbjct:  976 KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVP-SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDT-----GNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRA--PLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS----SFQVHPVTGEISTREPLDRELREL-YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI----ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSG---VIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALD 1457          

HSP 14 Score: 112.079 bits (279), Expect = 1.707e-23
Identity = 261/1209 (21.59%), Postives = 469/1209 (38.79%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKND----KEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFT-NKLVDVVEQEFIFFITAEDHGIPRLNSS-VKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLE-----IDHQQMVTYRISK--CTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPI--FKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQP--VDYEL--KPKWNFIITAFDLGY------------------------------------------------PALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPI-SGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKI------IINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVL-------NIGDPHNLNFQKNDYFFQIPECKTTPG--------LKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVS------DGTFTSTXXXXXXXXXXXXQCHNF----THDRYHFHIHETAPIHTVIGQVTL--KNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQD-NHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDL--LLFEI-LSPNDD---LLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLINVNDETPLIHN-------PTTVYLPK---INQNHNIMIKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKV---------SFNPGLLYANSINVSL--SCSDTIHNTIKNVSLI 6362
            R+Q+S   L +  +D    K +     + IFV+D NDN+P F    Y  S+       T++ ++ A+D D G+N  + YS+     +  F  ID QSG + T  KL   ++  + F + A D G   + S+ V V + +     ++  F++  +   +   ++  + + K++     +     + Y ++         F IN  TG +     L  E+     L +VA D  +   S  L +  L +   +    +P+  F+N+     +L E++  GT L         DG   +V++   A   + I    +D+ SG + +N+P  +DY+    P  + +     L Y                                                P L S   + + + + ND  P+F+++  +  + + N   GT V +V+A D D  +N  L Y       D+ FVI P  SGI+  +  + +E+   + L ++A D          +++V I   N+++        + + +++     I ++ A  N  +      Y L   S   I       ++RY+G + L      E           L+ + SD     H  + VL       N   P  L  Q   YF  +P               L +    A   GN  S + Y I     G S           +    G +SV    L   +       V ++  D GK   +   T + +   D    R  F    +     E    G  +    +Q     LD +L  I  NE   F L ++  IV     PLD E    +  ++ +S        +  ++++ I +I    D   NF       +Y   I E AP+   I Q+     +    PN  + +DI S   +H+F+++   G++     +DY+     Y L+I A D   Q               + + D NDN P F  T     + E+ P+ S + +  ASD DK     L + I  +P+D+    +  V+  +G++++A + DYE+ +R+ + +  +D G  + +V V + + + ++ TP           P  V LP+   + Q     +  +D D+ GP    +   S    +  V+R +G V             G LY +  ++SL  S S   HN++ +++++
Sbjct: 1911 REQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-ETQWQFA-IDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS-LGLIELLIG--EAPQGTPVLRFQNETYR-VMLKENSPSGTRL-LQVVALRSDGRRQKVQFSFGAGNEDGI--LSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNK-GTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISA--NDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ-----EYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNN-SKVIYIIEPAQEGFS-----------VHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALK-SSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV----LQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVK--PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSL-----QPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQ-----VTATDSDS-GPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVV 3069          

HSP 15 Score: 112.079 bits (279), Expect = 1.722e-23
Identity = 144/563 (25.58%), Postives = 258/563 (45.83%), Query Frame = 3
Query: 8028 SVSNNILSCNGN----SKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADS-KLFPLKFSLQGEENNA-FSINPQNGSVFLAQTVDRELKSKYEMKVAVSDG-INVLE--IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRY------------SLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVD---VIITASDRGQPPLFHSITVHFLFITA-ECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGE---ITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQA--CGTKILSSVSFCSKRETITLVISDFNLYSPQIR-ISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTD-DRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +V  ++++ +G+    S V ++++      Y      +  IR A KP+D E  + + +++    G   +       I+V D+NDN+P F  +     V E+A +G+ +      D DS     + +SL  E     F+I+ ++G + L+Q +D E   ++ + V  +DG +  L   + +L+ V D NDN P   K+     + +N SE    N  ++ + A+D D    NN++I Y            S+SS +    V   F +  +SG + ++A       D ET D   + + A+D G P       V    + A + + +  KS +++ I      + GS V  +  +  +L GE   I + ++  N S  F +    G+IST   ++   L + + L+V+A   GT + S+      R  + + +SD N  +P+I    E  VS+ E    G+ +++V  +D D G    +  +I+   D D   L          + +VV  LD+E +  Y L + A D G P +    ++ ++VLD +DN P F S + V  +RE
Sbjct:  844 TVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIA-KPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKD----EYSVNVSESRSINAQIIQVNASDLD--TGNNARITYRIVDAGVDNVTNSISSSD----VSQHFGIFPNSGWIYLRAPL-----DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIE--ENLRRGSVVGVVTASDLDL-GENAAIRYSLLPINSS--FQVHPVTGEISTREPLDRE-LRELYDLVVEARDQGTPVRSA------RVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVRE 1376          

HSP 16 Score: 109.768 bits (273), Expect = 8.110e-23
Identity = 146/563 (25.93%), Postives = 233/563 (41.39%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQVLIK-------FGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIF--LYKKTLEGQFLETISIKVRI--IDENDNPP-IFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSG-VNQEVEYQFKK----------TRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFD---HGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLA-IVH---CQDDDQDPRDLIAVSII------GGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAID---NGNPSKQTTVDMLIRINKANIYFPVF------RNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLD-----KIKLEIIARDAG 1685
            KF  S+Y FR+ EN    ++VG V              Y        F ++ +TG I T   +DRE     L E++  + +   +G  + +  + VRI   D NDN P I  P +    + E     T++    A D D  +   S  Y I  G + D   L  +     G +  RVV  LD E +  Y+L ++  D G PP + V  + + V D NDN P F+ S    R+ E    G  V  +   +  +  V   VE  F+           T+ ++E  F IDR SG++ + +     + Q +  L + A D     +P  SA   V + V  +N   P++  + +        +++ + T  P+  I+H     D D      +   +I        + E   +L R       L     +    +Q Y + V+A+D   N     QT+V + +RI  AN + P F        +  S+ +     I   +A+  A D D+G NG++ Y IT G+   RF I   +G+I L+K L     D     +  L I A+D G
Sbjct: 1152 KFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRE-----LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQ-NASITYSIVKGRDSDGHGLFSID-PTSGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREV-QSEFRLEIRALDTTASNNPQSSAIT-VKIEVADVNDNAPEWPQDPID-------LQVSEAT--PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHG 1694          

HSP 17 Score: 107.842 bits (268), Expect = 2.687e-22
Identity = 114/437 (26.09%), Postives = 178/437 (40.73%), Query Frame = 3
Query:  396 SIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRP-LDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINS----FFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILR------QIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIA 1673
            SI +RI D NDNPP F  +     ++E     T +    A D D +    +  Y +    E           Q   Q  L   R  +D ET+   +LT+   D G PPL     V + + D NDN P+F  S Y V + E+   G  ++KV ASD D GVN  V Y   +    L  EF +   SG I +         +      V A D G   LS    + + +  +N     F+P+     +  + KA+     + +  P+  V   D D      ++  I+ GN+  IF ++R+ G + ++R      + + +H +N       + A D GN        + + I  A    P+F     +  V  +    + + +  A   D      + YSI  GD    F+IE +SG I + KPL      ++ L I A
Sbjct:  489 SIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRD-EGLNSALTYSLAETPE-----THAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHL-TEFEVRSASGEICIAGELDFE-RRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKAS----SQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLN-------ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQA 904          

HSP 18 Score: 105.916 bits (263), Expect = 1.098e-21
Identity = 130/504 (25.79%), Postives = 208/504 (41.27%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN--NYKIESGNEDDRFALSGVGVQYRGQLLLR-------VVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNES-----NLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENE---FSIDRKSGSIRLTQPTSCHI-NQGDCTLVVEAFDHGSPSLSAYCYVTVHVI---RINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILR----QIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLET 1703
            F ++  TG+I T + ID E+     + +      +      T ++ V I D NDN PIF  +     + EN  +   I   +A+D D    GV+   NY I            G G ++  +  +R       +   LD E +  Y+  +   D+G   L     +++ + D NDN PVF P +Y V L ES           +V V A+D D G   +V Y     R V  NE   F IDR +G I + +P    +  Q    L + A D G+   +A   V + +I   +    F K R NY    D      +G V      + H        R  +  SI  G+ +  F++E   GN+ I +    + K+   +N+Q+          G P       + I +   N   P F      ++V  +A + + +    A D D+G +G++ YS+ K   +  FAI+  SG + L + L +    +  L + A D G+ SL T
Sbjct:  554 FQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDC---GVNAMVNYTI------------GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSY-----RIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAH--------RSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL--------GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLST 1018          

HSP 19 Score: 105.531 bits (262), Expect = 1.447e-21
Identity = 117/482 (24.27%), Postives = 212/482 (43.98%), Query Frame = 3
Query:  261 GLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISI-KVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDR--FALSGVGV----------QYRGQLLLRVVRPLDRETKEKYKLTISVED--KGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEY-------QFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGS---PSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRD--LIAVSIIGGNDENIFALERTHGNVHILRQI-KAIHNINLQS-YTITVRAIDNGNPS-KQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLIT 1616
            GLF+++  +GVI T  ++D E  +  +  + +          ET+ + +V ++D NDN P F  + L  R+ E+ AL   +   +  +   D   V  N  +E   ED R  + L+ +            ++ G L+  V R LDRE + +++L I   D      P    + V+I V D NDN+P +      ++++E+   G  +    A+DAD+G N +++Y       Q  +++    + F +D  +G++ L  P      Q +  L+V+A D  S     L     V + ++  N   P F ++   S  K A + I   TR    + H    D+D  D   +   I GGN E  F +    G + +++ +  A  ++     + + + A D+G P  K++++++ + +  ++   P F       T+  N    SF+    A  L    N  + Y I  G   D F ++   G+IT
Sbjct: 1306 GLFSIDPTSGVIRTRVVLDHEERS--IYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPAD---VVRN-SVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLV--VARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQ-EYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF-VSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIIT 1777          

HSP 20 Score: 103.605 bits (257), Expect = 5.574e-21
Identity = 126/540 (23.33%), Postives = 222/540 (41.11%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDD-RFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLK-GVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHI------------------LRQIKAIH----------------NINLQSYTITVRAIDNGNPSKQTTV---------------DMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKD-SGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL 1730
            F+++  +G  L++  +DRE  +   ++I    +          +I + + D+NDN P F  +K    + E+  L T +   +A D+D    GV+        NE   +FA+ G         L+  V  LDRE +  Y   +   D G+  ++   + V+I V D NDN P+F    Y  ++     PG  ++KV A DAD G N E+ Y      S +  +F I+  +G++  +Q  +    +    L V A D G+P  S+   + + +       P  R  +   T +    E      + L +V  + D +  R  +  S   GN++ I +L+   G + +                  L + +A+H                  + ++ T +  A+ N  P++   V               +++I +   N   P F  +    TV    +  +F+A   A D DAG N ++ Y I  G++ + F IE   SG++     L     D  KL+IIA D G+  +  T  + + I+
Sbjct: 1895 FSIDSSSGE-LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD---LGVNARLVYSLANETQWQFAIDGQ------SGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKL-LHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLR--FQNETYRVMLKENSPSGTRLLQVVALRSDGR--RQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIV 2419          

HSP 21 Score: 100.908 bits (250), Expect = 3.157e-20
Identity = 121/509 (23.77%), Postives = 218/509 (42.83%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDL--IEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFY-PN----KLERRIIENIALLTDI-SLTAATDSDTDEFGVSNNYKIESGNEDDRFAL-SGVGVQYRGQLLLRVVRPL--DRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKK-----------TRSVLENEFSIDRKSGSI-----------RLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNP-SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            LF ++ LTG +     +D E++   L  ++       +  +   ++++++RI+D ND+ P F  PN    K     I +   + ++ +   A D D+ + G    Y+I  GN + RF + S  G+      L++ + P   D E   ++ L I  +D GQP P K  L + +IV+  ++N P F  + Y   + E+   G  V++V A       N  + Y+               R ++      DR+S +            R +  +S  + +   +  +    +G     A  Y+TV  +  NS  P+FR             E G +       V   D D+ P   +  SI GGN  N F+++ + G +      +  H+     YT+ ++A D G P S+Q   ++ I +   N   P F+    + +V  +A + + +    A D D G+N +++YS+   + + +FAI+  SGLIT +  L           ++A D G
Sbjct: 1541 LFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNG-QLTYEITGGNGEGRFRINSQTGIIE----LVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNS--PEFRPGSCYGLSVPENSEPGVIH-----TVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHS----RYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-ETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 22 Score: 95.9005 bits (237), Expect = 1.312e-18
Identity = 149/633 (23.54%), Postives = 273/633 (43.13%), Query Frame = 3
Query: 8154 PVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDG---INVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVI---ITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGS------------RVANIAVNH-----DNLYGEITFFIISGNG-SSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTII-------TSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLG--FPRKSQTSI-VLIKVLDEDDNSPYFISRN---------FVASLRELDQLIVLPEVRDEDS---------IMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNESVINLILDVFGASQENYPKRLPLGRYSRLMIYLIL 9890
            P+DRE  +  +++V+  D G+         I++V+D NDN P F  + +   + EN   GS +  +   D D  +   +++SL    N++F ++P  G +   + +DREL+  Y++ V   D    +    + + I V+D NDN P+I+     +  V++  E       VV + A D D  Q  N+ I YS+  + +      LF ++  SG +  + V      D+E   +    + ASD G PP     TV  L +    +L   + TF     V    ++ +            R A++  N      ++L    T   ++ +   + F I   +G +  +R ++  +  + F L ++A  T   +S +  S   T+ + ++D N  +P+       + +SE   VG+ +      D D G  G ++  +I        S +   SL  F  +  +  L +  PLD+E   +Y L + A D       + QTS+ V +++LD +D++P+F+S N         F++    + +++      DEDS         I     E  + + S+T   ++L +S    T  + K        NLI+   GA     P+     + S L ++LI+
Sbjct: 1110 PLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL-PINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP---QEDVVSVREEQPPGTEVVRVRAVDRDHGQ--NASITYSIV-KGRDSDGHGLFSIDPTSGVIRTRVVL-----DHEERSIYRLGVAASDGGNPP---RETVRMLRVEV-LDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSE-FRLEIRALDTT--ASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSL--FRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQT-GIIELVKSLPPATEDVEKGGR----FNLII---GAKDHGQPEP----KKSSLNLHLIV 1709          

HSP 23 Score: 91.6633 bits (226), Expect = 2.065e-17
Identity = 117/437 (26.77%), Postives = 194/437 (44.39%), Query Frame = 3
Query: 5010 WISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTK-VFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEYIWINEIPE-----FSLDKTSGIVTT-SGVPLDHEAVAYFIGKIQVSDG---TFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHL--FSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSE-----IIQLIASDADKSDL--LLFEILSPNDDLLMTVNPITGVI--STAGILDYEKTERHALTVSCTDGLH---RVTVEVLINLINVNDETPLIHNPTTVY-----LPKINQNHNIMIKCSDQDNLGPLSYDIMTSSKD 6227
            ++ + ++ LDREI+  S  T+ VV  D+G     +  +K +FL I D NDN P F  E  ++HA           V  V AHD+D  L+S L Y  + E PE     F +D  +G++TT S +  + E V      +   DG     +STA +++ I D ND    F    Y+  + E  P+   I +V+  +     N ++ + I  E  KHL  F V    G I   GE+D+E+ + Y   + ATD    S         T  + + + D+NDN PVF      VS+ E    +S+     I+ ++A+D D  +   + + I++ N+  +  ++  TG I      +L       H L +S TDG +        V +++I+     P+       Y     +P+     +++    D  +  P+ Y I +   D
Sbjct:  454 YLVIVHLPLDREIV--SNYTLSVVATDKGT--PPLHASKSIFLRITDVNDNPPEF--EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTY-SLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLT--VVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI-GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLS--------TTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPD 872          

HSP 24 Score: 91.6633 bits (226), Expect = 2.245e-17
Identity = 111/443 (25.06%), Postives = 195/443 (44.02%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDS---QSGRLFTN-KLVDVVEQE----FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISK--CTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTN-LYVNIIDVNDNSP----IFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYL---NQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPPDHP--FVINPISGILSVSNPI 4385
            R  YS   + ++  +      + V++ V+D NDN+P F   S       +T        + A D D        Y+I    V  D   + S   + G L+ + ++   +++E    +   I A D G P L   + V + I     ++  F++  +F  + E+  +   + ++     + D   +V Y I++    ++  F I+  TG I++   LD E    H L +VA D+    G + L  T  + + + DVNDN P    IF +D  +  I SES + G  +   + +D D          +T  G +    F + T   ++YL   + P+D E+   +   + A D G P LH++ S+ + IT++ND  P F ++      V +    GT+V +V A D D   N  L Y  +  P  H   F I+P +G+++  + I
Sbjct:  143 RASYSLVAIPLSGRN------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVN-DAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDH----GEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKI-SESAQPGEFVARISVHDPDSKTE-YANVNVTLNGGDGH--FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQD-LYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI 569          

HSP 25 Score: 91.2781 bits (225), Expect = 2.588e-17
Identity = 105/395 (26.58%), Postives = 171/395 (43.29%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQS-YFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPR-----LNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEY---LAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKP--RFNKESRLEFIVQQNVAIGTTVGRVYA 4274
            RKQ S   +    N +       + I V D NDNSP F   S Y  S+  +++P   I  V A D D G N  + YSI    +   F  IDS SG L    L       +   I A D G P+      N ++ V  + + +P+    F    +  ++ ED  +   + ++     ++     + Y ++  TQ   F+I+  +G+I  + +LDRE  A +   ++ATD     G  Y    A   + +N++D+NDN PIF+       + +   + G  L    A D D G N ++ Y L A      + F+I+  +GAL  +Q +  E     +  + A D G P   S   + + I       P  RF  E+    ++++N   GT + +V A
Sbjct: 1811 RKQRSSDSIGDTSNGQHFDVAT-IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKF-SIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPR----FKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQW-QFAIDGQSGLITTVGKLDRELQASYNFMVLATD-----GGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPA-LIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNET-YRVMLKENSPSGTRLLQVVA 2190          

HSP 26 Score: 84.7297 bits (208), Expect = 3.170e-15
Identity = 146/641 (22.78%), Postives = 288/641 (44.93%), Query Frame = 3
Query: 7791 YQTFFSINRESGQISLN-------EPLPQLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSE---ISVSNNILSCNGNSKVSFTLHPKWSQ-DYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSW-----IIDIGVIDADSKLF-PLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSK--YEMKVAVSDGINV---LEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFI-----TAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHD---NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAG----------LAGIVKLT-IITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            +  +F I+ ++G I+         EP+PQL  V        L    + ++   D + +  ++D         ++  SV EN       + VS +   C  N+ V++T+   +         + + EI  A + +D E  ++ E  V+  D  GG+  +    +++ D+NDN P+F    +   + E+    S      I+ +   D D   F  + + +  G E   F I+   G +F+ +     ++++  + + ++ +DG N+    +  + +++ D+   RP I ++     +V    +   G + V ++ A   D   ++ S +RYS+ S +        F +  +SG++ I A  L+  + ++ + + I A+  G+PP++    V+           E E  +++      I+V  +++ G+ +   A  HD      G++T+ ++  +G   F+I +++G +  S++++     Q  +LIV A    + S     S   TI + + D N   P     E +V++SE   + + ++QV+  D D G           AG+  +T  I+S+D       FP +G  Y   +  PLD E + +Y LT+LA D G P     + V+++VLD +DN P F
Sbjct:  550 HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFD-------QSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGE-LDFERRSSYEFPVLATD-RGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAM-QRPPIFEKARYNYYV--KEDIPRGTV-VGSVIAASGD--VAHRSPVRYSIYSGDP----DGYFSIETNSGNIRI-AKPLDHEAKSQVL-LNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVR------ISVPESAELGAPLY-AAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYES-SQRHTLIVTATDGGVPS----LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIY---LRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKF 1153          

HSP 27 Score: 82.0333 bits (201), Expect = 1.637e-14
Identity = 138/546 (25.27%), Postives = 225/546 (41.21%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIE------IFLYKKTLEGQFLETISIKVRII--DENDNPPIFYPNKLERRIIENIA------LLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALS---GVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKG-QPPLKG----------------------VLEVEIIVEDYNDNSPVFSP-SKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSP-SLSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHIL----RQIKAIHNINLQSYTITVRAIDNGN-PSKQTTVDMLIRINKANIYFPVFRNRYQSV-TVYRNASINSFIANFFATDLDAGLNGKIIYSITKGD--YRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQ 1742
            EG F +N  TG+I    ++     A++ +E      + +  K       +  S+ + +I    ++NPP F        I+EN+        +T  SL  A +++        +Y+I +G  +D F +    G+ +  RGQ         DRE++  Y L + V D   Q  L                        V  + I V D NDNSP F P S Y + + E++ PG  +  V ASD D G N ++ Y    T   L N+FSID  SG +   +P          TL ++A D G P S   +C +T+ V   N   P+F+++ Y GS  + A +    V       +   D D      +  S+     +  FA++   G +  +    R+++A       SY   V A D G    +  TV + I +   N   P+F  RY  +  V         +    A D D G N +I+YS+   +     +F I   +G ++  + L       + LE++ARD G     + G ++L I ++ Q
Sbjct: 1653 EGRFRINSQTGII---ELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANL-------SYEIPAGVANDLFHVDWQRGI-ITTRGQF--------DRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSI--TGGNLGNKFSIDSSSGELS-ARPLDRE-QHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQ------ISAVDADLGVNARLVYSL-ANETQWQFAIDGQSGLITTVGKLDRELQA-------SYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFE-RYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQ 2159          

HSP 28 Score: 76.6406 bits (187), Expect = 8.386e-13
Identity = 93/353 (26.35%), Postives = 162/353 (45.89%), Query Frame = 3
Query:  711 PPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRK-SGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPR---DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSV---------TVYRNASINSFIANFFATDLDA-GLNGKIIYSITKGDYRDRFAIEKDSGLITL----LKPLWFVKLDKIKLEIIARDAGINSLETTGYL 1715
            P L    E+ I +ED NDNSP FS  ++   ++E N  G  V +V+A D+D+G N  + Y         +N F I+   SG +R        I +    L + A D G P ++    + V ++ +N   P F  N + +  +A   E+G V    +  +   D D  P     L A S +   + +IFAL+R  G + + R++   + +  Q Y + V A D  + ++     + +R+N  N   PVF  +              +  + S++  +    ATD D+ G N K+IY I     ++ F++   +G++++    L+P      D   + IIA+DAG  +L+++  L
Sbjct: 2300 PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH--DNAFVIEPAFSGIVRTNIVLDREI-RDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEAT--ELGAV----ITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLD--YELQ-QEYELDVIASDAAHEARTV---LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA--QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYF-VRIIAKDAGKPALKSSTLL 2634          

HSP 29 Score: 74.7146 bits (182), Expect = 2.970e-12
Identity = 128/577 (22.18%), Postives = 243/577 (42.11%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMG------FVSENALIGSWIIDIGVIDADSKL-FPLKFSLQGEENNA-FSINPQNGSVFLAQ-----TVDRELKSKYEMKVAVSDG----INVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQ----------------------IRYSLSSENQRIPVKSLFLLNEDSGS-LTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHD-NLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLG-FPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL-IVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQ-SKTNFTLKILKRSTNESVINLILDVFGASQENYPK 9842
            ++++D ND++P F      G      F+S+   IG  +  I  +D DS     L + + G      F IN Q G + L +     T D E   ++ + +   D          + + + V  S++N P+  + +   T + N    +    FV+ +TA     +++ N                         R     E+Q   V  +++ + +  S L+  AV     SD+      I  +  GQ   F   T++             +    Y ++V   S+ G     +A + D     ++ + I  GN  + FSI S +G++S +R ++     ++   I  +   +  S    C+    IT+ + D N  +P+ ++S+ T S+ E   +G++++Q+  +D D G+   +  ++   T  +F++     +G S  +  V  LD E+Q  Y+  +LA D G +  +S T  V I VLD +DN P F    ++  +  L Q    L +V+  D+ + +  E  Y+L ++ S+    F+ + +   L   +   +ES   L L+V    + N P+
Sbjct: 1590 LRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGS----FVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDS------IGDTSNGQ--HFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCN----ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAI-----DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ 2144          

HSP 30 Score: 74.3294 bits (181), Expect = 3.425e-12
Identity = 112/457 (24.51%), Postives = 197/457 (43.11%), Query Frame = 3
Query:  342 IEIFLYKKTLEGQFLETIS-IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSV-LENE--FSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINS-------FFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHG--NVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVF-RNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEII 1670
            I + L  +T +  FL + + + + + DENDN P F   +    + E     T ++   A DSD         Y I  GN D+ F +      + G +   +V  LDRE ++ YKL I   D+G P + G   + + + D NDN P F P+   V ++E+   G  +  + A+D D+     + Y+     +V +EN   F++DR SG + L +     + Q +  L V A D      +A+   TV  +R+N        F  +    Y       + I         L  V+  D D +  +   + II    E  F++  ++G  +V++ R   A+ +     Y + + A D G P+ +++  + ++ N        F +N+Y++  +   A + S +       LD  L      +I  G+    F + + S  I L+KPL   + D  KL ++
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGS-NARLRYHIVDGNHDNAFVIEPA---FSGIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ-EYELDVIASD------AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-FSVHPSNGVVSVNMSRLQPAVSSSG--DYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRA-QISEAAPLGSVVLQLGQDALDQSL------AIIAGNEESAFELLQ-SKAIVLVKPLDRERNDLYKLRLV 2717          

HSP 31 Score: 72.7886 bits (177), Expect = 1.183e-11
Identity = 84/319 (26.33%), Postives = 145/319 (45.45%), Query Frame = 3
Query: 7962 VCKCTNHGYFTGSVEE-NSDSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP-LKFSLQGE-----ENNA-FSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVI-----NTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALN-WISDNETVDVIITASDRGQPPL 8873
            V +  N G F   V   +SD+  +        +GN   +F + P +S         TN +      +DRE+ +  ++ +I  D G   +  +    ++++D+NDN P F  N  +  VSE   +G+ I  I   D D+  +P L + L  E     EN + F+++  +G + L + +D EL+ +YE+ V  SD  +     + + V D NDN P    +     F I       SE    +  ++ + ATDA DS+ NNS++ Y +       P +  F ++  +G +++    L   +S +    V I A D G+P L
Sbjct: 2331 VSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSG-----IVRTNIV------LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDA-DSEGNNSKVIYIIE------PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPAL 2628          

HSP 32 Score: 71.633 bits (174), Expect = 2.874e-11
Identity = 124/491 (25.25%), Postives = 204/491 (41.55%), Query Frame = 3
Query: 8331 SWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLN---EDSGSLTIKAVALNWISDNETV---DVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLYGEITFFIISGNGS---SYFSIGSKNGQISTSRNVNSAILGQWFSLIVQA--CGTKILSSVSFCSKRETITLVISDFNLYSPQIRI----SETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVN-PLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQ-----LIVLPEVRDEDSIMASRNEPSYTLKSKTSSKVQLFQ 9737
             +I D G ID+     P     +       +I+   G +     +DRE ++ Y +      G N   I +L+TV D NDN P   +  ++  F  NT       +    + A D D  +  N+Q RY++ S N    V   F L+   E  G L +  + ++   D ET     ++I A D G PPL   +TV+           I   + +Y   V   +  G+ V  + A + D     +  + I+   S     F I  + G I  ++ ++     +   L+V A   G + L + +F S R      ++D N   P I +     + +  ISE  + G  + ++ V DPD+          +   D  F+L    T  NS  L +V+ PLD EI   Y+L+++A D G P    +  + +++ D +DN P F    + A++ E+       L VL   RDE    A     +Y+L     +  Q FQ
Sbjct:   97 GYIGDFGGIDSGP---PYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN---IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL----LPARDLD-LEPYNTQ-RYNIVSGN----VNDAFRLSSHRERDGVLYLD-LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQS-RYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPLETTAFVSIR------VTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALT---TRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSAL----TYSLAETPETHAQWFQ 555          

HSP 33 Score: 69.707 bits (169), Expect = 9.520e-11
Identity = 131/498 (26.31%), Postives = 210/498 (42.17%), Query Frame = 3
Query: 8241 IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKL-FPLKFSL-QGEENNAFSINPQ-NGSVFLAQTVDRELKSKYEMK-VAVSDGINVL--EIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQ-RIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP--IAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSY----------FSIGSKNGQISTSRNVNSAIL-------GQWF-SLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTL-LAHDLGFP-----RKSQTSIVLIKVLDEDDNSPYF-ISRNFVASLRELDQL 9632
            +I++ D NDNSP F+   F+  VSE    G+++  +   D+D+     L++ +  G  +NAF I P  +G V     +DRE++  Y++K +A  +G+  +     + + + D NDN+P           ++  SE       + +I+A D D   +    + Y L +E+   I   S+F L+  SG L +K      +     +DVI  ASD        + TV  + +  E +   +    Q P   A+L    E S   +++V+ D L    T     GN S            FS+   NG +S    VN + L       G +F  +I +  G   L S +       + +  +D      Q   ++    ISE   +GS +LQ+     D  LA      I  + +  F L+       S  + +V PLD E    Y L L L+H  G P       S    V+I +LD +DN P F  S  + A + EL  L
Sbjct: 2309 VIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-----PNNLVTVSEATELGAVITSISANDVDTYPA----LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVI--ASDAAH----EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISE--SLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVS----VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTL------LRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA-----IIAGNEESAFELL------QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPL 2768          

HSP 34 Score: 65.855 bits (159), Expect = 1.574e-9
Identity = 52/161 (32.30%), Postives = 80/161 (49.69%), Query Frame = 3
Query: 5655 GEIDYEQDNHYILLITATDVSQQSL--FLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIAS--DADKSDLLLFEILSPNDD--LLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHR---VTVEVLINLINVNDETPLIH 6110
            G +D E    Y LLI A D     L  F+        TV ++I D+NDN P+F+ +R   ++PE+  + + ++Q+ AS  DAD++ L+ + I     D   +  ++P TG I     LD+E  E H L V   D   +    T  V I + +VND  P I+
Sbjct:  242 GFLDRETTPGYSLLIEALDGGTPPLRGFM--------TVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTIN 394          

HSP 35 Score: 64.6994 bits (156), Expect = 2.782e-9
Identity = 49/189 (25.93%), Postives = 90/189 (47.62%), Query Frame = 3
Query: 1179 IVHCQDDDQDPRDLIAVSIIGGNDENIFAL---ERTHGNVHILRQIKA-IHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITK--GDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            ++  +D D +P +    +I+ GN  + F L       G +++  QI   +       Y++ + A+D G P  +  + + I I   N   P+F       TV  NA++ + +   +A+D DA  NG + Y+I +   D    F I+  +G I + K L F   +  +L ++A+D G   LETT ++ + +
Sbjct:  195 LLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRV 383          

HSP 36 Score: 62.3882 bits (150), Expect = 1.498e-8
Identity = 104/504 (20.63%), Postives = 203/504 (40.28%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLE---------RRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGV-----NQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCY-----VTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPL----AIVHCQDDDQD--PRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDML-IRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDR----FAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +F L++ +G ++    +D E      +++       E + +    + VR+ DENDN P+F   +             I E++++  D+    ATD+D++       Y IE   E      S   V      L   V      +   Y + I  +D G+P LK    + +   D       F  ++Y  +++E+   G  V+++     D  +     N+E  ++  ++++++              L +P     N      +V +  HG P +S+        V + ++  N  FP F        D++A  E       PL    A +   D DQ+  P   +   I  GNDE++F ++   G + +  ++   ++   +SY + +RA D+ +     ++    + ++  N   P F        +  N  + S +    A+DLD G  G++ YSI      +     F ++ +SGL+T      + +  +  +E++A D G
Sbjct: 2477 IFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV----LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAV-----SSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIV--------------LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF--------DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLD--YDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 37 Score: 62.3882 bits (150), Expect = 1.629e-8
Identity = 84/285 (29.47%), Postives = 127/285 (44.56%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIV---GQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEG-------QFLETISIKVRIIDENDNPPIF-YPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNN-YKIESGNEDDRFALSGV-GVQYRGQLLLRVVRPLDRETKEK-YKLTISVEDKG-QPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLEN--EFSIDRKSG 950
            +FL +QY  ++SE  P+ ++V   GQ  +    +    ++E  F L +   ++L    +DRE   +DL ++ L      G            IS+ + I+D NDN PIF    K E  I E   L   I+   A D+D +    S   Y I SGN++  F +  V GV       L V   LD ++  K Y+L I   D   Q PL  +    + + D NDN P F  ++Y   L E+   G  V + +ASD D G   ++ Y      S   +   F +D +SG
Sbjct: 2647 QFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLV-KPLDRER--NDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGV-------LFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG 2921          

HSP 38 Score: 60.4622 bits (145), Expect = 5.395e-8
Identity = 87/364 (23.90%), Postives = 151/364 (41.48%), Query Frame = 3
Query: 5523 TVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPD-HGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPND-DL----LMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETP--LIHNPTTVY--LPKINQNHN--------IMIKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFN-----PGLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYTAFI----KLERFEKSPLKI------QSVFDK--LIIPNDDKYVYFLLQS 6509
            T + QV   +S    N  +++ IV     + F + P   GI+ T   +D E  + Y L I ATD       +P + T T T+ V IVD+NDN P F    L V++ E   + + I  + A+D D    L + + + +  D+    +  ++  +G +     LDYE  + + L V  +D  H     + + + + ND  P  L   P   +  LP I++           + +  +D D+ G  S  I       +   V    G VS N     P +  +    V +   D     +K+ +L+ +  N +    + F+    + +  E +PL        Q   D+   II  +++  + LLQS
Sbjct: 2339 TFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEG-----VPQM-TGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQS 2695          

HSP 39 Score: 60.4622 bits (145), Expect = 6.651e-8
Identity = 90/372 (24.19%), Postives = 155/372 (41.67%), Query Frame = 3
Query:  567 SGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLE------VEIIVEDYNDNSPVFSPS-KYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFD-HGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSI-IGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNR-YQSVTVYRNASINSFI-ANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLD 1649
            +GNE+  F L    +Q +  +L   V+PLDRE  + YKL + +     PPL   L       V I + D NDN P+F  S KY   ++E     + + ++ A DAD       E  +  T    E+ F+ID  +G + +              L++ A D H    L +     + +   N   PKF +     T+   ++   +     +   H  D D+ P   +  SI    +DE+ + + R      ++           Q Y + + A D G   K+ +V + + I   + + P F  R Y+ V     A    ++     ATD D+G +G+++Y ++       F + + SG + + + L   KLD
Sbjct: 2683 AGNEESAFEL----LQSKAIVL---VKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPL-----TEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAP--HSHFKVNRSSGAVLIKRKL---KLD 3035          

HSP 40 Score: 58.151 bits (139), Expect = 2.785e-7
Identity = 69/281 (24.56%), Postives = 125/281 (44.48%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETIS-IKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNES-NLP-GFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQP--------TSCHINQGDCTLVVEAFDHGSPSLSAYCYVTV 1067
            E +F ++ +TGV+  +N +D +S A     I     +   + L ++   ++ + DENDN P F   +    + EN  + + +    A+D D   FG   NY I     D+  +     V     L+       D E +++Y + +   D G    K  + V + +E  ++ +P F+   Y   L  +  LP G+ V +V A+D+DSG +  V YQ     S     F ++R SG++ + +          + +++  D +LV+ A      SLS+   V +
Sbjct: 2800 EHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFG-QLNYSIGPAPSDES-SWKMFRVDSESGLVTSAFV-FDYEQRQRYDMELLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHS----HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEI 3071          

HSP 41 Score: 57.3806 bits (137), Expect = 4.527e-7
Identity = 65/252 (25.79%), Postives = 111/252 (44.05%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLPQLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSD-----SEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESC--PGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNA----FSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGIN 8522
            FSI+  SG++S      +  S YTL+I+AS +        + +  + +   ++         +TGSV+E++       +IS  +  L  N     S     +W       + ++  I T  K +DRE+  +    V+  DG    + S   P  I V+D+NDN PIF    ++G V      G  ++ +  +DAD      + +SL   EN+A    F INP  G++  +Q++  E      ++V   D  N
Sbjct: 1895 FSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ---FAIDGQSGLITTVGK-LDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNA-ENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGN 2141          

HSP 42 Score: 56.225 bits (134), Expect = 1.300e-6
Identity = 47/191 (24.61%), Postives = 85/191 (44.50%), Query Frame = 3
Query: 9030 EITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNF 9602
            E+ + I SGN    F+I    G +  +  ++     + + LI++AC +        CS  +   L + D N   P+  ++E    ++E   VGS++ +    D D G  G +  +I  +  D  S   F  +  S  +      DYE + +Y + LLA D+G   K  +  V +++   D+ +P F  R +
Sbjct: 2789 EVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSH--HQRPLCSL-QPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTY 2974          

HSP 43 Score: 53.9138 bits (128), Expect = 6.383e-6
Identity = 98/445 (22.02%), Postives = 185/445 (41.57%), Query Frame = 3
Query: 8538 MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVI---ITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP---IAVLYTSQEGSRVANIAVNHDNLYGEITFFI-----ISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTV---------SISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNG------NSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQL--IVLPEVRDE-DSIMASRNEPSYTLKSKTSSKVQLFQSKTNFTLKILKRSTNE 9785
            ++I + D NDN P+ S+    K FV   SE  +   FV  + A D+D    +N+++RY +   N      + F++      +    V  N + D E  D+    I A+D G P +  + T+    +    ++   + TF  P   + V   ++ G+ + +I+ N  + Y  +T+ +     +     S F++   +G++   R ++   L Q + L        +++S +    R  +T+ ++D N  +P     +             ISE + V  +LL V+  D D+       + II    + FS+   P+NG      +  Q  V +  DY ++      ++A D G P    ++++ ++  D       F+   + A + E   L  +VL   +D  D  +A        +     S  +L QSK    +K L R  N+
Sbjct: 2308 LVIELEDENDNSPKFSQ----KQFVATVSEGNNKGTFVAQVHAFDSD--AGSNARLRYHIVDGNH----DNAFVIEPAFSGI----VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIV----DVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE-LQQEYEL-------DVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSV--HPSNGVVSVNMSRLQPAVSSSGDYFVR------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA-------IIAGNEESAFELLQSKAIVLVKPLDRERND 2710          
BLAST of Protocadherin Fat 4 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 174.481 bits (441), Expect = 1.869e-42
Identity = 250/1061 (23.56%), Postives = 447/1061 (42.13%), Query Frame = 3
Query: 3150 SFTVLAVNKNDKEKSTKVFVVIFVQDFND-------------NSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELD-----FVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGA---------FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGT---ILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAII---LPKSSFYREKIATLKAQSNSKNLNSRFMY-LLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNT--MIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWIN---EIPEFSLDKTSGIVTTSGVPLDHEAVAYF-IGKIQVSDGT--FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSV----NPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLH--RVTVEVLINLINVNDETPLIHNPTTVYLPKINQ 6146
            +F +    ++  +   ++ +V   Q+FND              SP F    Y  S+         +  V A DP+   +  V YS+  L   LD       ++DS++G + T+  +D    +  +F + A D   P  + +  + V +         F+ + F  +I E   +   +  L    Q +     + Y I   T             F I+  +G+I   + LDRE    + L + A D +S +     A  ++ V ++D NDN P F ++      + E    GT    +    A D D G N  +RY +   G  + S F ID+ SG + L +P+DYE    +  +I A D G P+  +   + V + + ND  PRF   S+ +  V +NV +G  + RV A D D   N  + Y  S    + P  ++P +G +    P+ +E    F   V+A D     +    SV + ++  +DN+       Y A +    P  +     + T+ A     + +SR  Y +   ++  +  I    G   +T    +++   +  FL+++ +  +D+  +  +  + +NI D +N    F+   Y   + E     G  +  + A       SD+       Y    E I    +     ++ +TG I V N  LDRE   G  +T   V    G N S    T V + + D NDN P F +  +     E+   G  +        D  L+  ++Y+  +   E   F +D TSG + T+   LD E+VA F +  I V  G+   +ST  + I ++D ND    F  D+   ++ E +P+ +V+G++   +     N ++ + I+     + FS+      +   + T  E+DYE       L+       ++   P        +LV+  D+NDN PV    ++  +   D   + EI ++ A DAD SD L + ILS N+  L+ +N  +G +  +  L+    +   + VS +DG++  +  +++ + LI  +    ++ N  TV L ++ +
Sbjct:  313 TFNIRCDRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSL---LDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF-SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAII--GGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYT-SQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGT----PVTTVTA--TDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQ-EKRFLLTVAA--TDSGGRSDTATVHINITDANNFAPIFENAPYSASVFE-DAPVGTTVLVVSAT-----DSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLT---VTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKG-LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVV------RAASPPLRNDAHIEILVT--DVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLITED----MLFNSVTVRLNEMTE 1331          

HSP 2 Score: 159.458 bits (402), Expect = 7.316e-38
Identity = 139/517 (26.89%), Postives = 236/517 (45.65%), Query Frame = 3
Query: 2937 PIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYG-----KWSIFXXXXXXXXXXXXXXXR-KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL---EIDHQQMVTYRISKCTQKGAFSINQHT--GIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRL---TATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVD 4427
            P F E  YT  V E+    T    ++ I++ + D  + + I  ++ G     ++SI S      L +    E  + Y   + A +     +S    +++ V D NDN+P F T  +  S+  +      I +V A D D G N  + YSI +         +D ++G + T K +D  EQ  F F + A+D G+P  ++S  V + +     +   F+ + +  N+ ED      +  +   + D    + Y I+    +G F+I      G+I +   LD +     +LT+ ATD+     +       +++NI D N+ +PIF+N   +  +  E   VGT +   +A D D G+N Q+ Y L   +  G+ S   F I+  +GA+  N P+D E    +   +TA D G P+L     V + +T++ND  P F K    +  + ++  +GT+V +V A DPD      + Y L      D  FVI+P SG +  +  + +E    F L  +AVD
Sbjct:  579 PQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA-VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDT-----ATVHINITDANNFAPIFENAPYSASVF-EDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF-KSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD 1087          

HSP 3 Score: 154.066 bits (388), Expect = 3.511e-36
Identity = 119/405 (29.38%), Postives = 195/405 (48.15%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGR---LFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKG-----AFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYY 4307
            + +++F V+A +     KS    VVI VQD NDN P F+ + Y  ++     P T +  V A DPD   +  ++Y I        F  I SQ+GR        L    E+ F+  + A D G    + +  V++ I  +      F+   +  ++ ED  +   +  +     ++     +TY +++ +  G      FSIN  TG I     LDRE  + ++LT+ A D  +   S+    T++ + + DVNDN+P FK+      IL E   VGT +    A+D D GLNG+++Y L+   +E  S F ID  SG +  N+ +D E    ++    A D G P L S + V + + ++ND  P F  + ++   V +N  +G+ VG ++A DPD   N V++Y
Sbjct:  757 QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFA-ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSD---TTDVEIGVTDVNDNAPAFKSPLYQASIL-EDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS-FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASD-KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY 1150          

HSP 4 Score: 152.525 bits (384), Expect = 8.535e-36
Identity = 145/531 (27.31%), Postives = 238/531 (44.82%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRES--------LASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTA---ATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNES---NLP-GFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYR-----DRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHARIKSTCPTQFILDDS 1796
            +F ++  +GVI T + +DRE+         A+DL      ++T       T S++V+++D+NDN P F       ++ E+    T+ +  A   ATD+D      +  Y I  GN   +F++  +     G + L  V+PLD E+   Y+L I  +D G P      ++ + V D NDN+P F    YT +  ES   N+P G+ +++V A D+D G N E+ Y   +         ++D ++G ++  +P      QG     V A D G P  SA   V + V  +N   P F   Y       A +   +    P+  V   D D+D R  +   I  GN    FA+   +G   ++   +++     + + +TV A D+G  S   TV   I I  AN + P+F N   S +V+ +A + + +    ATD D G+N +I YS+ +         D F+I   +G I    PL         L + A+D G  SL  T  +++ +   +      KS      IL+D+
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTA------TASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN-NAAIRYAIIGGNTQSQFSIDSMS----GDVSL--VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF----YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF--PLAVDPRTGWVQTIKPLD-REEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYY-----EANVGEDQPPGTPVTTVTATDPDEDSR--LHYEITTGNTRGRFAITSQNGR-GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA 1020          

HSP 5 Score: 135.961 bits (341), Expect = 8.040e-31
Identity = 136/509 (26.72%), Postives = 220/509 (43.22%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQL----------LLRVVRPLDRETKEKYKLTISVEDKGQPPLK---GVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFE---VVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY--IEIG-KVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAI--EKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDL 1721
            + LF ++  TGV+ TS  +DRE +      +     +   +   T +++V ++D ND+ P F   + E  I E   + + +    ATD D     +  N +IE G E       G G+    ++          ++     LDRET + Y L ++  D      +       V++ V D NDN P FS   YTV++ E    G E   V  + A+DAD G N  + Y      +  +++FSID  SG + L +P   + +     LV+ A D GSPS S    + V+VI  N   P+F   Y     ++    + +G  + R     V   D D+     I  SI   +D    A++   G V     IK +       +   V A D G P K  +  ++I +   N   P F  +Y    V  +    + +    ATD D   + ++ Y IT G+ R RFAI  +   GLIT+ + L + +  +  L + A D+G  S   T ++++
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRS-GTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQD-----IGKNAEIEYGIE---AVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT--QSQFSIDSMSGDVSLVKPLD-YESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF---YTSQFQESVLENVPVGYNIIR-----VQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQT---IKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI 887          

HSP 6 Score: 132.494 bits (332), Expect = 1.164e-29
Identity = 160/626 (25.56%), Postives = 256/626 (40.89%), Query Frame = 3
Query:  165 YNFRVSENQPINTIVGQVLIKFGFSYEFFHKE-------GLFNLNKLTG--VILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVS-------NNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCT---LVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDK-AAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGN--VHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLH----ARIKSTCPTQFILDDSNLLHSF------------SHIFIEDFSKQLELSDSNRITEIEFKIINPHTILTDFF 1928
            Y   V E+QP  T V  V           H E       G F +    G  +I  +  +D +     L+ +     T  G   +T ++ + I D N+  PIF        + E+  + T + + +ATDSD    GV+       N   I      D F+++       G ++     PLDRET   Y LT++ +D G P L    +VEI V D NDN+P F    Y   + E  L G  V++V ASD D G+N  ++Y     R + +  F ID  SG+IR    T+  +++       L   A D GSP LS+   V + +  +N   P F      ++DK   Y+         +  +H  D D+    ++  SIIGG+D N F+L    G+    +L   +  +    + + + VRA    +P  +    + I +   N   PV R+       +R+   +  I    A   DA ++ K+ Y I  G+  +   +   SG + +L P     + K     ++   GIN  +    L + ++  D L      R+       F+   S LL+ F             HIF+  FS Q +   S+RI  + F    P     +F+
Sbjct:  799 YEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTV---AATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDV---GVNAQITYSLNEESINGLGSPDPFSIN----PQTGAIVTNA--PLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD-RDIEDGSFVIDPTSGTIR----TNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF------ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPA--FDADVSDKLHYRILSGNNANLLRLNSSSGGL-VLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLITEDMLFNSVTVRLNEMTEEAFL---SPLLNFFLDGLAAIIPCPKEHIFV--FSIQDDTDVSSRILNVSFSARRPDVSHEEFY 1390          

HSP 7 Score: 124.79 bits (312), Expect = 2.319e-27
Identity = 127/517 (24.56%), Postives = 238/517 (46.03%), Query Frame = 3
Query: 2814 VDKNVNGRLIELRIELFDGLSGDLSVSNTEIIIEFHPIFDS-PIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDK-EKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPV----ELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRIS-KCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVT-NLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGA----LYLNQPVDYE-LKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYY 4307
            +D+   GR    ++   DG     S S++ ++I    + D+ P F   +Y   V E+    TP+  ++          H  I   +  G+++I S     L++     + KQ    +L V   D   +S    V I + D N+ +PIF    Y  S+       TT+  V A D D G+N  + YS+ +  +      D   I+ Q+G + TN  +D      ++  +TA+D G P L+ +  V + +     +   F    +  +I ED  +   + ++     ++     + Y +S +  + G+F I+  +G I     LDRE++A   LT +A D    KGS  L+ T  + + + DVND+ P F +D +  ++  E++ VG+++G   A+D D+G+N  V Y +   G +  + F + T  G+    L     +DYE  + ++  ++ A     P L ++  + + +T++ND  P   ++ ++ F   ++      +GR+ A D D ++ L+Y
Sbjct:  752 LDREEQGRFA-FQVVAKDGGVPPKSASSS-VVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD----KGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYV-PENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVL-RDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHY 1255          

HSP 8 Score: 112.464 bits (280), Expect = 1.307e-23
Identity = 165/642 (25.70%), Postives = 279/642 (43.46%), Query Frame = 3
Query: 7758 ATNVAIYNGTIYQTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISVSNNILSC-------NGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGII---ESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQ-GEENNAFSINPQNGS--VFLAQTVDRELKSKYEMKVAVSDGINVLEIGML-ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSEN-QRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVD---VIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDN--LYGEITFFIISGN---GSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTD-DRFSLVPFPTNGNSYQLKVVNPLDYE-IQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNF 9602
            A   AI  G   Q+ FSI+  SG +SL +PL  + V  Y L IRA      S+    +     I   DN  +     ++T   +E+    + V  NI+           N+++++++  +     L  +  T  ++T  KP+DRE        V+  DG  G+     S   +I V D+NDN P F   Y+   V E+   G+ +  +   D D     L + +  G     F+I  QNG   + +AQ++D + + ++ + VA +D     +   + I +TD+N+  P       N  +  +  E A     V+ ++ATD+D     N+QI YSL+ E+   +     F +N  +G     A+  N   D ET     + +TA D G P L  +  V              KS   Y  ++L  +  G+ V  +A +  +  L G I + +   +   GS  F I   +G I T++ ++   +  +  + I    G+  LSS         + + + D N   P     + T+ + E   VGS + ++   DPD G+  +V  +II   D + FSLV  P +  + QL  +  LDYE  + ++ L + A     P     + + I V D +DN+P  + R+F
Sbjct:  618 AIRYAIIGGNT-QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR-----FYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTI-KPLDREEQGRFAFQVVAKDG--GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR-LHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFE----NAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTG-----AIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL-YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS--FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTV------EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERA-QLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAP--VLRDF 1223          

HSP 9 Score: 109.383 bits (272), Expect = 1.107e-22
Identity = 125/492 (25.41%), Postives = 220/492 (44.72%), Query Frame = 3
Query: 8256 DLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFS----LQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-------GINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSS--------ENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVD---VIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP--IAVLYTSQ---------EGSRVANI-AVNHDNLY-GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVIS--DFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +L + SP F    ++  V E    G+ +  +   D +    P+ +S    L     + F ++ + G V  + ++DREL   +  +V  +D       G   L++ +L    D ND+ P    E     F  +  E A     V+ + ATD D  +  N++I Y + +        ++Q +P+   F ++  SG ++ ++       D ET D   +++TA+D        S        TA  ++++L     YP      YT Q         E + VA+I A + D      I + II GN  S FSI S +G +S  + ++   + + + L+++A            S+  T  L+++  D N  +P+   S+   S+ E + VG N+++V   D D G    +  +I +  DD F L   P  G    ++ + PLD E Q +++  ++A D G P KS +S V+I V D +DN P F  + + A++ E
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDS--PVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVL----DCNDHSPTFEAE----QFEASIREGATVGSTVITLRATDQDIGK--NAEIEYGIEAVTDGAGLAQDQEMPI---FRIDSRSGVISTRSSL-----DRETSDSYHLLVTAAD------LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESV-RSYRLVIRA------QDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-SERDDNFPLAVDPRTG---WVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGE 805          

HSP 10 Score: 104.76 bits (260), Expect = 2.581e-21
Identity = 144/575 (25.04%), Postives = 247/575 (42.96%), Query Frame = 3
Query: 4980 TMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDL--DSTLEY-----------IWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD------GTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHT---VIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQNHN-----IMIKCSDQDNLGPLSYDIMTS-SKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYTAFIKLERFEKSPLKIQSVFDK-------LIIPNDDKYVYFLLQSLYNLSEDDYNF------YLINPSTG 6566
            ++ ++D  TG ++  +  LDRE+++   +    VV        R   T + +N+ DCND+ P F  E F     E  T G  +   T++A D+D+  ++ +EY               E+P F +D  SG+++T    LD E    +   +  +D         T+TA++ + + D ND    F+   Y   + E     T    +  +   ++    N  I++ I+    +  FS++   G ++    +DYE    Y L+I A D    S       + TT +LV+++D NDN P F T++   S+ E+VP+   II++ A D+D+     + + I   +D+  + V+P TG + T   LD E+  R A  V   DG       +  V+I + +VND  P   NP   Y   + ++         +  +D D    L Y+I T  ++    I      G ++    L Y       L+ + T      + + + +  N +  N  A I    FE +P    SVF+        L++   D  V    Q  Y+L+E+  N       + INP TG
Sbjct:  405 SLFKVDSRTGVVTT-SASLDRELMD---VHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVI--TLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSS-LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPS------RSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-NP-KYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHI--NITDANNFAPI----FENAPYSA-SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG 957          

HSP 11 Score: 96.6709 bits (239), Expect = 7.065e-19
Identity = 116/483 (24.02%), Postives = 212/483 (43.89%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSL----------QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINV------LEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNI---FVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITA-ECELRILKSTFQYPIAVLYTSQEGSRVANIAV--NHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            + V+D ND+SP F    F   + E A +GS +I +   D D  K   +++ +          Q +E   F I+ ++G +    ++DRE    Y + V  +D  +           + + V D NDN PQ S+    +T+ +   E   G      V +I ATDAD  Q NN+ IRY++   N     +S F ++  SG +++    L++ S   +  ++I A D G P   ++  +    I A +   R   S FQ   +VL     G  +  +    + +    EIT+ I   + +   ++  + G + T + ++    G++ F ++ +  G    S+ S      ++ + + D N   P         ++ E    G+ +  V   DPD       ++T   +T  RF++     NG    + +   LDY+ + ++ LT+ A D G   +S T+ V I + D ++ +P F +  + AS+ E
Sbjct:  452 VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSE----RTYTVQVPEDQWGGTEDNTVAHIRATDAD--QGNNAAIRYAIIGGN----TQSQFSIDSMSGDVSL-VKPLDYES-VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE--SVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASS------SVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-TGNTRGRFAIT--SQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFE 908          

HSP 12 Score: 96.2857 bits (238), Expect = 8.933e-19
Identity = 129/512 (25.20%), Postives = 224/512 (43.75%), Query Frame = 3
Query: 8157 VDREVYNNLEISVIIADGSGGIIESCPGI----IKVIDLNDNSPIFTLNYFMGFVSENALIGS---WIIDIGVIDAD-SKLFPLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE---IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSL-TIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQ---YPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQ--ISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTI-ITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLI 9635
            +DRE  ++  + V  AD +    E         +KV+D NDN P F+   +   V E+   G+    +  I   DAD      +++++  G   + FSI+  +G V L + +D E    Y + +   DG +        +L+ V D+NDN P+       ++ + N          ++ + A D+D+    N++I YS+S  +   P+     ++  +G + TIK +      +       + A D G PP   S +V    IT + ++      F    Y   V      G+ V  +     +    + + I +GN    F+I S+NG+  I+ +++++     + F L V A  +   S  +      T+ + I+D N ++P    +  + S+ E   VG+ +L V   D D G+   +  ++   S +   S  PF  N  +  +    PLD E    Y LT+ A D G P  S T+ V I V D +DN+P F S  + AS+ E D L+
Sbjct:  536 LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPV----GYNIIRVQAYDSDEGA--NAEITYSISERDDNFPLA----VDPRTGWVQTIKPLDRE---EQGRFAFQVVAKDGGVPPKSASSSV---VITVQ-DVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYK-QEKRFLLTVAATDSGGRSDTA------TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE-DALV 1022          

HSP 13 Score: 76.6406 bits (187), Expect = 7.912e-13
Identity = 89/328 (27.13%), Postives = 147/328 (44.82%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFIT--AEDHGIPRLNSSVKVYVKINPSPKSKQFF--DKQTFFQNISEDMKITEKIFKLEIDH-----QQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAV----------TNLYVNIIDVNDNSPIFKNDAL--NNFILS-ESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLN 4064
            Y  TV A +  +   S    V I V D NDN+P F +  Y  SI       T++ +V A DPD G+NG + Y +    +E     ID  SG + TNK +D  E   +F +T  A D G P L+S+V+V +++     S   F  DK T +  + E+  +   + ++           +V Y I       AFS         L+ R   E     +LT+   D  ST+    L V           ++ + + DVNDN+P+ ++  +  NNF     S ++G I  F      D  ++ ++ YR+ +    + ++ ++++ SG L L+
Sbjct:  973 YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLD-RESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLY--VPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFS---------LVTRPGSERA--QLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAF------DADVSDKLHYRILSG--NNANLLRLNSSSGGLVLS 1278          

HSP 14 Score: 59.6918 bits (143), Expect = 1.072e-7
Identity = 92/359 (25.63%), Postives = 160/359 (44.57%), Query Frame = 3
Query: 7755 YATNVAIYNGTIYQTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENS---DSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYY-NAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP-LKFS-LQGEENNAFSINPQNGS----VFLAQTVDRE-LKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISK-EIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTI 8789
            Y+ N    NG      FSIN ++G I  N PL  +  S Y L + A     N  +    D ++ ++  ++         +  S+ E++    S I V+ +      N ++ + L  +  +D  +  +  +  IRT +K +DRE      ++ I  D GS  +  +    I++ D+ND+ P F  +    +V EN+ +GS + +I   D D  +   + +S + G+++NAFS+  + GS    +     +D E  + ++E+ V  +      +  + I VTD NDN P +   ++I   F      F  G I    I A DAD S     ++ Y + S N      +L  LN  SG L +
Sbjct:  934 YSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAK-DGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRT-NKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNF---RDHFPSGEIG--RIPAFDADVSD----KLHYRILSGNN----ANLLRLNSSSGGLVL 1277          
BLAST of Protocadherin Fat 4 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 174.481 bits (441), Expect = 1.869e-42
Identity = 250/1061 (23.56%), Postives = 447/1061 (42.13%), Query Frame = 3
Query: 3150 SFTVLAVNKNDKEKSTKVFVVIFVQDFND-------------NSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELD-----FVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGA---------FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGT---ILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAII---LPKSSFYREKIATLKAQSNSKNLNSRFMY-LLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNT--MIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWIN---EIPEFSLDKTSGIVTTSGVPLDHEAVAYF-IGKIQVSDGT--FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSV----NPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLH--RVTVEVLINLINVNDETPLIHNPTTVYLPKINQ 6146
            +F +    ++  +   ++ +V   Q+FND              SP F    Y  S+         +  V A DP+   +  V YS+  L   LD       ++DS++G + T+  +D    +  +F + A D   P  + +  + V +         F+ + F  +I E   +   +  L    Q +     + Y I   T             F I+  +G+I   + LDRE    + L + A D +S +     A  ++ V ++D NDN P F ++      + E    GT    +    A D D G N  +RY +   G  + S F ID+ SG + L +P+DYE    +  +I A D G P+  +   + V + + ND  PRF   S+ +  V +NV +G  + RV A D D   N  + Y  S    + P  ++P +G +    P+ +E    F   V+A D     +    SV + ++  +DN+       Y A +    P  +     + T+ A     + +SR  Y +   ++  +  I    G   +T    +++   +  FL+++ +  +D+  +  +  + +NI D +N    F+   Y   + E     G  +  + A       SD+       Y    E I    +     ++ +TG I V N  LDRE   G  +T   V    G N S    T V + + D NDN P F +  +     E+   G  +        D  L+  ++Y+  +   E   F +D TSG + T+   LD E+VA F +  I V  G+   +ST  + I ++D ND    F  D+   ++ E +P+ +V+G++   +     N ++ + I+     + FS+      +   + T  E+DYE       L+       ++   P        +LV+  D+NDN PV    ++  +   D   + EI ++ A DAD SD L + ILS N+  L+ +N  +G +  +  L+    +   + VS +DG++  +  +++ + LI  +    ++ N  TV L ++ +
Sbjct:  313 TFNIRCDRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSL---LDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF-SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAII--GGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYT-SQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGT----PVTTVTA--TDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQ-EKRFLLTVAA--TDSGGRSDTATVHINITDANNFAPIFENAPYSASVFE-DAPVGTTVLVVSAT-----DSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLT---VTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKG-LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVV------RAASPPLRNDAHIEILVT--DVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLITED----MLFNSVTVRLNEMTE 1331          

HSP 2 Score: 159.458 bits (402), Expect = 7.316e-38
Identity = 139/517 (26.89%), Postives = 236/517 (45.65%), Query Frame = 3
Query: 2937 PIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYG-----KWSIFXXXXXXXXXXXXXXXR-KQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL---EIDHQQMVTYRISKCTQKGAFSINQHT--GIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRL---TATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVD 4427
            P F E  YT  V E+    T    ++ I++ + D  + + I  ++ G     ++SI S      L +    E  + Y   + A +     +S    +++ V D NDN+P F T  +  S+  +      I +V A D D G N  + YSI +         +D ++G + T K +D  EQ  F F + A+D G+P  ++S  V + +     +   F+ + +  N+ ED      +  +   + D    + Y I+    +G F+I      G+I +   LD +     +LT+ ATD+     +       +++NI D N+ +PIF+N   +  +  E   VGT +   +A D D G+N Q+ Y L   +  G+ S   F I+  +GA+  N P+D E    +   +TA D G P+L     V + +T++ND  P F K    +  + ++  +GT+V +V A DPD      + Y L      D  FVI+P SG +  +  + +E    F L  +AVD
Sbjct:  579 PQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA-VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDT-----ATVHINITDANNFAPIFENAPYSASVF-EDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF-KSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD 1087          

HSP 3 Score: 154.066 bits (388), Expect = 3.511e-36
Identity = 119/405 (29.38%), Postives = 195/405 (48.15%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGR---LFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKG-----AFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYY 4307
            + +++F V+A +     KS    VVI VQD NDN P F+ + Y  ++     P T +  V A DPD   +  ++Y I        F  I SQ+GR        L    E+ F+  + A D G    + +  V++ I  +      F+   +  ++ ED  +   +  +     ++     +TY +++ +  G      FSIN  TG I     LDRE  + ++LT+ A D  +   S+    T++ + + DVNDN+P FK+      IL E   VGT +    A+D D GLNG+++Y L+   +E  S F ID  SG +  N+ +D E    ++    A D G P L S + V + + ++ND  P F  + ++   V +N  +G+ VG ++A DPD   N V++Y
Sbjct:  757 QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFA-ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSD---TTDVEIGVTDVNDNAPAFKSPLYQASIL-EDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS-FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASD-KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY 1150          

HSP 4 Score: 152.525 bits (384), Expect = 8.535e-36
Identity = 145/531 (27.31%), Postives = 238/531 (44.82%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRES--------LASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTA---ATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNES---NLP-GFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYR-----DRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLHARIKSTCPTQFILDDS 1796
            +F ++  +GVI T + +DRE+         A+DL      ++T       T S++V+++D+NDN P F       ++ E+    T+ +  A   ATD+D      +  Y I  GN   +F++  +     G + L  V+PLD E+   Y+L I  +D G P      ++ + V D NDN+P F    YT +  ES   N+P G+ +++V A D+D G N E+ Y   +         ++D ++G ++  +P      QG     V A D G P  SA   V + V  +N   P F   Y       A +   +    P+  V   D D+D R  +   I  GN    FA+   +G   ++   +++     + + +TV A D+G  S   TV   I I  AN + P+F N   S +V+ +A + + +    ATD D G+N +I YS+ +         D F+I   +G I    PL         L + A+D G  SL  T  +++ +   +      KS      IL+D+
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTA------TASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN-NAAIRYAIIGGNTQSQFSIDSMS----GDVSL--VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF----YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF--PLAVDPRTGWVQTIKPLD-REEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYY-----EANVGEDQPPGTPVTTVTATDPDEDSR--LHYEITTGNTRGRFAITSQNGR-GLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA 1020          

HSP 5 Score: 135.961 bits (341), Expect = 8.040e-31
Identity = 136/509 (26.72%), Postives = 220/509 (43.22%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQL----------LLRVVRPLDRETKEKYKLTISVEDKGQPPLK---GVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFE---VVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAY--IEIG-KVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAI--EKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDL 1721
            + LF ++  TGV+ TS  +DRE +      +     +   +   T +++V ++D ND+ P F   + E  I E   + + +    ATD D     +  N +IE G E       G G+    ++          ++     LDRET + Y L ++  D      +       V++ V D NDN P FS   YTV++ E    G E   V  + A+DAD G N  + Y      +  +++FSID  SG + L +P   + +     LV+ A D GSPS S    + V+VI  N   P+F   Y     ++    + +G  + R     V   D D+     I  SI   +D    A++   G V     IK +       +   V A D G P K  +  ++I +   N   P F  +Y    V  +    + +    ATD D   + ++ Y IT G+ R RFAI  +   GLIT+ + L + +  +  L + A D+G  S   T ++++
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRS-GTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQD-----IGKNAEIEYGIE---AVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT--QSQFSIDSMSGDVSLVKPLD-YESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF---YTSQFQESVLENVPVGYNIIR-----VQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQT---IKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI 887          

HSP 6 Score: 132.494 bits (332), Expect = 1.164e-29
Identity = 160/626 (25.56%), Postives = 256/626 (40.89%), Query Frame = 3
Query:  165 YNFRVSENQPINTIVGQVLIKFGFSYEFFHKE-------GLFNLNKLTG--VILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVS-------NNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCT---LVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDK-AAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGN--VHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNILQSDQLH----ARIKSTCPTQFILDDSNLLHSF------------SHIFIEDFSKQLELSDSNRITEIEFKIINPHTILTDFF 1928
            Y   V E+QP  T V  V           H E       G F +    G  +I  +  +D +     L+ +     T  G   +T ++ + I D N+  PIF        + E+  + T + + +ATDSD    GV+       N   I      D F+++       G ++     PLDRET   Y LT++ +D G P L    +VEI V D NDN+P F    Y   + E  L G  V++V ASD D G+N  ++Y     R + +  F ID  SG+IR    T+  +++       L   A D GSP LS+   V + +  +N   P F      ++DK   Y+         +  +H  D D+    ++  SIIGG+D N F+L    G+    +L   +  +    + + + VRA    +P  +    + I +   N   PV R+       +R+   +  I    A   DA ++ K+ Y I  G+  +   +   SG + +L P     + K     ++   GIN  +    L + ++  D L      R+       F+   S LL+ F             HIF+  FS Q +   S+RI  + F    P     +F+
Sbjct:  799 YEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTV---AATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDV---GVNAQITYSLNEESINGLGSPDPFSIN----PQTGAIVTNA--PLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD-RDIEDGSFVIDPTSGTIR----TNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF------ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPA--FDADVSDKLHYRILSGNNANLLRLNSSSGGL-VLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLITEDMLFNSVTVRLNEMTEEAFL---SPLLNFFLDGLAAIIPCPKEHIFV--FSIQDDTDVSSRILNVSFSARRPDVSHEEFY 1390          

HSP 7 Score: 124.79 bits (312), Expect = 2.319e-27
Identity = 127/517 (24.56%), Postives = 238/517 (46.03%), Query Frame = 3
Query: 2814 VDKNVNGRLIELRIELFDGLSGDLSVSNTEIIIEFHPIFDS-PIFFEPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDK-EKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPV----ELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRIS-KCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVT-NLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGA----LYLNQPVDYE-LKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYY 4307
            +D+   GR    ++   DG     S S++ ++I    + D+ P F   +Y   V E+    TP+  ++          H  I   +  G+++I S     L++     + KQ    +L V   D   +S    V I + D N+ +PIF    Y  S+       TT+  V A D D G+N  + YS+ +  +      D   I+ Q+G + TN  +D      ++  +TA+D G P L+ +  V + +     +   F    +  +I ED  +   + ++     ++     + Y +S +  + G+F I+  +G I     LDRE++A   LT +A D    KGS  L+ T  + + + DVND+ P F +D +  ++  E++ VG+++G   A+D D+G+N  V Y +   G +  + F + T  G+    L     +DYE  + ++  ++ A     P L ++  + + +T++ND  P   ++ ++ F   ++      +GR+ A D D ++ L+Y
Sbjct:  752 LDREEQGRFA-FQVVAKDGGVPPKSASSS-VVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD----KGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYV-PENSPVGSVVGEIHAHDPDEGVNAVVHYSI--IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVL-RDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHY 1255          

HSP 8 Score: 112.464 bits (280), Expect = 1.307e-23
Identity = 165/642 (25.70%), Postives = 279/642 (43.46%), Query Frame = 3
Query: 7758 ATNVAIYNGTIYQTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISVSNNILSC-------NGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGII---ESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQ-GEENNAFSINPQNGS--VFLAQTVDRELKSKYEMKVAVSDGINVLEIGML-ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSEN-QRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVD---VIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDN--LYGEITFFIISGN---GSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTD-DRFSLVPFPTNGNSYQLKVVNPLDYE-IQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNF 9602
            A   AI  G   Q+ FSI+  SG +SL +PL  + V  Y L IRA      S+    +     I   DN  +     ++T   +E+    + V  NI+           N+++++++  +     L  +  T  ++T  KP+DRE        V+  DG  G+     S   +I V D+NDN P F   Y+   V E+   G+ +  +   D D     L + +  G     F+I  QNG   + +AQ++D + + ++ + VA +D     +   + I +TD+N+  P       N  +  +  E A     V+ ++ATD+D     N+QI YSL+ E+   +     F +N  +G     A+  N   D ET     + +TA D G P L  +  V              KS   Y  ++L  +  G+ V  +A +  +  L G I + +   +   GS  F I   +G I T++ ++   +  +  + I    G+  LSS         + + + D N   P     + T+ + E   VGS + ++   DPD G+  +V  +II   D + FSLV  P +  + QL  +  LDYE  + ++ L + A     P     + + I V D +DN+P  + R+F
Sbjct:  618 AIRYAIIGGNT-QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR-----FYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTI-KPLDREEQGRFAFQVVAKDG--GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSR-LHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFE----NAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTG-----AIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL-YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS--FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTV------EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERA-QLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAP--VLRDF 1223          

HSP 9 Score: 109.383 bits (272), Expect = 1.107e-22
Identity = 125/492 (25.41%), Postives = 220/492 (44.72%), Query Frame = 3
Query: 8256 DLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFS----LQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-------GINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSS--------ENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVD---VIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYP--IAVLYTSQ---------EGSRVANI-AVNHDNLY-GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVIS--DFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +L + SP F    ++  V E    G+ +  +   D +    P+ +S    L     + F ++ + G V  + ++DREL   +  +V  +D       G   L++ +L    D ND+ P    E     F  +  E A     V+ + ATD D  +  N++I Y + +        ++Q +P+   F ++  SG ++ ++       D ET D   +++TA+D        S        TA  ++++L     YP      YT Q         E + VA+I A + D      I + II GN  S FSI S +G +S  + ++   + + + L+++A            S+  T  L+++  D N  +P+   S+   S+ E + VG N+++V   D D G    +  +I +  DD F L   P  G    ++ + PLD E Q +++  ++A D G P KS +S V+I V D +DN P F  + + A++ E
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDS--PVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVL----DCNDHSPTFEAE----QFEASIREGATVGSTVITLRATDQDIGK--NAEIEYGIEAVTDGAGLAQDQEMPI---FRIDSRSGVISTRSSL-----DRETSDSYHLLVTAAD------LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESV-RSYRLVIRA------QDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-SERDDNFPLAVDPRTG---WVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGE 805          

HSP 10 Score: 104.76 bits (260), Expect = 2.581e-21
Identity = 144/575 (25.04%), Postives = 247/575 (42.96%), Query Frame = 3
Query: 4980 TMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDL--DSTLEY-----------IWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSD------GTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHT---VIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQNHN-----IMIKCSDQDNLGPLSYDIMTS-SKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDTIHNTIKNVSLIVLDRNRSSKNYTAFIKLERFEKSPLKIQSVFDK-------LIIPNDDKYVYFLLQSLYNLSEDDYNF------YLINPSTG 6566
            ++ ++D  TG ++  +  LDRE+++   +    VV        R   T + +N+ DCND+ P F  E F     E  T G  +   T++A D+D+  ++ +EY               E+P F +D  SG+++T    LD E    +   +  +D         T+TA++ + + D ND    F+   Y   + E     T    +  +   ++    N  I++ I+    +  FS++   G ++    +DYE    Y L+I A D    S       + TT +LV+++D NDN P F T++   S+ E+VP+   II++ A D+D+     + + I   +D+  + V+P TG + T   LD E+  R A  V   DG       +  V+I + +VND  P   NP   Y   + ++         +  +D D    L Y+I T  ++    I      G ++    L Y       L+ + T      + + + +  N +  N  A I    FE +P    SVF+        L++   D  V    Q  Y+L+E+  N       + INP TG
Sbjct:  405 SLFKVDSRTGVVTT-SASLDRELMD---VHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVI--TLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSS-LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPS------RSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-NP-KYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHI--NITDANNFAPI----FENAPYSA-SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG 957          

HSP 11 Score: 96.6709 bits (239), Expect = 7.065e-19
Identity = 116/483 (24.02%), Postives = 212/483 (43.89%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSL----------QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINV------LEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNI---FVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITA-ECELRILKSTFQYPIAVLYTSQEGSRVANIAV--NHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            + V+D ND+SP F    F   + E A +GS +I +   D D  K   +++ +          Q +E   F I+ ++G +    ++DRE    Y + V  +D  +           + + V D NDN PQ S+    +T+ +   E   G      V +I ATDAD  Q NN+ IRY++   N     +S F ++  SG +++    L++ S   +  ++I A D G P   ++  +    I A +   R   S FQ   +VL     G  +  +    + +    EIT+ I   + +   ++  + G + T + ++    G++ F ++ +  G    S+ S      ++ + + D N   P         ++ E    G+ +  V   DPD       ++T   +T  RF++     NG    + +   LDY+ + ++ LT+ A D G   +S T+ V I + D ++ +P F +  + AS+ E
Sbjct:  452 VNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSE----RTYTVQVPEDQWGGTEDNTVAHIRATDAD--QGNNAAIRYAIIGGN----TQSQFSIDSMSGDVSL-VKPLDYES-VRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE--SVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASS------SVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-TGNTRGRFAIT--SQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFE 908          

HSP 12 Score: 96.2857 bits (238), Expect = 8.933e-19
Identity = 129/512 (25.20%), Postives = 224/512 (43.75%), Query Frame = 3
Query: 8157 VDREVYNNLEISVIIADGSGGIIESCPGI----IKVIDLNDNSPIFTLNYFMGFVSENALIGS---WIIDIGVIDAD-SKLFPLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLE---IGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSL-TIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQ---YPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQ--ISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTI-ITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQLI 9635
            +DRE  ++  + V  AD +    E         +KV+D NDN P F+   +   V E+   G+    +  I   DAD      +++++  G   + FSI+  +G V L + +D E    Y + +   DG +        +L+ V D+NDN P+       ++ + N          ++ + A D+D+    N++I YS+S  +   P+     ++  +G + TIK +      +       + A D G PP   S +V    IT + ++      F    Y   V      G+ V  +     +    + + I +GN    F+I S+NG+  I+ +++++     + F L V A  +   S  +      T+ + I+D N ++P    +  + S+ E   VG+ +L V   D D G+   +  ++   S +   S  PF  N  +  +    PLD E    Y LT+ A D G P  S T+ V I V D +DN+P F S  + AS+ E D L+
Sbjct:  536 LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPV----GYNIIRVQAYDSDEGA--NAEITYSISERDDNFPLA----VDPRTGWVQTIKPLDRE---EQGRFAFQVVAKDGGVPPKSASSSV---VITVQ-DVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYK-QEKRFLLTVAATDSGGRSDTA------TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE-DALV 1022          

HSP 13 Score: 76.6406 bits (187), Expect = 7.912e-13
Identity = 89/328 (27.13%), Postives = 147/328 (44.82%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFIT--AEDHGIPRLNSSVKVYVKINPSPKSKQFF--DKQTFFQNISEDMKITEKIFKLEIDH-----QQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAV----------TNLYVNIIDVNDNSPIFKNDAL--NNFILS-ESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLN 4064
            Y  TV A +  +   S    V I V D NDN+P F +  Y  SI       T++ +V A DPD G+NG + Y +    +E     ID  SG + TNK +D  E   +F +T  A D G P L+S+V+V +++     S   F  DK T +  + E+  +   + ++           +V Y I       AFS         L+ R   E     +LT+   D  ST+    L V           ++ + + DVNDN+P+ ++  +  NNF     S ++G I  F      D  ++ ++ YR+ +    + ++ ++++ SG L L+
Sbjct:  973 YLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLD-RESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLY--VPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFS---------LVTRPGSERA--QLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAF------DADVSDKLHYRILSG--NNANLLRLNSSSGGLVLS 1278          

HSP 14 Score: 59.6918 bits (143), Expect = 1.072e-7
Identity = 92/359 (25.63%), Postives = 160/359 (44.57%), Query Frame = 3
Query: 7755 YATNVAIYNGTIYQTFFSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENS---DSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYY-NAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP-LKFS-LQGEENNAFSINPQNGS----VFLAQTVDRE-LKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISK-EIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTI 8789
            Y+ N    NG      FSIN ++G I  N PL  +  S Y L + A     N  +    D ++ ++  ++         +  S+ E++    S I V+ +      N ++ + L  +  +D  +  +  +  IRT +K +DRE      ++ I  D GS  +  +    I++ D+ND+ P F  +    +V EN+ +GS + +I   D D  +   + +S + G+++NAFS+  + GS    +     +D E  + ++E+ V  +      +  + I VTD NDN P +   ++I   F      F  G I    I A DAD S     ++ Y + S N      +L  LN  SG L +
Sbjct:  934 YSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAK-DGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRT-NKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNF---RDHFPSGEIG--RIPAFDADVSD----KLHYRILSGNN----ANLLRLNSSSGGLVL 1277          
BLAST of Protocadherin Fat 4 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 234.958 bits (598), Expect = 1.496e-60
Identity = 258/1106 (23.33%), Postives = 497/1106 (44.94%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVD---VVEQE----FIFFITAEDHGIPRL---NSSVKVYVK-INPSPKSKQFFDKQTFFQNISEDMKITEKIFKL---EIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPP-DHPFVINPISGILSVSNPILQEVS--FDLVVMAVD----AERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYV---GTVQAH-----DKDLDSTLEYIWINEIPE-FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTV----EVLINLINVNDETPLI-HNPTTVYLPKINQNHNIM--IKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSD 6326
            + +YS  V+A ++  +  S  V V I + D NDN P+F++ +Y F      +    +G+VFA D D G N  V YS E    + +F E+++ +G L +   +D   ++ Q     F F + + D G+P+     + V+VY++ IN +P     F K  +  +I+E  +   ++ ++   ++D  +  +V Y I++  ++  FSI+ ++G + L+ +LD E    + L I+A D+ S   S       L ++++D NDNSP F    L+  +L E+ ++G ++   TA D D G N  + Y ++AT       F I   +G+++L + +DYE +  +   +TA D G P+  S++ V + + + ND  P F      + I  +N+ I T+V  + A D D   N +L Y  ++  P    F I+ +SG++  +  I +E S  F+L + A D    AE + R+  ++V + +   N++    ++  A++   +      + T+ A    +  N    Y L     D  I++RY+GD+ L S    +     + + + + +    T  K   T+L + +       F +  Y   + E +   G  +  L A  P    + +EY+I  +  G     K    +  + + +G I      LDRE                   GS +    V+    D    R   A  +F+F       +  K+ +   G ++ H      +  ++ + Y  I+   + F +D  SG ++ +   LD E  + +   ++  DG  +S   + I + D ND    F+   Y F I E     +++  +   +  +  N  I + +  +     F +NP  G+      +D+E    +IL + A D   +S         +  V  +++D+ND+ P+F+++    SI E +   + ++ + A+D D   S  LL  +     D   ++NP TG+I T+ +LD E    + L V  +DG     +     V + + ++ND  P   H+P   ++P      +++  +  +D+D+          + ++ +   +D I G ++ +  L  ++ +  ++   D
Sbjct: 1047 QDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFET--PQSNF-ELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPK---FTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCV---LSISVLDDNDNSPSFPKSTLSVDVL-ENMRIGELVASVTATDSDSGSNADITYSISATNNH--GTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSI-PENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFR-RFALKNVTIWVTDQNDNIPTFISQNALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFIMDRYSGDIRLAS----QLIPSKLIYSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKYITILKEGQPA-GTNVISLDASSPRGAGTKVEYFIVSVRSG----GKAAGRLFTIGRHSGVIQTA-AELDRE------------------QGSDLYLLDVYAIETDAKQPRTQHAEVSFLFD------FFFKVMLLLKGNLREHISQTCAEGANALVTYAIISGADDSFRIDPESGELSATRR-LDRERRSKYSLLVRADDGQQSSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADGGGRS--------SSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGSSEVTFTVHVKD 2095          

HSP 2 Score: 232.261 bits (591), Expect = 1.136e-59
Identity = 165/532 (31.02%), Postives = 265/532 (49.81%), Query Frame = 3
Query:  120 FLILMILCVKFLSSQ--YNFRVSENQPINTIVGQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNN-YKIESGNEDDRFALSGVGVQYRGQ---LLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDL-IAVSIIGGNDENIFALERTH-GNVHILRQIKAIHNINLQSYTITVRAIDNGNP-SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGI 1688
             L+   L    +SSQ    F V E QP+ T VG +  K  F+Y F  +  LF++N  TGVI TS++IDRE L  ++I + +    L  Q      +++ ++D NDN P+F    +     E+ +    + L  ATD+D    GV +  Y+I SGN+  +F L  + V   G+   L L     LDRET   Y+L I VEDKG+P   G L+V + ++D NDN P F   +Y   + E    G  V+++ ASD D G N E+ Y   +        F ID K+G++ + +       + + +L + A D+G PSL      TV ++ +N   P  +  Y  +T K A ++        +A++   D D    +  I+VSI+GGN++  F +  +   N+ +++    +    + SY +TV   DNG P ++ +   ++I +N  N + P+F+     V +  +    S+I    ATD D+G N  + YS+  G+    FAI ++SGL+T    L      +I L I A+D G+
Sbjct:   24 LLVFWTLSRCSVSSQVRQEFEVLEEQPVGTYVGTIETKPAFTYRFSEQHKLFSINATTGVIYTSSVIDREVLPGNIINVVV----LSSQPTYPTEVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLD-ITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEG-----TPFQIDPKAGTVVIKEGLDYETKR-EYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGL 544          

HSP 3 Score: 204.527 bits (519), Expect = 2.643e-51
Identity = 219/920 (23.80%), Postives = 395/920 (42.93%), Query Frame = 3
Query: 10608 SGHLSVDRKGIIRIRKSIDKESVDSLTVQSSIQFKG---KSELLTLTVNVNDENDSESKSRITDIFIGIAENAFQLTRIAQLLPIDPDITGDFQCRLDTLNVPLGILIT-PDCWLHIINTSSAIRSINNSY-MRILHHDGYHNAVVSSFRMKVNLLNNKNIQTNWIV---FKIPNLFITSXXXX-XXXXXXXXXXXNVDVALMAIETVKN--YLVIWPRSP-----NREKALQVVEQFKDKLEVVLKIEIQEITIRLCNRKLCNSHGLCSIGIQVNYEQLFTDEDSITANIIYIYPSVNFNIKCLCDDGFLGEKCAL-LAKCRQQVCHNGGVCGVNRNGEAVCECAPGYTGYNCEYDINECEKTNLCTPHGNCNNIRGGFKCECQLNWIGNGLCTQPFNYCSSNPCSELGTERCIPILGGFKCRCHFGNFGDHCQYSAISFPAESYMEMDFQKISK----MSLEFSTILKDTPLX----XXXXXXXXXXXXXXXXGSIRLSIFEDSALVSQRDSNKDLSNGNWWKLDXXXXXXXXXXXXXACEDWNQCDHTIDQFRTIRQRFDVSSSMGRNNVDSNSIIRVLIGSIQKLKLSGVQYFVGCARNLQF-FNGSLIRNEQKGV---LFDSCPRYRNGIL--PCSNSDLECGNVGKCIDEWFASRCECPPGYQPPSCTPGYSSYALAPNTIISFVKRPKSDSTNSNSPKNFDSYLKRK-----RSVSPEYTMISIRIKTRDRNSIIFMALSSFHSYTLVQLENGLVKVVDKY--AGSYQEMLHKVVTVNDDKIHTITVTRHSTGTVSVTVDFVVAQVNWLQSHDILGHSVNEVYLAGLP-DLKKIENSLSFPNFVGCISDVRFNNKTMPLRGLSENFNVSIIQGSVTSGCSSDICRQSGVCEKYQKCLEIDGIPHAIWGQYKCV 13250
            S + ++   G +   + +D+E +    +   I+  G    S   T+ + VND+ND+ S+SR  +I++    N F    +  + P DPDI   FQC   +L  P  +L + P     +I+ S   RS + ++ + +  +DG H+AV S  R+     NN  +  + ++    K  + F+++   + L+I  + L  L   V +  +  + N  +L    +       N        +  K+ L     ++I  +    C+   C + G C   + V  E     E+S+   ++   P   +   C C  G+ G  C   + +C+   CHNGG C  N  G   C C  G+TG  CE D+NEC  +N C     C N  GGF C C+  + G   C    NYC  NPC   G+  C   + G+ C C FG FG HC+ ++  F   SY  M+F  +      + ++F+T+ ++  L+    +     +  + + +  G +R S    S       S + +S+G +  +       +  +++  C +  +  +       +   + +     R +V     +R +   + +        FVGC   ++F  NG  +   Q      + D CPR     +  PC +        G C+D W   +C+C  G+  P+C           +T +S     + D   S S K  D  L+R      RSV  +++ + ++ +TR  +  +  A  S++ YT ++L+ GL++ V     AG  +  +  V+ ++D + HT+ + R+ + TV + +D   +++    + D  G  V+ + L G+P   +   ++L F    GC + V++N + +P  G     ++S    SV  GC      +S  C     C+         W  Y+CV
Sbjct: 3110 SSYFTISPTGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDNPSESRSVEIYVHYFGNMFPGGSLGVVKPQDPDIQDTFQC---SLTPPAALLFSIPTGTCDLISNS---RSTDGTFDLSVRSNDGVHSAVNSHVRVFFIGFNNATVDNSILIRVTTKSASDFLSNHYLSFLRIANSQLAGLGTGVQIYGVFELNNSTFLTAAVKRGHSQYVNPSGVATFFQSIKEVLHRQSGVKIDSVDHDPCSHNPCQNGGSCKRRLGVGPE--MKTEESVPVILVSNQPLQPY--ACNCRPGYAGALCETDIDECQPTPCHNGGTCH-NLVGGFSCTCPDGFTGMACERDVNEC-LSNPCQNGALCQNYPGGFNCLCKSGFAGKA-CDSVINYCECNPCFNGGS--CQNRVEGYYCHCPFGVFGKHCELNSYGFEELSY--MEFPSLDPNNNYIYIKFATLKENALLMYNHDNQTGDKAEFLALEILEGRMRFSFNLGSGAYKLMTSIR-VSDGQFHTVIARRAGMAASLTIDLCGEEQEPGYCAVSNVAVHTDWILDVQPNRLSVGG---VRSIEALLHRSGQVSTHDFVGCI--MEFAVNGRPLEPSQALASHGIQDRCPRLEAACVSEPCRHG-------GTCLDMWSWQQCQCTDGFTGPTCE------KCDADTALSLDGSGRLDYALSQSRKR-DVLLERALQGPGRSVL-QHSSLELKFRTRSASGTLLHAQESYN-YTTLRLKGGLLQYVSDAGVAGKVERTVSDVL-LSDGQWHTLLLQRNGSSTV-LRIDRSSSKLILHNTQDFGGIDVHTLSLGGVPVPGQSHTHTLCFD---GCYAYVKYNGEMLPFSGEHRTVSISKTDPSVKIGCRGPNLCESSPCWDGLMCVN-------QWYTYQCV 3978          

HSP 4 Score: 188.348 bits (477), Expect = 2.097e-46
Identity = 259/1042 (24.86%), Postives = 448/1042 (42.99%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI---DHQQMVTY--RISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQ-----DRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMY-LLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTP-GLKLFRLQAL---YPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIV---------TTSGVPLDHEAV-----AYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTT-NPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADK----SDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQN 6149
            R +YS   L V  +D ++S+ ++V I V D ND++P FS   Y F I     P + +  + A D DSG+NG + YS+E+   +  F+ ++  +G     + +D   Q  FI  + A D G    +SSV+VY  +         F+   +  +I E +     +  +     DH    T    +      G FSIN  TG+I   + LDRE  A + L +VA+D    + +   +   + V + D+NDN P F +      I + ST  G+++   T  D D G N Q+ Y LT    E    FKID   GA+  ++ +      +  F +   D G      + +VTV      D  P    + +  F   +N    T V +V    P    + YY+ S +  D+ F I+ +SG LS+  P+  E + +  V+ ++A  Q       Y++  + V   +DN    +   + A IL   +   +++  + A       N +  Y ++  +  +   INR TG++   +T P++   +   + + +++       K  + K+++++ D  N N  +    F     +  P G  + R+         N IS   Y I D          LP     +   TG I++    L+RE  +      +V   D G   S    T V + + D NDN P F+  ++    PE T  G  +   +    D+  +  + Y   ++   F ++ +SG +          +SG    H  +     ++ +           S   ++I + D+ND    F    Y   + ++  + T + +VT  +      N  I++ I      + F ++   G +T    +  + +  Y+L ITA+D     L      +  TTV +++ + N + P F   ++ V++ E + + + I  L A D DK    + L+ + I S NDD L +V+  TGV+S A  LDYE  ++H L VS TDG        V V I + +VND  P + +P   Y P + +N
Sbjct: 1776 RSKYS---LLVRADDGQQSSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFL-LNPITGVFNVTRALDFETQPFFILTVRAADGG--GRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGG--QPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPA-STSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEK---FKIDPIRGAITASEKL--TGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDK-AFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGN-LDNAFHIDQLSGELSIRKPLDYE-NIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEIL--ENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEI--RTTRPLDREKV-AQYSLRVKATDRGMPPKSTAVKVLISVLD-VNDNAPRFSKIFSATVPENAPVGFTVTRVTTTDEDAGANAIS--RYSITD--------ASLP---FIIHPSTGDITISRP-LNRE--DTDHYIAKVSAHDSGWTVS----TDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSG----HNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPL------SDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPP-VFDPVE-YFPVVQEN 2761          

HSP 5 Score: 180.259 bits (456), Expect = 5.016e-44
Identity = 299/1299 (23.02%), Postives = 549/1299 (42.26%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL-----EIDHQQMVTYRISKCTQKGA-FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKV-GTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPK---WNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDP--DTNEVLYYLQSVHPPDHP----FVINPISGILSVSNPILQEVSFDLVVMAVDAERQD--RYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYI-FDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEI------PEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN----FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GL--HRVTVEVLINLINVNDETPLIHNPT--TVYLPKINQNHNIMIKCSDQDNL--GPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSDT-----IHNTIKNVSLIVLDRNRSSKNYTAFIKLERFEKSPLKIQSVFDKLIIPNDDKYVYFLLQSLYNLSEDDYNFYLINPSTGEF---KPIEGFAPRKHEYRFTIAGIKRDSLNQENQINIETILTYKEIELCYPSFLGTPYSFQIDHRVTAPKYLGSVSV-----GYCSNQKILYYLSSGHSFFYVNGTSGDIFITRDL 6893
            YS  ++A +      S+   + I V D NDNSP F   +    +  + +    +  V A D DSG N  + YSI        F  I   +G +F  K +D   Q  +   +TA+D G P  +SS+ V + +     +   F     F++I E++ I+  +  +     + D   ++ Y I+  T +G  F I+  +G+I+    +DRE      LTI ATD +        A+ N+ + + D NDN P F +    N +++ES  V G+IL    A D D+G NG+V Y L     ++   F +D +SG + L      +L P    ++ +++A D G     S   +T+ +     + P F++   +  I+++    GT V  + A  P     +V Y++ SV          F I   SG++  +  + +E   DL ++ V A   D  +   Q  +V    D   ++ +L  G +        RE I+    Q+ ++  N+   Y + + + D   I+  +G++  T     E  S   + L+  +  +  + I  + T  V +I D H   F ++ Y F IPE   +PG  +  + A       SD +  +  +I   + E  +  ++   L+  TG  +V    LD E      +TV          G R    +V+ N+ D ND+ P+F +  +     E+ + G  +   TV A D+D  ++     +N +       +FS++ ++G++ TS + LD E  A +   +  SDG   +  +    +       ++    F H  Y  HI  +    +++  VT+ +  +  N  + + +     +  F ++P  G IT   ++    +  + + +     + +        T +TTV V  V   D  P       A + PE+ P N+ I+  +   + ++  L + I S N D    ++ ++G +S    LDYE  E++ L +   D G   +    +V I +++VND  P+          L  ++    +++   DQD+   G L Y I+  +K+  +  ++R TG++     L        SL    T       +T   V + VLD N ++  ++        E +P+       ++   ++D     +  S Y++++    F +I+PSTG+    +P+      + +    IA +           ++   +T  +I    P F    Y             +  VS      G+  N KI Y++ S   +F +N +SG+IFI + L
Sbjct: 1265 YSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTF-SISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFIS---QNALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDT---FIMDRYSGDIRLAS----QLIPSKLIYSLMVSATDHGTDRKSSRTELTIILQGT--DGPVFSQPKYIT-ILKEGQPAGTNVISLDASSPRGAGTKVEYFIVSVRSGGKAAGRLFTIGRHSGVIQTAAELDREQGSDLYLLDVYAIETDAKQPRTQHAEVSFLFDFFFKVMLLLKGNL--------REHIS----QTCAEGANALVTYAIISGADDSFRIDPESGELSATRRLDRERRS-KYSLLVRADDGQQSSDIWVNIT--VSDIND-HTPTFSRSVYSFDIPE-DMSPGSIVAAILA-------SDGDSGVNGEITYSVEEDDE--DSTFLLNPITGVFNVTRA-LDFETQPFFILTVRAA-----DGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVL--TVSAADRDHGNS--STLLNSVHLSGGDGQFSINPSTGLIITSSL-LDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEK-FKIDPIRGAITASEKLTGSSEVTFTVHVKDGGTNPK--------TDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNT-IVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKE-NSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIFSATVPENAPVGF--TVTRVTTTDEDAGANAI--SRYSITDASLPF-IIHPSTGDITISRPL-----NREDTDHYIAKVSAHDSGWTVSTDVTIFVT--DINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGF--NGKIFYFIRSQTEYFRINSSSGEIFIKQQL 2486          

HSP 6 Score: 171.4 bits (433), Expect = 2.305e-41
Identity = 251/1060 (23.68%), Postives = 443/1060 (41.79%), Query Frame = 3
Query: 3177 NDKEKSTKVFV-VIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVE-QEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQ----MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESR-LEFIVQQNVAIGTTVGRVYAQDPD---TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS----------FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSK---NLNSRFMYLLKNS-SYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIE--DCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPE---FSLDKTSGIVTTSGVPLDHEAVAYF---IGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS---DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVE---VLINLINVNDETPLIHNPTTVYLPKINQNHN-----IMIKCSDQD---NLGPLSYDIMTS 6218
            N K  ST V V  +   DF    P    +   F+   +   NT + KV    P +G    ++Y I    ++  F  ID  SG L   K +D    ++++ +I A D G P  ++  KV + +     +   F+++ F   I E++     +    +D        + Y I    ++ +F+IN+ TG I     LDRE +A + L + ATD      S  + V    ++++DVNDN+P F    + +  + E+  VG  +   T  D D G N   RY +T   +     F I   +G + +++P++ E    +   ++A D G+     +  VT+ +T+IND  PRF+K S  L++   +   IG+ V +V A DPD     ++ Y+++S       F IN  SG + +   +  + S             +V A D   +    + +V +++  D+ D        +   P +   +     LK  +  K    LNS   Y +    S +K  +++ TG V + S+   + N + +   I+     +  L    + K+ +   + H   F +N     + E  T  G  +  L A              ++I  G  +       +  +  +TG +S+    LD E  +  ++ V          G   + + V +NI+  D NDN PVF    +     EN   G  +    + A DKD  S     ++ +  +   F +D  +GI+TT G  LD+EA   +   +    V D    S A + I +  AN+    F   +Y+F I E AP  TV+G+V   +     + ++ + I     K  FS+N   G I   G +D E++    L + A +       +   +     V ++++D ND  PVF      V + E +     +  + A D+D         + I + ++    T+NP TG +S A  LD E    + LT+   D           +++ L ++ND  P +    T Y  ++ +N       + +   D D   N GP +Y ++++
Sbjct: 2099 NPKTDSTTVTVRFVTGGDF----PHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAGP---LSYYIASGNLDNAF-HIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKV---LISVLDVNDNAPRFSK--IFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLP----FIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTV---STDVTIFVTDINDNAPRFSKPSYYLDY--PELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQ---TEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVV-DSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYL-LEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTV-GTAIRTLSARDKDKDKQMNGLITYNISSGNDD------GLFSVHSQTGVLSLAKT-LDYETKQKHELRVSAT-----DGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVV--KMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGF-LDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGS----IRGADIDEVLVNITVLDANDP-PVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTL---VTTY-GEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVST 3106          

HSP 7 Score: 167.548 bits (423), Expect = 3.390e-40
Identity = 248/926 (26.78%), Postives = 412/926 (44.49%), Query Frame = 3
Query: 3636 IDHQQMVTYRISKCTQKGAFSIN------QHTGIIHLINR--LDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKP----RFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN--------EVLYYLQSVHPPDHPFVINPISGILSVSNPILQE--VSFDLVVMAVDAER---QDRYDQQSVKVHIKHDNEDEIQVLTYGAII---LPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFN---SIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNL--NFQKNDYFFQIPECKTTPGLKLFRLQA----LYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDL--DSTLEY-IWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLI--TATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS-DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVL--INLINVNDETPLIHN---PTTVYLPKINQNHNIMIKCSDQDNL--GPLSYDIMTS-SKDIQNIYVD 6248
            +DH    TYRI     +  F ++           +HL++   LDRE   F+ L I   D    K   YL V    V I D+NDN P F ++     +  E   VG+ +    A+D+D+G N ++ Y L     +  + F+ID  +G + + + +DYE K +++  I A D G P+L++    TV + ++ND  P    R+   +     V +N  +GT V  +   D D++         +L   +  H   H   +  +S ++ V++ + +E   S++L V   D  +   +  +    + V+  +D+    Q   Y   I   +PK S+ +   AT     + +N N R+  L+  +S     I+  +G V    T+  E N   + +I   IS +       I Y  TKL++NI D ++    F +N Y   I E  +  G +L  L A    L P   I     + FD    +S++ K      RLD  +G +S  +  LDRE  E S   + +   D G       C KV + ++D NDN PVF    +  +  EN   G    V TV A D DL  + T++Y I   +  +F +  TSG VTT  V LD E    +  ++  +DG    +    I+     D   N   F    Y F + E  P+ T+IG  T+  +T + +  I + I S   + LF +    G IT  G ID E+   Y L +   A +V+ ++L           V +++ D+NDN P F  +   VS  E+      I Q  ASD D++ + ++   L  N   L  ++   G+IS  G L+   T  + L V  +D G+ + T  +   I++ +VND  P+        T+   +   +    ++ +D+D+   G + YDI++  ++D+  I+ D
Sbjct:  163 VDH---TTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVN---VTIQDINDNPPSFDHEQYQTSVF-EDAAVGSSVLQIAASDLDEGANAEITYLL-----DEGTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLS-LIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSAT--DGDSGQNANLRYS-LVSGNSLGWFAISENSGLV----TSAAELNRETASEIVLNISAKDQGLQPKISY--TKLIVNITDVNDQVPTFTQNTYHVSITE-HSPAGSELVVLSATDSDLGPNGTIR----FSFDSETPVSDQNKF-----RLDSTSGRLST-STELDRE--EESSYLLYIRATDSGAPPLHSVC-KVNITLKDVNDNSPVFYPMQYFANIKENEPSGSS--VTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTL-VALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIG--TVSATTVDLHTNITYLIASGDQRSLFGIKA--GQITALGLIDREEQAFYQLRVIARAGEVTGETL-----------VNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEV-TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPD 1033          

HSP 8 Score: 157.918 bits (398), Expect = 2.845e-37
Identity = 184/743 (24.76%), Postives = 335/743 (45.09%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLV---------DVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKL------EIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLA-VTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDG--LNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEF--IVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLT---YGAI--ILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNS-IDITFLI-SLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRG---KNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDL 5264
            R+     +  V+ +D   +    V IFV D NDN+P FS  SY+      T+  + + +V A DPD G NG + Y I     + ++  I+S SG +F  + +         ++      F +TA D GI  L S   V + +  S  +   F+  ++F  +++ +K+  ++ K+      +      + Y IS       F +++ TG + + + L  +    ++L I A+D    KG+  L+  T + + + + N ++P F  + +    +SE+  VGT +   +A D D    +NG + Y +++   + +  F + + +G L L + +DYE K K    ++A D G+ A  S ++V + +T++ND  P F+    +E+  +VQ+NV  GTTV ++ A D D  +N ++ Y+      D  F+I+P +GI++    +  E    + L V A +   ++R     V + +K  NE   + ++   Y  I    PK +   E  A+ +       +   +  +   S      IN+ TG ++++ +   E    I +  L  +  S+R   + +      VL+  DP    F +  Y  Q+ E  +  GL  F   +    + +     + + I     ER    NT   ++ +TG +SV +  LDRE +    +T  ++ +D G     GS I    + + +ED NDN P     T      EN   G  +   T+ + D DL
Sbjct: 2388 REDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRS---QTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASD----KGNPPLSDRTTVKIAVTEENHHTPEFSQNQV-TVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGL--FSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDP---VEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDL-FIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVV---YYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDPP--VFTQELYDVQVNEGLSPGGLVTF--VSAEDSDSVPSWSRFTYAIAAN-HER----NTFT-INPQTGQVSVAS-ELDRETVPVYNLT--ILAVDSGSPAATGSAI----LIVTLEDINDNGPTLV--TTYGEVMENQRAGTPVM--TLSSRDPDL 3092          

HSP 9 Score: 157.918 bits (398), Expect = 2.992e-37
Identity = 262/1139 (23.00%), Postives = 493/1139 (43.28%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKI----NPSPKSK-QFFDKQTFFQNISEDMKITEKIFKLEIDHQQM------VTYRISKCTQKGAFSINQ----HTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD---TNEVLYYLQSVHP--PDHPFVINPISGILSVSNPI--LQEVSFDLVVMAVDAERQDRYDQQSVKVHIK--HDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDIT-FLISLESLRSDTLIKYHSTKLVLNIGDPHN--LNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEY-IWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGT--FTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIV--DINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERH------ALTVSCTD-GLHRV---TVEVLINLINVNDETP-LIHNPTTVYLPKINQNHNIMIKCS----DQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSL------SCSDTIHNTIKNVSLIVLDRNRSSKNY 6395
            Y   +   +K + +K   + V + +QD NDN P F  + Y  S+       +++ ++ A D D G N  + Y ++    E    +ID ++G +   + +D   ++E+   I A D+G+P L +  +  VK+    +  P  K ++F   + F ++ E+ ++   +  L +           ++  I    ++  F ++     +  +I + + LDRE I+ + LT+  +DN         A   ++VN  D+ND+ PIF+ +A+    +SE    G+ +   +A D D G N  +RY L +    S+  F I   SG +     ++ E   +    I+A D G     S   + V IT++ND+ P F + +    I + + A G+ +  + A D D      + +   S  P    + F ++  SG LS S  +   +E S+ L + A D+     +    V + +K  +DN      + Y A I  ++      + T+ A       N    Y +      K  I+  +G V    TT V  +  + T + + + +     L  +    + + + D  +  L F + DY F +              + +  G  I  +     D++  I+  I   +       + G I+   + +DRE     Q   ++ VI R   G     T V + ++D NDN P F +      A EN   G  I+       D+  +  + Y +  N    F + +  G+++ +G PL+    +Y +  +    G    TS+  + I + D ND    F    Y   I E+ P+++   +V   +  +  N  I +DI+S   + +F + PD G +  + ++D E  + Y LL+ A D +        +E+++ +V VSI+  DINDN P+F++T       E+    + + ++ A D D   +  + +   +P  +  +  N ITGV+++   LD E   R       + TV  +D GL +      +V + + ++ND  P    +     + +  QN   +++ S    D++  G + YDI   +++ Q   +D  +G+V+    L Y  + + SL      S S  + +T   +S+ VLD N +S ++
Sbjct:  210 YQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLD----EGTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVN--DINDHPPIFQ-EAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSG--NSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPA-GSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANI-KENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKV----TTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVM-------------FENVPVGTIIGTVSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGL-IDRE----EQAFYQLRVIARA--GEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTG-PLEVTTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPD-GQLYIKADLDREVQDRYSLLVVAKDRA--------VESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFEL--NAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQ-FSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCV-LSISVLDDNDNSPSF 1299          

HSP 10 Score: 144.436 bits (363), Expect = 3.366e-33
Identity = 137/495 (27.68%), Postives = 227/495 (45.86%), Query Frame = 3
Query:  258 EGLFNLNKLTGVI-------LTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNN--YKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRS---------VLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPS-LSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +GLF++++  G+I       +T++    E +ASDL            Q   ++ + + + D NDN P+F     E  I+E+  + +      ATD D+   GV+    Y I SGN  D F     G+   GQL ++    LDRE +++Y L +  +D+    L   + V I+++D NDN P+F+ + Y     E    G  V +V+A D D G N EV Y F+  +S         VL +   +DR+S    L +     +     +  V + D G P  L     V V++  IN   PKF  +   ++   +   + ++ R     V   D D++   L+   I  GN+E  F+++   G V ++ ++         SY++ + A D+G+    +T  + I +   N   P F     SV V  N  I   +A+  ATD D+G N  I YSI+  +    F+I  ++G I L+K L +      KL + A+D+G
Sbjct:  921 KGLFHIHEKHGLISLTGPLEVTTSSYQLEVVASDL---------GVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDS---GVNGEIVYDIISGNTRDVF-----GIFPDGQLYIKA--DLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRES----LMRQRGAAV----FSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLR-----VSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDY---ETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSG 1380          

HSP 11 Score: 143.28 bits (360), Expect = 7.034e-33
Identity = 155/536 (28.92%), Postives = 234/536 (43.66%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQVLIK---FG----FSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDL------IEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSII-----GGNDENIFALERTHGNVHILRQI-KAIHNINLQSYTITVRAIDNGNPS---KQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGIN 1691
            F S+ Y F   E Q    +VG+V  +   FG      Y F   +  F LN +TGV+ ++  +DRESL            +    + L     +   ++V I D NDNPP F  +  +  I E+   +T +   +A+D D ++ G+ + Y I  GNE+ +F++        GQ+ L  V  LD ET   Y L I  ED G  PL     + I V D NDNSP F  S  +V + E+   G  V  V A+D+DSG N ++ Y    T +     FSI   +GSI L +    +  Q    L V A D G PS S+   V +HV   N   P F        D    I         +  +   D D D   L+  SI      GG+    F ++   G ++  + I +   N+    + +T++A D   P+   +    ++ I +   N   P F ++  ++    N  I S +    A D D G NG++ Y + +GD  D F +++ SG I L   L   KL    L + A D G +
Sbjct: 1084 FNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVH-YDITEGNEEKQFSID----SNSGQVTL--VGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNN--HGTFSISPNTGSIFLVKKLD-YETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPG-----DIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGH----FRIDSVSGVIYTNKDIDREFSNL----FELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQ-NALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGD-SDTFIMDRYSGDIRLASQLIPSKL-IYSLMVSATDHGTD 1593          

HSP 12 Score: 142.51 bits (358), Expect = 1.296e-32
Identity = 138/505 (27.33%), Postives = 230/505 (45.54%), Query Frame = 3
Query: 3147 YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDV-VEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTF---FQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAI------AFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD--TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVS--FDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAII--LPKSSFYREKIATLKAQSNSKNLNSRFMY 4613
            Y   V+A +    ++++ +F+ I V D NDN+P+F   SY  +I      N+   +V A D DSG+NG + Y I        F       G+L+    +D  V+  +   + A+D  +  L++SV V + ++    ++  F+   +   F+   E   +  ++F  + D       R S  T +  F +N  TG++    +LDRE++      A    T++++D    K  +  A   +Y+   D+NDN P F  D     I +ES +  T L   +A+D+D+  NG V Y +T    E    F ID+ SG + L   +DYE  P ++  I A D G   L S   +++++ + ND  P F K S L   V +N+ IG  V  V A D D  +N  + Y  S       F I+P +G + +   +  E    + L V A D+ R  R     V +H++ D  D   V T G I   +P++      + ++ A     ++N    Y
Sbjct:  946 YQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIF--PDGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQ--DINDNPPKFTKDIYQASI-AESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEE--KQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPK-STLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVR-DFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEY 1441          

HSP 13 Score: 140.198 bits (352), Expect = 7.153e-32
Identity = 154/611 (25.20%), Postives = 274/611 (44.84%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISVSNNILSCNG-NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIK-AVALNWISDNETVDV-----IITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYG---EITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQAC--GTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNL--LQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            F I++ SG++S+ +PL  + +  Y L I A  +       + K     + V DN        +    +E  S   + V + +   +G N ++ + +     ++    N  T EIRT  +P+DRE      + V   D G      +   +I V+D+NDN+P F+   F   V ENA +G  +  +   D D+    +      + +  F I+P  G + +++ ++RE    Y  KV+  D    +   + I VTD NDN P+ SK     ++ ++  E       V  ++ATD D  +  N +I Y + S+ +       F +N  SG + IK  +     S +  ++V     I+TASDRG  PL    TV    + +       +S   Y   V  + + G+R+  +       +G   EI + I  GN S+ F +  + G ++ + ++ +A   + + L + A   G   L      S R T+ + +++ N ++P+   ++ TV++SE + VG+ +  L     D D  + G++   I +  DD      F  +  +  L +   LDYE + ++ L + A D G+  K+    V I+V D +DN P F
Sbjct: 2165 FHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTT-RPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFS-KIFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSK----PSYYLDYPELTEIGSIVTQVSATDPD--EGFNGKIFYFIRSQTE------YFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESP-SYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSL-AADTNKVYLLEITASDKGNPPL------SDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGL----FSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVF 2749          

HSP 14 Score: 137.887 bits (346), Expect = 3.256e-31
Identity = 247/1072 (23.04%), Postives = 438/1072 (40.86%), Query Frame = 3
Query: 3207 VVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGF--VNYSI----EKLPVELDFVEIDSQSGRLF----TNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI-DHQQMVTYRISKCTQKGA-FSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFK---NDALNNFI-LSESTKVGTILGFYTANDIDD------------GLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNL-SVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNE---VLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLV--VMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGA--IILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKN----SSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN--FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVS----QQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHR---VTVEVLINLINVNDETPLIHNPTTVYLPKINQNHNIMIK---CSDQDNLGPLSYDIMTSSKDIQNIYVDRITG 6260
            V I V D NDN+P+F   S   S          +    A D D G NG     Y I    ++    LD     S  G       T  L       +   I  ED G P+    ++V V I     +   FD + +  ++ ED  +   + ++   D  +     I+    +G  F I+   G + +   LD E    + LTI A DN           T   V ++DVNDN P+ K       + F  + E+ +VGT++   T +D D             G N Q  + + ++ + ++S+ K+ +          +D E    +N  ++  D G P   S+  S+ + + +IND  P F +E+     + +++  G+ +  V A D D+ +   + Y L S +     F I+  SG+++ +  + +E + ++V  + A D   Q +     + V+I  D  D++   T     + + + S    ++  L A  +    N    +   +    S  +K  ++  +G +  ++    E  S   ++L+ + +  S     +   K+ + + D ++ +  F    YF  I E + + G  +  + A  P   +       + I  G S +  + +T       +G ++   + LDRE  E +   ++V   D G   S      V + + D  DN  VF  + + F   EN   G    +GTV A   DL + + Y+  +          +G +T  G+ +D E  A++  ++    G  T    + I + D ND   NF H   H    E       I Q    +     N +I + +  +  K LF ++  HG+I+  G ++    + Y L + A+D+       SLFL           +S+ D+NDN PVFD     V+I E  P+NS   ++ A+D D      ++++I+S N   +  + P  G +     LD E  +R++L V   D        +V V I L ++ND  PL ++   V+  +  Q    ++      D+D  GP S    +      N  ++ ITG
Sbjct:  115 VRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPS---LYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASV---------LDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIF-QEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGW-FAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNIT-DVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEES---SYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPS-GSSVTTVTASDPD--LGRNGTVKYAITAGDSSKFHISST-------SGKVTT-LVALDRE--EKTAYQLQVTATDGGGLRSHTPAI-VTVTVVDTQDNPLVFGQKDYSFVMFENVPVG--TIIGTVSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGL-IDREEQAFYQLRVIARAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSL-KQNPKGLFHIHEKHGLISLTGPLEVTTSS-YQLEVVASDLGVPQRTSSLFL----------TISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFP-DGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKD-FGPNSEVRYSFETPQSNFELNAITG 1137          

HSP 15 Score: 136.732 bits (343), Expect = 7.976e-31
Identity = 252/1016 (24.80%), Postives = 437/1016 (43.01%), Query Frame = 3
Query: 3207 VVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQ-EFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTF----FQNISEDMKITEKIFKLEIDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT---NEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLK---AQSNSKNLNS--RFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSI---------DITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWIS-VGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIW----INEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIV--SEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLP-CLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKS--DLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTD-GLHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQ 6146
            V I ++D NDNSP+F    YF +I  +    +++  V A DPD G NG V Y+I     +     I S SG++ T   +D  E+  +   +TA D G  R ++   V V +  +  +   F ++ +    F+N+     I   +    +D    +TY I+   Q+  F I    G I  +  +DRE  AF+ L ++A      +  E    T + + + D+NDN+P F + ++ +    E+   G  +    A+D D+  NG + Y L         +F I    G + L  P++      +   + A DLG P   S+L +T+++ ++ND  P F++ S  E  + ++  + +   RV A D D+    E++Y + S +  D  F I P  G L +   + +EV     ++ V  +R       SV V I  D+ ++ + L      +      +E+ A +    A+      NS  R+ +    S+++   +N  TG   LTST  ++  S+           T L S + L      +      + +I D +   F K+ Y   I E       +L R+ A       + L +Y  DI  G  E+         +D  +G ++ VG   LD E       +++++  D G       C  + +++ D NDN P F   T      EN   G+   V +V A D D  S  +  +     N    FS+   +G +      LD+E  + +   +   D    S ++ I +I    D   N   FT       I E  PI T +  +T  ++  + N ++++ I   +  G H F ++   G+I T  +ID E  N + L I ATD +  + F    L+ VT    + + D NDNIP F  ++ A+    ++ I S +  ++A D D+     + +E++  + D  + ++  +G I  A  L   K   ++L VS TD G  R +    + +I    + P+   P  + + K  Q
Sbjct:  661 VNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITA--GDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGT-IIGTVSATTVDLHTNITYLIASGDQRSLFGIK--AGQITALGLIDREEQAFYQLRVIA------RAGEVTGETLVNITVKDLNDNAPNFMH-SVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLK---QNPKGLFHIHEKHGLISLTGPLEVTTS-SYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLS-YEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDV-FGIFP-DGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFE---LNAITG--VLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDIND-NPPKFTKDIYQASIAESAQN-MTQLLRVSASDVDENKNGLVHY--DITEGNEEK------QFSIDSNSGQVTLVGK--LDYETTP--SYSLKIIAEDSGSVPLSSTCV-LSISVLDDNDNSPSFPKSTLSVDVLENMRIGE--LVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVK-KLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGH-FRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVT----IWVTDQNDNIPTF-ISQNALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFI-MDRYSGDIRLASQLIPSKL-IYSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKYITILKEGQ 1626          

HSP 16 Score: 129.798 bits (325), Expect = 1.025e-28
Identity = 253/1103 (22.94%), Postives = 446/1103 (40.44%), Query Frame = 3
Query: 2931 DSPIFF-EPFYTFVVKENSLSHTPLRKISLIQSQNIDNYHLSIIEESLYGKWSIFXXXXXXXXXXXXXXXRKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQM-----VTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYE--LKPK----WNFIITAFDLGYP-ALHSNLSVTVTITNINDEKPRFNKESRLEFIVQ--QNVAIGTTVGRVYAQDPDTNE--VLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSF---------YREKIATLKAQSNSKNLNSRFMYLLKNS-SYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLN---FQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISD-LEYYIFDIYCGISERIKLP-NTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD--LDSTLEYIWI-NEIPEFSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPN------FIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNH-YILLITA--TDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTVEVLINLINVNDETP 6101
            D+P+ F +  Y+FV+ EN     P+  I    S    + H +I      G            ++ L   +R++ +F  L V     E + +  V I V+D NDN+P F       S   +      I +  A DPD   NG + YS+++ P  L    I  + G +     ++V    +   + A D G+P+  SS+ + + +     +   FD+ ++   I E   +  + F++E   +       + Y I     +  F I    G +++   LDRE    + L +VA D +    S   A  N+ + + D+NDN P+F N     F   E  + G ++G   A D D G N +VRY          S F+++  +G L     +D E  ++ +    ++F + + D G P  L     V V I +IND  P+F K+     I +  QN+   T + RV A D D N+  +++Y  +    +  F I+  SG +++   +  E   S+ L ++A D+          + + +  DN++            PKS+            E +A++ A  +    N+   Y +  + ++    I+  TG +FL      E  S+   + +++ +  S    +  S  +++++ D  N N   F   D F  IPE        +  + A      I+  LEY I          ++ P     R+D  +G I   N  +DRE     ++T++           R     V + + D NDN P F ++  +  A  N   G  +   TV A D D   +  +EY  +  +   F +D+ SG +  +   +  + + Y +       GT   ++   + I         F+  +Y   + E  P  T +  ++L  S+          FI+      +    LF++    G+I T  E+D EQ +  Y+L + A  TD  Q     P  +    + L                   V +     +   I Q  A  A+   L+ + I+S  DD    ++P +G +S    LD E+  +++L V   DG     + V I + ++ND TP
Sbjct:  774 DNPLVFGQKDYSFVMFEN----VPVGTIIGTVSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIARAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGL--FHIHEKHGLISLTGPLEVTTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPD-GQLYIKADLDREVQDRYSLLVVAKDRAVESLS---ASVNVSILLDDINDNRPLF-NSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQ----SNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNM---TQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPS--------FPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSL---YKLNVTAKDSGRPSRSSSIPVIIHVRD-FNDNPPVFTPGDIFKSIPE-NLPISTSVMSITAHDTDADINGLLEYSI---------ALQTPRGGHFRIDSVSGVIYT-NKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALV-AESNIVIGSILT--TVLAFDPDEGANGEVEYELVRGDSDTFIMDRYSGDIRLASQLIPSKLI-YSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKYITILKEGQPAGTNV--ISLDASSPRGAGTKVEYFIVSVRSGGKAAGRLFTIGRHSGVIQTAAELDREQGSDLYLLDVYAIETDAKQ-----PRTQHAEVSFLFDFF-------------FKVMLLLKGNLREHISQTCAEGANA--LVTYAIISGADDSFR-IDPESGELSATRRLDRERRSKYSLLVRADDGQQSSDIWVNITVSDINDHTP 1808          

HSP 17 Score: 127.487 bits (319), Expect = 4.364e-28
Identity = 134/518 (25.87%), Postives = 231/518 (44.59%), Query Frame = 3
Query:  171 FRVSENQPINTIVGQVL---IKFG-FSYEFFHK--EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKF-RINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIK-----AIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDL-DAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            F   ENQP NTIV +V     + G  SY       +  F++++L+G +     +D E++   ++ I    +     +     +++ ++D NDN P+F        I+EN++    + + +A D D+   G    Y I  GN+++ F ++      R    +R  RPLDRE   +Y L +   D+G PP    ++V I V D NDN+P FS   ++  + E+   GF V +V  +D D+G N    Y    T + L   F I   +G I +++P    +N+ D    +          +    VT+ V  IN   P+F + +Y    D     EIG +  +    V   D D+     I   I   +    F +  + G + I +Q++       +NIN+  ++  V A D G     +   ++I +  +N   P F +      V ++  + + +    A D  D GLN +I Y+I+ G+  ++F ++K +G +T+   L         LEI A D G
Sbjct: 2127 FTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFP-PYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSP-QRVLVVSALDQDSGPNG-QLEYAIIDGNKENSFNIN------RATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFS-KIFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSI--TDASLP--FIIHPSTGDITISRP----LNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYY--LDYPELTEIGSIVTQ----VSATDPDEGFNGKIFYFIR--SQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKG 2618          

HSP 18 Score: 121.324 bits (303), Expect = 3.452e-26
Identity = 243/1041 (23.34%), Postives = 450/1041 (43.23%), Query Frame = 3
Query: 3144 QYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYV-KINP-SPKSKQFFDKQTFFQN---ISEDMKITEKIFKLEIDH--QQMVTYRISKCTQKGAFSINQHTGIIHLINRLDRE--------AIAFHVLTIVATDNSSTKG-SEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDD-GLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD----TNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAE--RQDRYDQQSVKVHIKHDNEDEIQVLTYGAII---LPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFL-ISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGK-NGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKD-LDSTLEYIWI----NEIPEFSLDKTSGIVTTSGVPLDHEAV-AYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPN-FIIKFDIVSEW-GKHLFSVNPDHGIITTQGEIDYEQ--DNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIP--------------VFDTTRLAVSIPEDVPINSEIIQLIASDADKSDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHR-VTVEVLINLINVNDET 6098
            QYS  V A ++    KST V V+I V D NDN+P FS + +  ++  +     T+ +V   D D+G N    YSI      L F+ I   +G +  ++ ++  + + +I  ++A D G   +++ V ++V  IN  +P+    F K +++ +   ++E   I  ++   + D      + Y I   T+   F IN  +G I +  +L  +         +  H   + A+D    +G    ++ T + +N++D NDN P F++ +    + ++S KVGT L   TA D  D GLN ++ Y +  +G  S + F++D  +G++ +   +  +    +   ITA D G P L    +V + +T  N   P F+ ++++   V + + +GT +  + A+D D     N ++ Y  S    D  F ++  +G+LS++  +  E     +L V A D     +  Y   +++V   +DN      + Y  ++   +P  +     +  + A       N+   Y++++S  D  II+  TG   +T+   +++ +  +  L +   ++  +    +    + L   + +   F    Y+F+I E       K   +  ++  +     +  ++ +  G S +         ++K+TG I V    LDRE  E  +I+++V+  + G   G+ I    V + + D ND  PVF  E +     E  + G    V  V A D D + S   + +     +E   F+++  +G V+ +   LD E V  Y +  + V  G+  +T + I+++   +   +  T    +  + E     T +  ++ ++    PN     + +VS       F+++P  G +TT  E+D EQ  D +  +LI  + + Q S         T TV + + D NDN                +F    L V  P+D  I       +   A     LLF I +   DL      I+   ST G  D        L+V   DG+H  V   V +  I  N+ T
Sbjct: 2291 QYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFS-KIFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITD--ASLPFI-IHPSTGDITISRPLNREDTDHYIAKVSAHDSGW-TVSTDVTIFVTDINDNAPR----FSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEY--FRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASD----RGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPV-TKSVKVGTRLLKVTAYDKKDFGLNSEIEYAI--SGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFS-QNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGT----TVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTG--IITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAP----KGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGF-----SINKKTGQIYVSG-SLDREKEE--KISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGG--LVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVAS-ELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTISPT-GELTTSREVDREQISDFYLSVLIKDSGIPQMS--------STGTVHIKVNDQNDNPSESRSVEIYVHYFGNMFPGGSLGVVKPQDPDIQDTFQCSLTPPA----ALLFSIPTGTCDL------ISNSRSTDGTFD--------LSVRSNDGVHSAVNSHVRVFFIGFNNAT 3263          

HSP 19 Score: 119.013 bits (297), Expect = 1.666e-25
Identity = 114/403 (28.29%), Postives = 183/403 (45.41%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPI-----FSTQSYFFSINRHTKPNTTIGKVFAMDPDSGI-NGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFI----FFITAEDHGIPRLNSSVKVYV----KINPSPKSKQFFDKQTFFQNISEDM---KITEKIFKLEIDHQQMVTYRISKCTQK--GAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRL-TATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPD 4286
            +++YS T+ AV+       T+    + + D NDN P+     F T S F S++ + +  T +  +   D DS   NG ++ SI     +  F    S    L   K+  V+++E I      ++  D+G P   SS    V     IN  P     F +  +  +ISED+      + +   + D  Q    R S  +    G F+I++++G++     L+RE  +  VL I A D        Y   T L VNI DVND  P F  +   +  ++E +  G+ L   +A D D G NG +R+   + T +   + F++D+ SG L  +  +D E +  +   I A D G P LHS   V +T+ ++ND  P F        I ++N   G++V  V A DPD
Sbjct:  309 KREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPP---IFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISY---TKLIVNITDVNDQVPTFTQNTY-HVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANI-KENEPSGSSVTTVTASDPD 703          

HSP 20 Score: 119.013 bits (297), Expect = 1.708e-25
Identity = 151/620 (24.35%), Postives = 268/620 (43.23%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLP-QLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISVSNNILSCNG----NSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD---SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVT----DSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAE--CELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            F I+ ESG++S    L  +  S Y+L +RA     +S I W    ++++S  ++     +   ++  + E+  S  S+   IL+ +G    N ++++++           N  T  +    + +D E      ++V  ADG GG   S      ++D+ND+ P+F  + +   + E+   G+ ++ +   D D   S        L G +   FSINP  G +  +  +DRE ++ Y++ V  SDG     +    TV+    D NDN P+      +  +V +          V  +T TD D    +NSQ+ YSL+  N        F ++   G++T    A   ++ +  V   +   D G  P   S TV   F+T      +++    F +P      +Q  + +           G ++++I SGN  + F I   +G++S  + ++   + ++  L ++A         ++    E + + + D N   P          I E +     +L V  +D D+G  G ++  II    +      F  N  + +++   PLD E   QYSL + A D G P KS    VLI VLD +DN+P F S+ F A++ E
Sbjct: 1756 FRIDPESGELSATRRLDRERRSKYSLLVRADDGQQSSDI-W---VNITVSDINDHTPTFSRSVYSFDIPEDM-SPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITG-VFNVTRALDFETQPFFILTVRAADG-GGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQ-FSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFH----HHPYVTHIPASTSTGSLVFAVTVTDED--SGSNSQLHYSLTGRNSE-----KFKIDPIRGAIT----ASEKLTGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFP-----ENQPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYV-LWIEARDQGFPPYSAY----EKVEIAVLDVNDNHPVFEQEPFHAEILENLSP-QRVLVVSALDQDSGPNGQLEYAIIDGNKEN----SFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRF-SKIFSATVPE 2336          

HSP 21 Score: 118.242 bits (295), Expect = 2.511e-25
Identity = 121/406 (29.80%), Postives = 182/406 (44.83%), Query Frame = 3
Query:  552 NYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENI-FALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSI-TKGDYRDRFAIEKDSGLITLLKPLWF--------VKLDKIKLEIIARDAGINSLETTGYLDLNILQSD 1739
            +Y I SGN D+ F +     Q  G+L +R  +PLD E  EKY L I   D+G PP     +VEI V D NDN PVF    +   + E NL    V+ V A D DSG N ++EY         EN F+I+R +G IR T+P          +L V+A D G P  S    V + V+ +N   P+F   +  +  + A +    VTR     V   D+D     +   SI    D ++ F +  + G++ I R    ++  +   Y   V A D+G      + D+ I +   N   P F      +       I S +    ATD D G NGKI Y I ++ +Y   F I   SG I + + L +        + +++    + A D GI  L +   + +N++ S+
Sbjct: 2153 SYYIASGNLDNAFHID----QLSGELSIR--KPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILE-NLSPQRVLVVSALDQDSGPNGQLEYAIIDGNK--ENSFNINRATGEIRTTRPLDRE-KVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIFSATVPENAPVGF-TVTR-----VTTTDEDAGANAISRYSI---TDASLPFIIHPSTGDITISR---PLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEY---FRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSN 2530          

HSP 22 Score: 118.242 bits (295), Expect = 3.069e-25
Identity = 149/551 (27.04%), Postives = 249/551 (45.19%), Query Frame = 3
Query: 2844 ELRIELFDGLSGDLSVSNTEIIIEFHPIFDSPIFFEPFYTF-VVKENSLSHTPLRKISLIQSQNIDNYHLS-IIEESLYGKWSIFXXXXXXXXXXXXXXXRKQ-YSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQEFIFF-ITAEDHGIPRLNSSVKVYVKI------NPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEIDHQQMV------TYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSS--TKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLN-GQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESR-LEFIVQ--QNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDA 4430
            ELR+   DG       S   + I+   + D+P  F+P   F VV+EN  S T + K++     +  N  ++ +I+ S    + I  +  +         E KQ Y  TV A N  D+E+ +  +V I ++  N+  P F ++ Y+F I+      T +G+VFA D D G +G V Y I     +  F  I+ ++G+++ +  +D  ++E I   + A++ G  R     +V V I      +P   +++ +D Q     ++E +     +  +  +    V      TY I+   ++  F+IN  TG + + + LDRE +  + LTI+A D+ S    GS  L VT     + D+NDN P           + E+ + GT +   ++ D D   N G   Y L +TG  S S F I + +G L  ++ VD E    +   +   D G P + S  +V + + + ND       ESR +E  V    N+  G ++G V  QDPD  +   +  S+ PP       P      +SN    + +FDL V + D 
Sbjct: 2716 ELRVSATDG-GWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGF-SINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDPPVFTQELYDVQ-----VNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVT-----LEDINDNGPTL---VTTYGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAAS-SYFTI-SPTGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDNP----SESRSVEIYVHYFGNMFPGGSLGVVKPQDPDIQDT--FQCSLTPPAALLFSIPTGTCDLISNSRSTDGTFDLSVRSNDG 3243          

HSP 23 Score: 116.316 bits (290), Expect = 1.060e-24
Identity = 127/484 (26.24%), Postives = 215/484 (44.42%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQ----FLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTD-EFGVSNNYKIESGNEDDRFAL-SGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAI--VHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRIN--KANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLN-GKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            F L+K TG +  ++     SLA+D  +++L + T   +      +  ++K+ + +EN + P F  N++   + E + + T I   +A D D D +      Y I SGN+D  F++ S  GV       L + + LD ETK+K++L +S  D G       + V I V D NDN PVF P +Y   + E+   G  VVK+ A+D DSG N  + Y  + + S L   F ID  +G I  TQ    +  +    L V+AF+       ++ YV + +   N + P+F         K  Y EI +   K   +  V   D D     ++   I G + +  F++ +  G +++     ++     +  ++ V A + G+       ++L+ I    AN   PVF      V V    S    +    A D D+  +  +  Y+I     R+ F I   +G +++   L    +    L I+A D+G
Sbjct: 2585 FRLDKQTGSVTVAS-----SLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGV-------LSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDL---FIIDPNTGII-TTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRF-------VSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVS---GSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDP-PVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSG 3041          

HSP 24 Score: 114.39 bits (285), Expect = 4.290e-24
Identity = 132/501 (26.35%), Postives = 222/501 (44.31%), Query Frame = 3
Query:  261 GLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFG-VSNNYKIESGNED-DRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCT---LVVEAFDHGSPSLSAYCYVTVHVIRINS---FFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHIL----RQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            G F +++ +G++ ++  ++RE+ +  ++ I    + L+ +   T  I V I D ND  P F  N     I E+    +++ + +ATDSD    G +  ++  E+   D ++F L     +      L     LDRE +  Y L I   D G PPL  V +V I ++D NDNSPVF P +Y   + E+   G  V  V ASD D G N  V+Y      S   ++F I   SG +     T   +++ + T   L V A D G         VTV V+        F +   ++V   +      IG V+   +          D    I   I  G+  ++F ++   G +  L    R+ +A + +      +  RA   G  + +T V++ ++    N   P F +  + V+   N +    I    A+D D   NG I+YS+ K + +  F I +  GLI+L  PL  V     +LE++A D G+    ++ +L +++
Sbjct:  508 GWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLI-VNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGR------LSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDS---SKFHISSTSGKVT----TLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTV----------DLHTNITYLIASGDQRSLFGIKA--GQITALGLIDREEQAFYQLR-----VIARA---GEVTGETLVNITVK--DLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSL-KQNPKGLFHIHEKHGLISLTGPLE-VTTSSYQLEVVASDLGVPQRTSSLFLTISV 970          

HSP 25 Score: 113.235 bits (282), Expect = 8.242e-24
Identity = 127/477 (26.62%), Postives = 199/477 (41.72%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEI-GKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAG 1685
            +G F++N  TG+I+TS+++DRE+ AS  + +             + ++ V + D NDNPP F+ +     I  + +  T   + A T +D D    S  +   +G   ++F +  +    RG +          E       T+ V+D G  P      V +      D  P            E+      V KV  S   +G        +      L+N F ID+ SG + + +P   + N     L +EA D G P  SAY  V + V+ +N   P F         +  + EI   ++ + + +V   D D  P   +  +II GN EN F + R  G +   R  + +    +  Y++ V+A D G P K T V +LI +   N   P F   + S TV  NA +   +     TD DAG N    YSIT  D    F I   +G IT+ +PL     D    ++ A D+G
Sbjct: 1958 DGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTS--TGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPI----RGAITASEKLTGSSEV----TFTVHVKDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAG-----PLSYYIASGNLDNAFHIDQLSGELSIRKPLD-YENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFE-------QEPFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEI---RTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIF-SATVPENAPVGFTVTRVTTTDEDAGANAISRYSIT--DASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSG 2404          

HSP 26 Score: 110.923 bits (276), Expect = 4.325e-23
Identity = 120/453 (26.49%), Postives = 196/453 (43.27%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASD-ADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPR--DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLIT 1616
            F ++  TG I  S  ++RE     + ++  +    +  +  +  + + + D NDN P F          E   + + ++  +ATD D + F     Y I S  E  R   S   +  + QL  +     +     ++   ++  D+G  PL     V I V D NDN P F    Y   + +S   G  ++KV A D  D G+N E+EY      S   N+F +D+++GS+ +    +   N+    L + A D G+P LS    V + V   N   P+F  N V  T   A + +G   R     +  +D D+D +   LI  +I  GND+ +F++   H    +L   K +     Q + + V A D G  +K + V + I++   N   PVF        V  N    + +    ATD D+G N  + Y I   D  D F I+ ++G+IT
Sbjct: 2371 FIIHPSTGDITISRPLNREDTDHYIAKVSAH----DSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPD-EGFNGKIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNS--SNKFRLDKQTGSVTVASSLAADTNKV-YLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEA-LTVGTAIR----TLSARDKDKDKQMNGLITYNISSGNDDGLFSV---HSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSD-SDLFIIDPNTGIIT 2806          

HSP 27 Score: 108.997 bits (271), Expect = 1.596e-22
Identity = 146/550 (26.55%), Postives = 227/550 (41.27%), Query Frame = 3
Query:  150 FLSSQYNFRVSENQPINTIVGQV---LIKFGFSYEFFHKEG----LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQF--KKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQ-------------SYTITVRAIDNGNPSK-QTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNIL 1730
            F    Y+F + EN P+ TI+G V    +    +  +    G    LF +    G I    +IDRE  A   + +      + G+ L  I++K    D NDN P F  +      +EN A  T   +  A  SD DE   +N   + S  ++ +    G+   +    L+ +  PL+  T   Y+L +   D G P     L + I V D NDN+PVF    Y V + ES        +V A+D DSGVN E+ Y      TR V    F I    G + +       + Q   +L+V A D    SLSA   V++ +  IN   P F      ST+   + E  +     +  V  +D D            G N E  ++ E    N   L  I  +    LQ              ++ TV + D G P   +    + + I   N   P F       ++  +A   + +    A+D+D   NG + Y IT+G+   +F+I+ +SG +TL+  L +       L+IIA D+G   L +T  L +++L
Sbjct:  779 FGQKDYSFVMFENVPVGTIIGTVSATTVDLHTNITYLIASGDQRSLFGIK--AGQITALGLIDREEQAFYQLRVIARAGEVTGETLVNITVK----DLNDNAPNFMHSVEHVSAVENWA--TGHHIFQAKASDPDE--ATNGMIVYSLKQNPK----GLFHIHEKHGLISLTGPLEV-TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDV----FGI-FPDGQLYIKADLDREV-QDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFN-----STNYVFHFEEEQERGALVGRVFAEDKD-----------FGPNSEVRYSFETPQSNFE-LNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVL 1290          

HSP 28 Score: 104.375 bits (259), Expect = 4.661e-21
Identity = 107/411 (26.03%), Postives = 181/411 (44.04%), Query Frame = 3
Query:  390 TISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQP-PLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQS-YTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYR-DRFAIEKDSGLI 1613
            ++++ + + D NDN P+F          E       +    A D D   FG ++  +         F L+ +       L L     + +     +  T+   D+G P PLK   +V++ ++D NDN P F+   Y   + ES     ++++V ASD D   N  V Y    T    E +FSID  SG + L             +L + A D GS  LS+ C +++ V+  N   P F  + + S D    + IG++    +A V   D D      I  SI   N+   F++    G++ +++++    +   QS Y + V A D+G PS+ +++ ++I +   N   PVF       ++  N  I++ + +  A D DA +NG + YSI     R   F I+  SG+I
Sbjct: 1067 SVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKD---FGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDI--TEGNEEKQFSIDSNSGQVTLVGKLDYETTPS-YSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTL-SVDVLENMRIGEL----VASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKL----DYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVI 1462          

HSP 29 Score: 103.219 bits (256), Expect = 1.050e-20
Identity = 123/475 (25.89%), Postives = 212/475 (44.63%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFP--LKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GINVLE--IGMLITVTDSNDNRPQISKEIINKT-FVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLT----IKAVALNWISDNETVDVIITASDRGQP-PLFHSITVH-FLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNH--DNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQW-FSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTI-ITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            I V D+NDN+P+F    +   + E+  + S    +   D DS +    +   + G   + F I P +G +++   +DRE++ +Y + V   D  +  L   + + I + D NDNRP     + N T +V +  E       V  + A D D     NS++RYS  +       +S F LN  +G LT    +   +L            + +SD+G P PL     V  ++    +   +  K  +Q  IA   ++Q  +++  ++ +   +N  G + + I  GN    FSI S +GQ++    ++      +   +I +  G+  LSS   C     +++ + D N  SP    S  +V + E +++G  +  V   D D+G    +  +I  T+    FS+ P     N+  + +V  LDYE Q  Y L + A D G P +S +  V+I V D +DN P F   +   S+ E
Sbjct:  968 ISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFP-DGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRP-----LFNSTNYVFHFEEEQERGALVGRVFAEDKDFGP--NSEVRYSFETP------QSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIA--ESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSST--C----VLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISP-----NTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPE 1415          

HSP 30 Score: 97.8265 bits (242), Expect = 3.778e-19
Identity = 117/487 (24.02%), Postives = 209/487 (42.92%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKV-AVSDGINVLEIGMLITVT--DSNDNRPQISKEIINKTFVINTSEFA------HGNIFVVNITATDADDSQSNNSQIRYSLSSENQR------IPVKSLFLLNEDSGSLTIKAVALNWISDNETV---DVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQE---GSRVANIAVNHDNLYGE---ITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITST----DDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            + + D+NDN P F    +   V E+A +GS ++ I   D D      + +   +E   F I+P+ G+V + + +D E K +Y + + AV +G+  L      TV   D NDN P     ++   +   TS+FA           V  +T +D+D S +N +     L    QR       PV +L L+   S            + D E +   ++ ++ SD G+P    S     +F+    ++      FQ  +  +  S++   GS +  ++   D   G+   + + ++SGN   +F+I   +G ++++  +N     +   L + A    +   +S+      + + I+D N   P    +   VSI+E    GS L+ +   D D G  G ++ +  + T     ++F L     +  S +L     LD E +  Y L + A D G P       V I + D +DNSP F    + A+++E
Sbjct:  232 VTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGAN-AEITYLLDEGTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDP-----VVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVAS------------VLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVN---DINDHPPIFQEAVYRVDISEDIPKGSYIKGVSAT-DGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIV-LNISAKDQGLQPKISYTK----LIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRL-----DSTSGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKE 686          

HSP 31 Score: 97.8265 bits (242), Expect = 4.143e-19
Identity = 167/725 (23.03%), Postives = 302/725 (41.66%), Query Frame = 3
Query: 7800 FFSINRESGQISLNEPL-PQLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEEN-SDSEI---SVSNNILSCNGNSKVSF-TLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIES-CPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG---MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFH-SITVHFLFITAECELRI-LKSTFQYPIAVLYTSQEGSRVANIAVNH----------DNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITS-TDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASL-RELDQLIVLPEVRDEDSIMASRNEPSYTLKSKTS-----SKVQLFQSKTNFTLKILKRSTNESVINLILDVFGASQENYPKRLPLGRYSRLMIYL 9884
            +F+I+  SG ++    L  +  S   L I A  + +  KI + K       V D V   T + Y     E + + SE+   S +++ L  NG  + SF +  P   Q+    ++ +  + T+ + +DRE  ++  + +   D     + S C   I + D+NDNSP+F    +   + EN   GS +  +   D D  +   +K+++   +++ F I+  +G V     +DRE K+ Y+++V  +DG  +       + +TV D+ DN     ++  + +FV+        N+ V  I  T +  +   ++ I Y ++S +QR    SLF +   +G +T    AL  I             DR +   +   +      +T E  + I +K         +++ +  S V N A  H          D     +  + +  N    F I  K+G IS +  +          ++    G    +S  F      +T+ + D N  +P        V+I E   V S   +V+  D D+G+ G +   II+  T D F + P        QL +   LD E+Q +YSL ++A D      S +  V I + D +DN P F S N+V     E ++  ++  V  ED      +E  Y+ ++  S     +   +  S      + L R    +V +  +    +S +  PK  PL   +++ +Y+
Sbjct:  509 WFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTE-LDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQK--DYSFVM------FENVPVGTIIGTVSATTVDLHTNITYLIASGDQR----SLFGIK--AGQIT----ALGLI-------------DREEQAFYQLRVIARAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEVTTSSYQLEVVASDLGVPQRTSSLF------LTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFP------DGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTV---LSSDQGLPK--PLKDQAKVQVYI 1184          

HSP 32 Score: 92.8189 bits (229), Expect = 1.293e-17
Identity = 103/401 (25.69%), Postives = 177/401 (44.14%), Query Frame = 3
Query:  252 HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLP-GFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPS---LSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVF 1442
            ++E  F+++  +G +     +D E+  S  ++I + + +       T  + + ++D+NDN P F  + L   ++EN+ +   ++   ATDSD+        Y I + N    F++S       G + L  V+ LD ET+  YKL ++ +D G+P     + V I V D+NDN PVF+P      + E NLP    V+ + A D D+ +N  +EY     ++     F ID  SG I   +      +     L ++A D   P+     A   VT+ V   N   P F       +  A   E   V    L  V   D D+     +   ++ G D + F ++R  G++ +  Q+     I    Y++ V A D+G   K +  ++ I +   +   PVF
Sbjct: 1237 NEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKI-IAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGS-NADITYSISATNNHGTFSIS----PNTGSIFL--VKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPE-NLPISTSVMSITAHDTDADINGLLEYSI-ALQTPRGGHFRIDSVSGVIYTNKDIDREFSNL-FELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTF------ISQNALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRG-DSDTFIMDRYSGDIRLASQLIPSKLI----YSLMVSATDHGTDRKSSRTELTIILQGTD--GPVF 1613          

HSP 33 Score: 92.8189 bits (229), Expect = 1.529e-17
Identity = 128/520 (24.62%), Postives = 220/520 (42.31%), Query Frame = 3
Query:  267 FNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSN--NYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPS-LSAYCYVTVHVIRINSFFPKFRIN-YVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLET-----TGYLDLN----ILQSDQLHARIKSTCPTQFIL 1787
            F ++  +G +  +  +DRE  +    +  L  +  +GQ    I + + + D ND+ P F  +     I E+++  + ++   A+D D+   GV+    Y +E  +ED  F L+ +        +  V R LD ET+  + LT+   D G       + V   + D ND+ P+F+ S YT  + ES   G  V+ V A+D D G +  +      +    + +FSI+  +G I +T        +    L+V A D G P+ LS+   V+V V  IN   P+F  + YV       +I     T   +  V   D+D      +  S+ G N E  F ++   G +    ++     +     T TV   D G   K  +  + +R       FP  + + ++ T   N   N+ +     +   AG    + Y I  G+  + F I++ SG +++ KPL +  ++K  L I ARD G              LD+N    + + +  HA I      Q +L
Sbjct: 1756 FRIDPESGELSATRRLDRERRS----KYSLLVRADDGQQSSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDS---GVNGEITYSVEEDDEDSTFLLNPI------TGVFNVTRALDFETQPFFILTVRAADGGG--RSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGG--DGQFSINPSTGLI-ITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYV------THIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEK-FKIDPIRGAITASEKLTGSSEV-----TFTVHVKDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAG---PLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVL 2241          

HSP 34 Score: 90.5077 bits (223), Expect = 7.756e-17
Identity = 110/417 (26.38%), Postives = 183/417 (43.88%), Query Frame = 3
Query: 4962 RIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDS------TLEYIWINEIPEFSLDKT---SG------IVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHN---FTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPV-----FDTTRLAVSIPEDVPINSEIIQLIASDADKSDL---LLFEILSPND----DLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLIN-VNDETPLIH 6110
            R    + +  ++  TG I   ++ +DRE++ G+ I V V+      +      T+V + + D NDN PVF + + +    E+ + G+++ + T  A D D+ S      T   I  N+  +F LD T   SG      +V+T G  LD E   ++   IQV D         + +     D   N   F H++Y   + E A + + + Q+   +     N  I + ++ E     F ++P  G +  +  +DYE    Y L I A D    SL+        T   V ++D+NDN PV     F TT    S+ E+  + + +  L  SD+D S     +   IL  N+    D+  +  P   +I  A +LD E+   + LTVS +D    L R +   L+  +N +ND  P+  
Sbjct:   67 RFSEQHKLFSINATTGVIYTSSV-IDREVLPGNIINVVVL------SSQPTYPTEVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDT--ATDADIGSNGVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGG--LDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITY-LLDEGTP--FQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLY------TRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQ 463          

HSP 35 Score: 87.4261 bits (215), Expect = 5.593e-16
Identity = 85/302 (28.15%), Postives = 138/302 (45.70%), Query Frame = 3
Query: 3636 IDHQQMVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNG--QVRYRLTATGMESISVFKID-----TFSGA---LYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTN---EVLYYLQSVHPPDHPFVINPISGILSVSNPILQEV--SFDLVVMAVDAERQDRYDQQSVKVHIKHDNEDE 4496
            I+ +   TYR S+  Q   FSIN  TG+I+  + +DRE +  +++ +V   +  T  +E   V      ++D+NDN+P+F  DA       E    G  +   TA D D G NG     YR+ +   +    F++D     +  GA   L     +D E  P +  +I   D G P     L V VTI +IND  P F+ E + +  V ++ A+G++V ++ A D D     E+ Y L        PF I+P +G + +   +  E    + L + AVD      Y +    V +   N+++
Sbjct:   58 IETKPAFTYRFSE--QHKLFSINATTGVIYTSSVIDREVLPGNIINVVVLSSQPTYPTEVRIV------VLDINDNAPVFP-DASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQ--RKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHE-QYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDE----GTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDND 343          

HSP 36 Score: 86.6557 bits (213), Expect = 8.938e-16
Identity = 153/594 (25.76%), Postives = 245/594 (41.25%), Query Frame = 3
Query: 8142 TAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GI--NVLEIGMLITVTDSNDNRP---QISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKR---------ETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF----ISRNFVASLRELDQLIVLPEVRDED---------SIMASRNEPSYTLKSKTSS----KVQLFQS----KTNFTLKILKRSTNESVINLILDV 9812
            TA   +DRE     ++ VI    +G +       I V DLNDN+P F  +       EN   G  I      D D     +  +SL+      F I+ ++G + L   ++    S Y+++V  SD G+      + + I+V D NDN P   Q+S E+      I  SE  +   F V   ATD D     N +I Y + S N R     +F +  D G L IKA     + D  ++  ++ A DR    L  S+ V  L         +  ST  Y   V +  +E  R A +      ++ E   F  +      F     N +++    V ++ L      +++  G  + S     S +           + + I D N   P+        SI+E  +  + LL+V   D D    G+V   I    +++     F  + NS Q+ +V  LDYE    YSL ++A D G    S T ++ I VLD++DNSP F    +S + + ++R + +L+      D D         SI A+ N  ++++   T S    K   +++    K N T K   R +  S I +I+ V
Sbjct:  833 TALGLIDREEQAFYQLRVIAR--AGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEV-TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEV-----TILESEPVNSRFFRVE--ATDKDSGV--NGEIVYDIISGNTR----DVFGIFPD-GQLYIKADLDREVQDRYSL--LVVAKDRAVESLSASVNVSILLDDINDNRPLFNST-NY---VFHFEEEQERGALVG----RVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEK----QFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMR-IGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHV 1394          

HSP 37 Score: 85.1149 bits (209), Expect = 2.699e-15
Identity = 73/255 (28.63%), Postives = 118/255 (46.27%), Query Frame = 3
Query:  147 KFLSSQYNFRVSENQPINTIVGQV------LIKFGFSYEFF----HKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKK-TLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQ 878
            +F+S QY F +SE  P  T+VG+V      L + G  Y        K G F++NK TG I  S  +DRE      +++      ++ G  ++ + + + ++D ND PP+F     + ++ E ++    ++  +A DSD+        Y I + +E + F ++       GQ+   V   LDRET   Y LTI   D G P   G   + + +ED NDN P    +   V  N+    G  V+ + + D D   NQ
Sbjct: 2852 RFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRG-FSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTIN----PQTGQV--SVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGEVMENQR--AGTPVMTLSSRDPDLAPNQ 3096          

HSP 38 Score: 83.9593 bits (206), Expect = 6.610e-15
Identity = 109/496 (21.98%), Postives = 211/496 (42.54%), Query Frame = 3
Query:  258 EGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLET--ISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQ-FKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPR-DLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLN-GKIIYS-ITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDLNI 1727
            +GLF+++  TGV+  +  +D E+     + +     T  G   +T  +++ +++ D NDNPP+F P +    + EN+   T +    ATD D+    +   Y I+S + D        G+       +     LD E K+ Y LT+   +           V I ++  N+  P F   +Y   ++E+   G  V +V+ASD D G +  V Y  F ++R   +  FSI++K+G I ++        +   +L V A + GS   +    V V++  +++  P      +        +  G +    +  V  +D D  P       +I   ++ N F +    G V +  ++       +  Y +T+ A+D+G+P+   +  +++ +   N   P     Y    V  N    + +    + D D   N G   YS ++ G     F I   +G +T  + +   ++    L ++ +D+GI  + +TG + + +
Sbjct: 2689 DGLFSVHSQTGVLSLAKTLDYETKQKHELRV---SATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALM-AYVIQSSDSDLFIIDPNTGI-------ITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSR---KRGFSINKKTGQIYVSGSLDREKEE-KISLKVLAKNAGSIRGADIDEVLVNITVLDANDPPVFTQELYDVQVNEGLSPGGL----VTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELD---RETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGE--VMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTISP-TGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKV 3159          

HSP 39 Score: 82.4185 bits (202), Expect = 2.012e-14
Identity = 161/640 (25.16%), Postives = 267/640 (41.72%), Query Frame = 3
Query: 7794 QTFFSINRESGQISLNEPLP-QLVSVYTLRIRAS------LKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISV-----SNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKV--IDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQP----PLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDN-LYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYE-IQHQ-----YSLTLLAHDLGFPR--KSQTSIVLIKVLDEDDNSPYFISRNFVASLRELDQ 9629
            Q  F ++  SG++S +  L  +  S Y L IRA+      L  V    +  KD      V DN        YF  +++EN  S  SV     S+  L  NG  K + T          ++ + T+   T    +DRE     ++ V   DG GG+    P I+ V  +D  DN  +F    +   + EN  +G+ I  +     D           G++ + F I  + G +     +DRE ++ Y+++V    G    E  + ITV D NDN P     + + + V N +   H    +    A+D D  ++ N  I YSL         K LF ++E  G +++    L   + +  ++V+  ASD G P     LF +I+V+ +   A      +     Y + +L +    SR   + A + D+ + GEI + IISGN    F I   +GQ+    +++  +  + +SL+V A    + S     S    +++++ D N   P    +       E  + G+ + +V   D D G    V+ +  T   +      F  N  +  L     LD E +  Q     +S T+L+ D G P+  K Q   V + + D +DN P F    + AS+ E  Q
Sbjct:  615 QNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKD------VNDNSPVFYPMQYF-ANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITA----GDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDG-GGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDLHTNITYLIASGDQRSLFGI--KAGQITALGLIDREEQAFYQLRVIARAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHH----IFQAKASDPD--EATNGMIVYSLKQN-----PKGLFHIHEKHGLISLTG-PLEVTTSSYQLEVV--ASDLGVPQRTSSLFLTISVYDVNDNAP-----VFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGI-FPDGQLYIKADLDREVQDR-YSLLVVAKDRAVES----LSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSN------FELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAK-VQVYIQDINDNPPKFTKDIYQASIAESAQ 1208          

HSP 40 Score: 81.2629 bits (199), Expect = 4.420e-14
Identity = 130/538 (24.16%), Postives = 228/538 (42.38%), Query Frame = 3
Query:  177 VSENQPINTIVGQV-----------LIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYK--KTLEGQF--LETISIKVRIIDENDNPPIFYP-NKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNED----DRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRS---VLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLIAVSIIGGNDENIFALERTHGNVHILRQIKAIHNINLQSYTITVRAIDNGNPSKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGINSLETTGYLDL 1721
            + EN PI+T V  +           L+++  + +   + G F ++ ++GVI T+  IDRE   S+L E+ +    + +  +F      ++ + + D+NDN P F   N L      NI + + ++   A D D    G    Y++  G+ D    DR++     ++   QL+          +K  Y L +S  D G        E+ II++    + PVFS  KY   L E    G  V+ + AS +  G   +VEY     RS        F+I R SG I+    T+  +++          + GS        + V+ I  ++  P+ +   V S     + ++  + +  L     Q   +    L+  +II G D++ F ++   G +   R++          Y++ VRA D+G  S    V+  I ++  N + P F     S  +  + S  S +A   A+D D+G+NG+I YS+ + D    F +   +G+  + + L F       L + A D G  S     Y +L
Sbjct: 1413 IPENLPISTSVMSITAHDTDADINGLLEYSIALQT-PRGGHFRIDSVSGVIYTNKDIDRE--FSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALVAE--SNIVIGSILTTVLAFDPDEGANG-EVEYELVRGDSDTFIMDRYSGD---IRLASQLI---------PSKLIYSLMVSATDHGTDRKSSRTELTIILQ--GTDGPVFSQPKYITILKEGQPAGTNVISLDAS-SPRGAGTKVEYFIVSVRSGGKAAGRLFTIGRHSGVIQ----TAAELDR----------EQGS----DLYLLDVYAIETDAKQPRTQHAEV-SFLFDFFFKVMLLLKGNLREHISQTCAEGANALVTYAIISGADDS-FRIDPESGELSATRRLDRERR---SKYSLLVRA-DDGQQSSDIWVN--ITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADGGGRSSSVRVYFNL 1903          

HSP 41 Score: 80.8777 bits (198), Expect = 4.887e-14
Identity = 133/554 (24.01%), Postives = 231/554 (41.70%), Query Frame = 3
Query: 8064 SKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGI-----IKVIDLNDNSPIFTLNYFMGFVSENALIGSWII-------DIGVIDADSKLFPLKFSLQGEENNAF----SINPQNGSVFL----AQTVDRELKSKYEMKVAVSDGINVLEIGML---ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLF--HSITVHFLFITAE---CELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDN---LYGEITFFIISGNGSSYFSIGSKN----GQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFISRNFVASLRE 9620
            +K +FT            NA T  I T+   +DREV     I+V++       + S P       I V+D+NDN+P+F     +    E+A  G  +I       DIG    D   + +   + G +   F    ++NP     FL       +DRE    Y++ + V D     + G L   +T+ D NDN P    E     +  +  E A     V+ I A+D D+    N++I Y L   ++  P    F ++  +G++ IK   L++ +  E   + I A D G P L+     TV  L +       + R   +T ++  +V   +Q G+ VA + V+  +     G I+  I+ GN   +F + S        I  +  ++   +  +   +  +   K L+  SF S    + + ++D N + P  + +   V ISE I  GS +  V   D D+G    ++ ++++      SL  F  + NS  +     L+ E   +  L + A D G   K   + +++ + D +D  P F    +  S+ E
Sbjct:   60 TKPAFTYRFSEQHKLFSINATTGVIYTSSV-IDREVLPGNIINVVV-------LSSQPTYPTEVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRI---ISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHE----QYQTSVFEDAAVGSSVLQIAASDLDEGA--NAEITYLL---DEGTP----FQIDPKAGTVVIKE-GLDYETKRE-YSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKF-ASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFAS----LVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGN----SLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITE 578          

HSP 42 Score: 80.8777 bits (198), Expect = 5.588e-14
Identity = 121/482 (25.10%), Postives = 203/482 (42.12%), Query Frame = 3
Query:  264 LFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNNYKIESGNEDDRFALSGVGVQYRGQLLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDLI-AVSIIGGNDENIFALERTHG----NVHILRQIKAIHNINLQSYTITVRAIDNGNPSK-QTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGIN 1691
            LF + + +GVI T+  +DRE   SDL  + +Y    + +   T   +V  + +      F+    +  ++    L   IS T A  ++         Y I SG  DD F +     +      L   R LDRE + KY L +  +D  Q      + V I V D ND++P FS S Y+  + E   PG  V  + ASD DSGVN E+ Y  ++     ++ F ++  +G   +T+       Q    L V A D G  S S   Y   +++ +N   P F      S    + +E        L +     D  +   L+ +V + GG+ +  F++  + G    +  + R+ +A       SY + V A D G P+   ++  + + +   N   P F +      +  + S  S +     TD D+G N ++ YS+T G   ++F I+   G IT  + L      ++   +  +D G N
Sbjct: 1664 LFTIGRHSGVIQTAAELDREQ-GSDLYLLDVYAIETDAKQPRTQHAEVSFLFD------FF---FKVMLLLKGNLREHISQTCAEGAN-----ALVTYAIISG-ADDSFRIDPESGE------LSATRRLDRERRSKYSLLVRADDGQQ---SSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDE--DSTFLLNPITGVFNVTRALDFE-TQPFFILTVRAADGGGRSSSVRVY--FNLLDVNDHPPLFN----SSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQ--FSINPSTGLIITSSLLDRETRA-------SYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLT-GRNSEKFKIDPIRGAITASEKL--TGSSEVTFTVHVKDGGTN 2099          

HSP 43 Score: 76.6406 bits (187), Expect = 1.082e-12
Identity = 113/441 (25.62%), Postives = 207/441 (46.94%), Query Frame = 3
Query: 7863 SVYTLRIRASLKMVNS-------KILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEISVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPG--IIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADS-KLFPLKFSL-QGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSD-GIN--VLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRIL------KSTFQYPIAVLYTSQE----GSRVANIAVNHDNLY--GEITFFIISGNGSSYFSIGSKNGQIST 9107
            S+YT R  A++K+++        K  ++  T    SV +N    T     T S  ++S +  ++S +IL   GN +  F +H     +        + I+ A   +DRE  ++  ++V ++D    +  S     +I V D+ND+ PIF    +   +SE+   GS+I  +   D DS +   L++SL  G     F+I+  +G V  A  ++RE  S+  + ++  D G+   +    +++ +TD ND  P  ++     T+ ++ +E +     +V ++ATD+D     N  IR+S  SE   +  ++ F L+  SG L+  +  L+   ++  + + I A+D G PPL HS+          C++ I        S   YP+      +E    GS V  +  +  +L   G + + I +G+ SS F I S +G+++T
Sbjct:  325 SLYT-RTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSIL--GGNEQRHFDVHSSPVPNL-------SLIKVASV-LDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQ----NTYHVSITEHSPAGSELVVLSATDSD--LGPNGTIRFSFDSETP-VSDQNKFRLDSTSGRLST-STELDREEESSYL-LYIRATDSGAPPL-HSV----------CKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGD-SSKFHISSTSGKVTT 733          

HSP 44 Score: 75.8702 bits (185), Expect = 1.994e-12
Identity = 154/651 (23.66%), Postives = 271/651 (41.63%), Query Frame = 3
Query: 7794 QTFFSINRESGQISLNEPLPQLVSVYTLRIRASLKMVNSKILWYKDTDVSISVYD---NVCKCTNHGYFTGSVE-----------ENSDSEISVSNNILS--CNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIADGSGGIIESCPGIIKVI----DLNDNSPIF-TLNYFMGFVSE---NALIGSWIIDIGVIDADSKLFP---LKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGM----------LITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITA-ECELRILKSTFQYPIAVLYTSQEGSRVANI-AVNHDNLY-GEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVI--SDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFP---RKSQTSIVLIKVLDEDDNSPYFISRNFVAS 9611
            +  F I+ + G ISL  PL    S Y L + AS   V  +        ++ISVYD   N        Y    +E           E +D +  V+  I+    +GN++  F + P      LY  A+          +DREV +   + V+  D +   +ES    + V     D+NDN P+F + NY   F  E    AL+G       V   D    P   +++S +  ++N F +N   G +     +DRE   +       S  +   + G+           + + D NDN P+ +K+I    +  + +E A     ++ ++A+D D+++  N  + Y ++  N+    +  F ++ +SG +T+    L++ +   +  + I A D G  PL  +  +    +   +      KST    + VL   + G  VA++ A + D+    +IT+ I + N    FSI    G I   + ++       + L V A            S+  +I ++I   DFN   P     +   SI E + + ++++ +   D DA + G+++ +I   T           +G  Y  K +   D E  + + LT+ A D   P   R+     V I V D++DN P FIS+N + +
Sbjct:  921 KGLFHIHEKHGLISLTGPLEVTTSSYQLEVVASDLGVPQRT---SSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPDGQ---LYIKAD----------LDREVQDRYSLLVVAKDRA---VESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGR------VFAEDKDFGPNSEVRYSFETPQSN-FELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDI----YQASIAESAQNMTQLLRVSASDVDENK--NGLVHYDITEGNE----EKQFSIDSNSGQVTLVG-KLDYET-TPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLS--VDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQ-SLYKLNVTA------KDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDI---DREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALVA 1521          

HSP 45 Score: 74.7146 bits (182), Expect = 3.960e-12
Identity = 150/631 (23.77%), Postives = 254/631 (40.25%), Query Frame = 3
Query: 7803 FSINRESGQISLNEPLP-QLVSVYTLRIRA----SLKMVNSKILWYKDTDVSISVYDNVCKCTNHGYFTGSVEENSDSEI-----SVSNNILSCNGNSKVSFTLHPKWSQDYLYYNAETNEIRTAHKPVDREVYNNLEISVIIAD-GSGGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSK---LFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEI------GMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITAT--DADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELR-ILKST----FQYP--IAVLYTSQ-EGSRVANIAVNHDNLYG-EITFFIIS----GNGSS-YFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYF 9587
            FSI+  SGQ++L   L  +    Y+L+I A    S+ + ++ +L       SISV D+     +    T SV+   +  I     SV+        N+ +++++    +      +  T  I    K +D E  +  +++V   D G      S P II V D NDN P+FT       + EN  I + ++ I   D D+    L     +LQ      F I+  +G ++  + +DRE  + +E+ +  +D     E        + I VTD NDN P         TF+   +  A  NI + +I  T    D  +  N ++ Y L   +        F+++  SG + +   A   I       ++++A+D G               ++  EL  IL+ T    F  P  I +L   Q  G+ V ++  +     G ++ +FI+S    G  +   F+IG  +G I T+  ++       + L V A  T         ++   ++ +  DF      +        IS+    G+N L              V   II+  DD F + P      S +L     LD E + +YSL + A D    ++S    V I V D +D++P F
Sbjct: 1242 FSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVL-------SISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKK-LDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIP---------TFISQNALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGD-----SDTFIMDRYSGDIRL---ASQLIPSKLIYSLMVSATDHGTD-----------RKSSRTELTIILQGTDGPVFSQPKYITILKEGQPAGTNVISLDASSPRGAGTKVEYFIVSVRSGGKAAGRLFTIGRHSGVIQTAAELDREQGSDLYLLDVYAIETDAKQPR---TQHAEVSFLF-DFFFKVMLLLKGNLREHISQTCAEGANAL--------------VTYAIISGADDSFRIDP-----ESGELSATRRLDRERRSKYSLLVRADD---GQQSSDIWVNITVSDINDHTPTF 1810          

HSP 46 Score: 74.7146 bits (182), Expect = 4.306e-12
Identity = 115/465 (24.73%), Postives = 202/465 (43.44%), Query Frame = 3
Query: 8244 IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDAD-----SKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGML---ITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKS--TFQYPIAVLYTSQEGSRVANIAVNHDNLYGE--ITFFIISGNGSSY-FSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRET-ITLVISDFNLYSPQIRISET-TVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSPYFIS 9593
            I V + N ++P F+ N     VSE   +G+ I  +   D D     + L     S  G ++  FS++ Q G + LA+T+D E K K+E++V+ +DG  + +   +   I VTD NDN P        + F +       G   VV + ATD D    +N+ + Y + S +       LF+++ ++G +T +        D E   V          P     +  ++ I  +     +    + QY   +   + +G+ V  +  +  +L GE  + +++I G      FSI  K GQI  S +++     +  SL V A   K   S+      E  + + + D N   P +   E   V ++E +  G  +  V   D D+  +       I +  +R +    P  G   Q+ V + LD E    Y+LT+LA D G P  + ++I+++ + D +DN P  ++
Sbjct: 2630 IAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNIS-SGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPV---EYFPVVQENVPSGTT-VVKMNATDKD--SGSNALMAYVIQSSD-----SDLFIIDPNTGIITTQGFL-----DYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDL-GEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDRE-KEEKISLKVLA---KNAGSIRGADIDEVLVNITVLDAN--DPPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTG---QVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVT 3067          

HSP 47 Score: 66.6254 bits (161), Expect = 1.002e-9
Identity = 112/497 (22.54%), Postives = 206/497 (41.45%), Query Frame = 3
Query: 8151 KPVDREVYNNLEISVIIADGSGGIIESCPGI---IKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPL-KFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVA---VSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSN--------NSQIR-YSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWIS----DNETVDVIITASDRGQPPLFHSITVHFLFITAEC-ELRILKSTFQYPIAVLYTSQEGSRVANIAVNHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPD-AGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDN 9575
            K +D E     E+ V   DG  G I     +   I+V D+NDN P+F    +   V EN   G+ ++ +   D DS    L  + +Q  +++ F I+P  G +     +D E K  Y + V    V D        + I +  +N+  P+     ++K +    SE A     V  + A+D D  +           S+ R +S++ +  +I V S  L  E    +++K +A N  S    D + V V IT  D   PP+F          T E  ++++ +      +    ++++   V +        +   T+ I + +  + F+I  + GQ+S +  ++   +   ++L + A    + S     +    + + + D N   P +    T   + E  + G+ ++ +   DPD A   G    +++++          PT     +L     +D E    + L++L  D G P+ S T  V IKV D++DN
Sbjct: 2705 KTLDYETKQKHELRVSATDG--GWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRF----VSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYV-SGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDPPVF----------TQELYDVQVNEGLSPGGLVTFVSAEDSDSVPS--------WSRFTYAIAANHERNTFTINPQTGQVSVASELDRETV-PVYNLTILA----VDSGSPAATGSAILIVTLEDINDNGPTLVT--TYGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTISPTG----ELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDN 3165          

HSP 48 Score: 66.6254 bits (161), Expect = 1.256e-9
Identity = 115/446 (25.78%), Postives = 191/446 (42.83%), Query Frame = 3
Query: 8307 VSENALIGSWIIDIGVIDADSKLFPLKFSLQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETV---DVIITASDRGQPPLFHSITVHFLFITAECELRILKSTF---QYPIAVLYTSQEGSRVANIAVN--HDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSP--QIRISETT---VSISELIKVGSNLLQVDVIDPDAGLA-GIVKLTIITSTDDRFSLV---PFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFP--RKSQTSIVLIKVLDEDDNSPYF 9587
            V E   +G+++   G I+     F  +FS   E++  FSIN   G ++ +  +DRE+     + V V          + I V D NDN P       + + V++  E A     V+  TATDAD   +      Y + S N +   +    +N       +  V+   + D ET     ++I   D+G+P  F  + V+   +T + ++     +F   QY  +V   +  GS V  IA +   +    EIT+ +  G   + F I  K G +     ++     + +SL + A    + S  +    R   T+ + D N   P  + R   TT    S+ E  +VG+ +  + V D D+  A G + ++I+   + R   V   P P   N   +KV + LD E    Y+LT+   D G P  R S  S+V+  V D +D+ P F
Sbjct:   45 VLEEQPVGTYV---GTIET-KPAFTYRFS---EQHKLFSINATTGVIYTSSVIDREVLPGNIINVVVLSSQPTYPTEVRIVVLDINDNAPVFP----DASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGGL-DRETTPFYQLLIQVEDKGEPKKFGYLQVN---VTIQ-DINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEG---TPFQIDPKAGTVVIKEGLDYET-KREYSLTIHAVDNGVPSLYT----RTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVP---NLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIF-VNDINDHPPIF 462          

HSP 49 Score: 66.2402 bits (160), Expect = 1.389e-9
Identity = 84/338 (24.85%), Postives = 154/338 (45.56%), Query Frame = 3
Query: 8409 NNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIGMLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVHFLFITAECELRILKSTFQYPIAVLYTSQEGSRVANIAV---NHDNLYGEITFFIISGNGSSYFSIGSKNGQISTSRNVNSAILGQWFSLIVQACGTKILSSVSFCSKRETITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVP 9413
            +++F I+P++G +   + +DRE +SKY + V   DG    +I + ITV+D ND+ P  S+ +   +F I   + + G+I V  I A+D D     N +I YS+  +++     S FLLN  +G   +   AL++ +    +  +  A   G+     S+ V+F  +       +  S+  Y  ++L +   G+ V  ++    +H N    +    +SG G   FSI    G I TS  ++      +  L+V + G +     +  S   T+++V++D N   P+         I      GS +  V V D D+G    +  ++     ++F + P
Sbjct: 1753 DDSFRIDPESGELSATRRLDRERRSKYSLLVRADDGQQSSDIWVNITVSDINDHTPTFSRSVY--SFDI-PEDMSPGSI-VAAILASDGDSGV--NGEITYSVEEDDE----DSTFLLNPITGVFNVTR-ALDFETQPFFILTVRAADGGGRS---SSVRVYFNLLDVNDHPPLFNSSV-YTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSG-GDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQ----PTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDP 2070          

HSP 50 Score: 66.2402 bits (160), Expect = 1.535e-9
Identity = 69/230 (30.00%), Postives = 101/230 (43.91%), Query Frame = 3
Query: 5460 QCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD----KSDLLLFEILSPNDD----LLMTVNP-----ITGVISTAGILDYEKTERHALTVSCTDGLHRVT---VEVLINLINVNDETP 6101
            +C   +  R  F + E  P+ T +G +  K     P F  +F   SE  K LFS+N   G+I T   ID E     I+ +         + L    T  T V + ++DINDN PVF    + VS  ED     ++I   A+DAD      D   + I+S ND     L +TVNP        ++ST G LD E T  + L +   D         ++V + + ++ND  P
Sbjct:   32 RCSVSSQVRQEFEVLEEQPVGTYVGTIETK-----PAFTYRF---SEQHK-LFSINATTGVIYTSSVIDREVLPGNIINV---------VVLSSQPTYPTEVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGG-LDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPP 242          

HSP 51 Score: 56.9954 bits (136), Expect = 8.745e-7
Identity = 48/164 (29.27%), Postives = 74/164 (45.12%), Query Frame = 3
Query: 9216 ITLVISDFNLYSPQIRISETTVSISELIKVGSNLLQVDVIDPDAGLAGIVKLTIITSTDDRFSLVPFPTNGNSYQLKVVNPLDYEIQHQYSLTLLAHDLGFPRKSQTSIVLIKVLDEDDNSP-----YFISRNFVASLRELDQ---LIVLPEVRDEDSIMASRN 9683
            + + I D N   P     +   S+ E   VGS++LQ+   D D G    +   +   T       PF  +  +  + +   LDYE + +YSLT+ A D G P     +   +K+LD +DN P     YF + +  AS+ E  Q   ++ L  V D DS  A+ N
Sbjct:  230 VNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGT-------PFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGN 386          

HSP 52 Score: 55.0694 bits (131), Expect = 3.095e-6
Identity = 71/268 (26.49%), Postives = 112/268 (41.79%), Query Frame = 3
Query: 8118 NAETNEIRTAHKPVDREVYNNLEISVIIADGS---GGIIESCPGIIKVIDLNDNSPIFTLNYFMGFVSENALIGSWIIDIGVIDADSKLFPLKFS---LQGEENNAFSINPQNGSVFLAQTVDRELKSKYEMKVAVSDGINVLEIG---MLITVTDSNDNRPQISKEIINKTFVINTSEFAHGNIFVVNITATDADDSQSNNSQIRYSLSSENQRIPVKSLFLLNEDSGSLTIKAVALNWISDNETVDVIITASDRGQPPLFHSITVH 8894
            N +T +I  +   +DRE    + + V+  +     G  I+     I V+D ND  P+FT   +   V+E    G  +  +   D+DS     +F+       E N F+INPQ G V +A  +DRE    Y + +   D  +    G   +++T+ D NDN P +       T      E       V+ +++ D D +  N     YSL S        S F ++      T + V    ISD   + V+I   D G P +  + TVH
Sbjct: 2904 NKKTGQIYVSGS-LDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTL------VTTYGEVMENQRAGTPVMTLSSRDPDLA-PNQGPFTYSLVSTGA---ASSYFTISPTGELTTSREVDREQISDF-YLSVLI--KDSGIPQMSSTGTVH 3156          
BLAST of Protocadherin Fat 4 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 231.106 bits (588), Expect = 2.413e-59
Identity = 260/1109 (23.44%), Postives = 499/1109 (45.00%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVD---VVEQE----FIFFITAEDHGIPRL---NSSVKVYVK-INPSPKSKQFFDKQTFFQNISEDMKITEKIFKL---EIDHQQ--MVTYRISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDT--NEVLYYLQSVHPP-DHPFVINPISGILSVSNPILQEVS--FDLVVMAVD----AERQDRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMYLLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTPGLKLFRLQALYPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYV---GTVQAH-----DKDLDSTLEYIWINEIPE-FSLDKTSGIVTTSGVPLDHEAVAYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTTNPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDAD--KSDLLLFEI---LSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDGLHRVTV----EVLINLINVNDETPLI-HNPTTVYLPKINQNHNIM--IKCSDQDNLGPLSYDIMTSSKDIQNIYVDRITGKVSFNPGLLYANSINVSLSCSD 6326
            + +YS  V+A ++  +  S  V V I + D NDN P+F++ +Y F      +    +G+VFA D D G N  V YS E    + +F E+++ +G L +   +D   ++ Q     F F + + D G+P+     + V+VY++ IN +P     F K  +  +I+E  +   ++ ++   ++D  +  +V Y I++  ++  FSI+ ++G + L+ +LD E    + L I+A D+ S   S       L ++++D NDNSP F    L+  +L E+ ++G ++   TA D D G N  + Y ++AT       F I   +G+++L + +DYE +  +   +TA D G P+  S++ V + + + ND  P F      + I  +N+ I T+V  + A D D   N +L Y  ++  P    F I+ +SG++  +  I +E S  F+L + A D    AE + R+  ++V + +   N++    ++  A++   +      + T+ A    +  N    Y L     D  I++RY+GD+ L S    +     + + + + +    T  K   T+L + +       F +  Y   + E +   G  +  L A  P    + +EY+I  +  G     K    +  + + +G I      LDRE                   GS +    V+    D    R   A  +F+F       +  K+ +   G ++ H      +  ++ + Y  I+   + F +D  SG ++ +   LD E  + +   ++  DG  +S   + I + D ND    F+   Y F I E     +++  +   +  +  N  I + +  +     F +NP  G+      +D+E    +IL + A D   +S         +  V  +++D+ND+ P+F+++    SI E +   + ++ + A+D D   S  LL  +   LS  D    ++NP TG+I T+ +LD E    + L V  +DG     +     V + + ++ND  P   H+P   ++P      +++  +  +D+D+          + ++ +   +D I G ++ +  L  ++ +  ++   D
Sbjct: 1039 QDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFET--PQSNF-ELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPK---FTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCV---LSISVLDDNDNSPSFPKSTLSVDVL-ENMRIGELVASVTATDSDSGSNADITYSISATNNH--GTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSI-PENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFR-RFALKNVTIWVTDQNDNIPTFISQNALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFIMDRYSGDIRLAS----QLIPSKLIYSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKYITILKEGQPA-GTNVISLDASSPRGAGTKVEYFIVSVRSG----GKAAGRLFTIGRHSGVIQTA-AELDRE------------------QGSDLYLLDVYAIETDAKQPRTQHAEVSFLFD------FFFKVMLLLKGNLREHISQTCAEGANALVTYAIISGADDSFRIDPESGELSATRR-LDRERRSKYSLLVRADDGQQSSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADGGGRS--------SSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHYSLSGGDGQF-SINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGSSEVTFTVHVKD 2089          

HSP 2 Score: 230.72 bits (587), Expect = 3.345e-59
Identity = 160/513 (31.19%), Postives = 258/513 (50.29%), Query Frame = 3
Query:  171 FRVSENQPINTIVGQVLIKFGFSYEFFHKEGLFNLNKLTGVILTSNIIDRESLASDLIEIFLYKKTLEGQFLETISIKVRIIDENDNPPIFYPNKLERRIIENIALLTDISLTAATDSDTDEFGVSNN-YKIESGNEDDRFALSGVGVQYRGQ---LLLRVVRPLDRETKEKYKLTISVEDKGQPPLKGVLEVEIIVEDYNDNSPVFSPSKYTVRLNESNLPGFEVVKVYASDADSGVNQEVEYQFKKTRSVLENEFSIDRKSGSIRLTQPTSCHINQGDCTLVVEAFDHGSPSLSAYCYVTVHVIRINSFFPKFRINYVGSTDKAAYIEIGKVTRKPLAIVHCQDDDQDPRDL-IAVSIIGGNDENIFALERTH-GNVHILRQIKAIHNINLQSYTITVRAIDNGNP-SKQTTVDMLIRINKANIYFPVFRNRYQSVTVYRNASINSFIANFFATDLDAGLNGKIIYSITKGDYRDRFAIEKDSGLITLLKPLWFVKLDKIKLEIIARDAGI 1688
            F V E QP+ T VG +  K  F+Y F  +  LF++N  TGVI TS++IDRE L  ++I + +    L  Q      +++ ++D NDN P+F    +     E+ +    + L  ATD+D    GV +  Y+I SGN+  +F L  + V   G+   L L     LDRET   Y+L I VEDKG+P   G L+V + ++D NDN P F   +Y   + E    G  V+++ ASD D G N E+ Y   +        F ID K+G++ + +       + + +L + A D+G PSL      TV ++ +N   P  +  Y  +T K A ++        +A++   D D    +  I+VSI+GGN++  F +  +   N+ +++    +    + SY +TV   DNG P ++ +   ++I +N  N + P+F+     V +  +    S+I    ATD D+G N  + YS+  G+    FAI ++SGL+T    L      +I L I A+D G+
Sbjct:   35 FEVLEEQPVGTYVGTIETKPAFTYRFSEQHKLFSINATTGVIYTSSVIDREVLPGNIINVVV----LSSQPTYPTEVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLD-ITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEG-----TPFQIDPKAGTVVIKEGLDYETKR-EYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGL 536          

HSP 3 Score: 204.527 bits (519), Expect = 2.451e-51
Identity = 218/921 (23.67%), Postives = 391/921 (42.45%), Query Frame = 3
Query: 10608 SGHLSVDRKGIIRIRKSIDKESVDSLTVQSSIQFKG---KSELLTLTVNVNDENDSESKSRITDIFIGIAENAFQLTRIAQLLPIDPDITGDFQCRLDTLNVPLGILIT-PDCWLHIINTSSAIRSINNSY-MRILHHDGYHNAVVSSFRMKVNLLNNKNIQTNWIVFKI-----PNLFITSXXXXXXXXXXXXXXXNVDVALMAIETVKNYLVIWP-------RSPNREKALQVVEQFKDKLEVVLKIEIQEITIRLCNRKLCNSHGLCSIGIQVNYEQLFTDEDSITANIIYIYPSVNFNIKCLCDDGFLGEKCAL-LAKCRQQVCHNGGVCGVNRNGEAVCECAPGYTGYNCEYDINECEKTNLCTPHGNCNNIRGGFKCECQLNWIGNGLCTQPFNYCSSNPCSELGTERCIPILGGFKCRCHFGNFGDHCQYSAISFPAESYMEMDFQKISK----MSLEFSTILKDTPLX----XXXXXXXXXXXXXXXXGSIRLSIFEDSALVSQRDSNKDLSNGNWWKLDXXXXXXXXXXXXXACEDWNQCDHTIDQFRTIRQRFDVSSSMGRNNVDSNSIIRVLIGSIQKLKLSGVQYFVGCARNLQF-FNGSLIRNEQKGV---LFDSCPRYRNGIL--PCSNSDLECGNVGKCIDEWFASRCECPPGYQPPSCTPGYSSYALAPNTIISFVKRPKSDSTNSNSPKNFDSYLKRK-----RSVSPEYTMISIRIKTRDRNSIIFMALSSFHSYTLVQLENGLVKVVDKY--AGSYQEMLHKVVTVNDDKIHTITVTRHSTGTVSVTVDFVVAQVNWLQSHDILGHSVNEVYLAGLP-DLKKIENSLSFPNFVGCISDVRFNNKTMPLRGLSENFNVSIIQGSVTSGCSSDICRQSGVCEKYQKCLEIDGIPHAIWGQYKCV 13250
            S + ++   G +   + +D+E +    +   I+  G    S   T+ + VND+ND+ S+SR  +I++    N F    +  + P DPDI   FQC   +L  P  +L + P     +I+ S   RS + ++ + +  +DG H+AV S  R+     NN  +  N I+ ++      +      +  L+I  + L  L   V +  +  + N   +         +  N        +  K+ L     ++I  +    C+   C + G C   + V  E     E+S+   ++   P   +   C C  G+ G  C   + +C+   CHNGG C  N  G   C C  G+TG  CE D+NEC  +N C     C N  GGF C C+  + G   C    NYC  NPC   G+  C   + G+ C C FG FG HC+ ++  F   SY  M+F  +      + ++F+T+ ++  L+    +     +  + + +  G +R S    S       S + +S+G +  +       +  +++  C +  +  +       +   + +     R +V     +R +   + +        FVGC   ++F  NG  +   Q      + D CPR     +  PC +        G C+D W   +C+C  G+  P+C           +T +S     + D   S S K  D  L+R      RSV  +++ + ++ +TR  +  +  A  S++ YT ++L+ GL++ V     AG  +  +  V+ ++D + HT+ + R+ + TV + +D   +++    + D  G  V+ + L G+P   +   ++L F    GC + V++N + +P  G     ++S    SV  GC      +S  C     C+         W  Y+CV
Sbjct: 3104 SSYFTISPTGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDNPSESRSVEIYVHYFGNMFPGGSLGVVKPQDPDIQDTFQC---SLTPPAALLFSIPTGTCDLISNS---RSTDGTFDLSVRSNDGVHSAVNSHVRVFFIGFNNATVD-NSILIRVTTKSASDFLSNHYLSFLRIANSQLAGLGTGVQIYGVFELNNSTFLTAAVKRGHSQYVNPSGVATFFQSIKEVLHRQSGVKIDSVDHDPCSHNPCQNGGSCKRRLGVGPE--MKTEESVPVILVSNQPLQPY--ACNCRPGYAGALCETDIDECQPTPCHNGGTCH-NLVGGFSCTCPDGFTGMACERDVNEC-LSNPCQNGALCQNYPGGFNCLCKSGFAGKA-CDSVINYCECNPCFNGGS--CQNRVEGYYCHCPFGVFGKHCELNSYGFEELSY--MEFPSLDPNNNYIYIKFATLKENALLMYNHDNQTGDKAEFLALEILEGRMRFSFNLGSGAYKLMTSIR-VSDGQFHTVIARRAGMAASLTIDLCGEEQEPGYCAVSNVAVHTDWILDVQPNRLSVGG---VRSIEALLHRSGQVSTHDFVGCI--MEFAVNGRPLEPSQALASHGIQDRCPRLEAACVSEPCRHG-------GTCLDMWSWQQCQCTDGFTGPTCE------KCDADTALSLDGSGRLDYALSQSRKR-DVLLERALQGPGRSVL-QHSSLELKFRTRSASGTLLHAQESYN-YTTLRLKGGLLQYVSDAGVAGKVERTVSDVL-LSDGQWHTLLLQRNGSSTV-LRIDRSSSKLILHNTQDFGGIDVHTLSLGGVPVPGQSHTHTLCFD---GCYAYVKYNGEMLPFSGEHRTVSISKTDPSVKIGCRGPNLCESSPCWDGLMCVN-------QWYTYQCV 3972          

HSP 4 Score: 187.963 bits (476), Expect = 2.788e-46
Identity = 260/1044 (24.90%), Postives = 448/1044 (42.91%), Query Frame = 3
Query: 3138 RKQYSFTVLAVNKNDKEKSTKVFVVIFVQDFNDNSPIFSTQSYFFSINRHTKPNTTIGKVFAMDPDSGINGFVNYSIEKLPVELDFVEIDSQSGRLFTNKLVDVVEQE-FIFFITAEDHGIPRLNSSVKVYVKINPSPKSKQFFDKQTFFQNISEDMKITEKIFKLEI---DHQQMVTY----RISKCTQKGAFSINQHTGIIHLINRLDREAIAFHVLTIVATDNSSTKGSEYLAVTNLYVNIIDVNDNSPIFKNDALNNFILSESTKVGTILGFYTANDIDDGLNGQVRYRLTATGMESISVFKIDTFSGALYLNQPVDYELKPKWNFIITAFDLGYPALHSNLSVTVTITNINDEKPRFNKESRLEFIVQQNVAIGTTVGRVYAQDPDTNEVLYYLQSVHPPDHPFVINPISGILSVSNPILQEVSFDLVVMAVDAERQ-----DRYDQQSVKVHIKHDNEDEIQVLTYGAIILPKSSFYREKIATLKAQSNSKNLNSRFMY-LLKNSSYDKIIINRYTGDVFLTSTTPVEFNSIDITFLISLESLRSDTLIKYHSTKLVLNIGDPHNLNFQKNDYFFQIPECKTTP-GLKLFRLQAL---YPGNPISDLEYYIFDIYCGISERIKLPNTMIRLDKETGWISVGNIYLDREIIEGSQITVEVVVIDRGKNGSRIRCTKVFLNIEDCNDNRPVFANETFIFHAPENTTYGQKIYVGTVQAHDKDLDSTLEYIWINEIPEFSLDKTSGIV---------TTSGVPLDHEAV-----AYFIGKIQVSDGTFTSTXXXXXXXXXXXXQCHNFTHDRYHFHIHETAPIHTVIGQVTLKNSTT-NPNFIIKFDIVSEWGKHLFSVNPDHGIITTQGEIDYEQDNHYILLITATDVSQQSLFLPCLETVTTTVLVSIVDINDNIPVFDTTRLAVSIPEDVPINSEIIQLIASDADK----SDLLLFEILSPNDDLLMTVNPITGVISTAGILDYEKTERHALTVSCTDG---LHRVTVEVLINLINVNDETPLIHNPTTVYLPKINQN 6149
            R +YS   L V  +D ++S+ ++V I V D ND++P FS