inositol phosphoceramide mannosyltransferase 2-like

Overview
Nameinositol phosphoceramide mannosyltransferase 2-like
Smed IDSMED30029533
Length (bp)1582
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of inositol phosphoceramide mannosyltransferase 2-like (SMED30029533) t-SNE clustered cells

Violin plots show distribution of expression levels for inositol phosphoceramide mannosyltransferase 2-like (SMED30029533) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of inositol phosphoceramide mannosyltransferase 2-like (SMED30029533) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for inositol phosphoceramide mannosyltransferase 2-like (SMED30029533) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029533

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029533SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000009925.1 Contig41uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000009925.1 Contig41newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig44uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig44newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000040831.1 Contig41uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000040831.1 Contig41newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000066332.1 Contig44uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000066332.1 Contig44newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig45uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029533SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig45newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30029533SMESG000037127.1 SMESG000016240.1 SMESG000016239.1 SMESG000016238.1 dd_Smed_v4_2982_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029533SMESG000037127.1 SMESG000016240.1 SMESG000016239.1 SMESG000016238.1 dd_Smed_v4_2982_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029533SMESG000037127.1 SMESG000016240.1 SMESG000016239.1 SMESG000016238.1 DN309016ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30029533SMESG000037127.1 SMESG000016240.1 SMESG000016239.1 SMESG000016238.1 DN309016ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30029533SMESG000037127.1 SMESG000016240.1 SMESG000016239.1 SMESG000016238.1 dd_Smed_v4_2982_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|Q9UT67|IMT2_SCHPO (Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 5.340e-25
Identity = 80/254 (31.50%), Postives = 122/254 (48.03%), Query Frame = 2
Query:  539 FAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEF-----------PTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSS------TADNVTGPLVMSNLIQKYKERYPS 1249
            FA V   L  S  L  +N+ L+   ++        S + +   Q ++   PSK   L              P + +IIHQ+WK    +P  +     S    +P+++Y+ WTD+ +R F+A ++ WFL  +D++P  + RADV RYF L+HYGG Y D+D+ C Q  + LL     V        R T   G   V N  M S P+HP++ EL+++       S      T    TGPL +S L +KYK + P+
Sbjct:   11 FAAVNFFLMSSIVLYFNNEFLM--FADRCTKDIIPSEELRYLRQVLNDSIPSKDEPLPTLKLDSLNDISGEPVIPKIIHQTWKTT-EVPEGWKGAQQSCIDLHPDYEYILWTDEMSRNFIADNYPWFLPYFDAYPFNVQRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLLYYPVWV--------RRTDPVG---VSNDVMGSVPHHPYF-ELIIQNLEKNAKSYWLPYLTIMLSTGPLSISFLWEKYKRQLPN 249          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|P33300|SUR1_YEAST (Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.159e-22
Identity = 78/269 (29.00%), Postives = 132/269 (49.07%), Query Frame = 2
Query:  497 MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKT-----SSTADNVTGPLVMSNLIQKYKE-RYPSSDDIKIYEARYF 1285
            M  +LKY I F I   ++LL + Y     ++  LL   + + +        +  +  ++++  +P K P+L     + +IIHQ++K    +P  +          +P++KY+ WTD+   EF+ + + WFL  ++++   I RAD  RYF L HYGG+Y D+D+ C +  + LLA  + +        R T   G   V N  M S P HPF+L+ L  + H          T    TGPL +S + ++YK  R P +  ++I +  Y+
Sbjct:    1 MRKELKYLICFNI---LLLLSIIY-----YTFDLLTLCIDDTV--------KDAILEEDLNPDAPPK-PQL-----IPKIIHQTYKTE-DIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL--------RKTSPLG---VSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYY 235          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|Q10323|IMT3_SCHPO (Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.927e-21
Identity = 60/181 (33.15%), Postives = 98/181 (54.14%), Query Frame = 2
Query:  722 TVTRIIHQSWKNNGSLPSAFSRFVPSWKKC---YPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEI------FHGKTSSTADNVTGPLVMSNLIQKYKE 1237
             + +IIHQ+WK N  +P    ++V + K C   +P+++Y+ WTD++ REF+A  + WFL +YDS+P  I RADV RYF L+ YGGIY D+D  C +  + LL           H P   +    + + N+ M     HPF L+++  +      +H    +   + TGPL +S +   +++
Sbjct:   56 AIPKIIHQTWKTN-EIPE---KWVGAQKSCIDLHPDYEYVLWTDESMREFIATDYPWFLTQYDSYPYNIERADVVRYFILYKYGGIYLDLDVGCNRTLDPLL-----------HYPAWVRRTSPSGISNNVMGFAKGHPFLLQVVRNLPRFAFNYHFPYLTVMYS-TGPLFLSIIWSAWRK 220          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|P38287|CSH1_YEAST (Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.775e-21
Identity = 64/207 (30.92%), Postives = 105/207 (50.72%), Query Frame = 2
Query:  725 VTRIIHQSWKNNGSLPSAFSRFVPSWKKC---YPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTS-----STADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNF 1321
            + +IIHQ++K N  +P    ++V   +KC   +P++ Y+ WTD+ +  F+ + + WFL  + S+   I RAD  RYF L HYGGIY D+D+ C +  + LL            VP   +      V N  M S P HPF+L+++  + H K +      T    TGPL +S + ++YK    ++++  +   R   P  +   N +F
Sbjct:   62 IPKIIHQTYKTN-DIPE---QWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLK-----------VPAFLRKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAV---RILQPADYKMHNNSF 250          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|O14084|IMT1_SCHPO (Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 2.497e-19
Identity = 67/253 (26.48%), Postives = 122/253 (48.22%), Query Frame = 2
Query:  497 MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPN---WKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEI--FHGKTSSTADNV---TGPLVMSNLIQKY 1231
            M  K +  +L  I    V+LL+ +  +L ++ + ++   +   F    S       A            ++E+ P   R+IHQ WK+  ++P  +S  V S ++ +P+   W+++ WTD+    F+ +++SWF+  + S+P  I + D  RYF L+HYGG+Y D+D  C +P + LL+  + +          T+  GY+   N +  + P HPF  + +  +  F+ +  +    V    GPL +S    KY
Sbjct:    1 MGRKCRKLLLKGIPICGVILLILWGYSLYNTLRFMVPGKATEPFTLSLSDVSDDTSAPG----------EMEKIP---RVIHQLWKDE-NIPERWSNTVNSCRRQHPDENGWQFILWTDEKIMSFMNENYSWFMPVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATFILPS-------TEPIGYS---NDWFAATPKHPFLYQAIHNLSKFNHRYFTKYPTVFLSAGPLFLSYQFCKY 229          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267DTA4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010228g2 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.335e-54
Identity = 118/318 (37.11%), Postives = 167/318 (52.52%), Query Frame = 2
Query:  497 MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFN-GQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYS-KPNHPFWLELLMEIFH----GKTSSTADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 1432
            M  +   F   ++S  I LLL       G+  KL+    S    N   N SR+     +N S  + ++         + +I+HQSWK    LP+   R+  SWK C+P+W++  WTD+ N   V  H++WFL  Y+     I RAD+ RYFYL+H+GGIY+D+D  C++ FEHLL   +LVFG ++  P  + L G   VQNSFM S +P HPFW+ LL  I      GK     DN TGP V+   ++ Y     ++ D+K+Y  +YFNP SW  +N   K CK F  ++D     C     K  +FV Q H+  WG
Sbjct:    1 MRHRNALFAAAVLSTCICLLLTIGGG--GNGAKLIKGAQSSTHMNPAGNPSRRDASGTKNASLKAQAR------ASNIIKILHQSWKTR-QLPARAVRWSASWKSCFPDWEWRLWTDQDNLALVRDHYAWFLPVYNGQRYNIERADLARYFYLYHFGGIYTDLDTVCMKNFEHLLHLETLVFGAMDTHPGDSVLPG-QLVQNSFMASLRPGHPFWMRLLRRIERNFNAGKRGRPEDN-TGPTVLMEELRLYVR--SNASDVKVYPGKYFNPFSWTLRNS--KICKDFGQMSDSVEKICINSFPK--AFVVQLHTQSWG 301          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A2R2MRS0 (inositol phosphoceramide mannosyltransferase 2-like OS=Lingula unguis OX=7574 GN=LOC106161453 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.697e-52
Identity = 96/238 (40.34%), Postives = 135/238 (56.72%), Query Frame = 2
Query:  719 PTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIF-HGKTSSTADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVW 1429
            P + RIIHQSW+N   LP  F+++  SW+ C+P+W++ FWTD+ NR F+  H+ WFL  YDS+   I RAD  RYFYL+HYGGIY D+D EC++PFEHL+    L+F   +            Y+QNS M S+  HPFW  L  ++  H K +   D  TGP  +   I+KY      ++D  +Y   YFNP  WG   QN   CK  N +TD++   C+ H     ++   +H+  W
Sbjct:  125 PIIPRIIHQSWRNK-DLPVQFAKWQQSWRACFPDWEFKFWTDEDNRAFIHAHYPWFLTTYDSYSHNIKRADAARYFYLYHYGGIYVDLDYECIKPFEHLIVK-DLIFESTDIRLEGNMYPHNPYIQNSLMISRSRHPFWKLLWQDLLTHTKKALKPDLATGPKRLMAAIKKYTM---YNEDYLVYPPCYFNPFPWG---QNLTHCKTLNRMTDQEVTACKAHY--PHAYTITFHAQSW 352          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1S3KDX7 (mannosyl phosphorylinositol ceramide synthase CSH1-like OS=Lingula unguis OX=7574 GN=LOC106181098 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 5.006e-50
Identity = 91/237 (38.40%), Postives = 138/237 (58.23%), Query Frame = 2
Query:  725 VTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKG-YNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 1432
            +  IIHQ+WK    LP  F ++  SW++C+P W+   WTD++++ F+ K + WFL+KY S+  EI RAD  RYF L+H+GG+Y D+D ECL+PF+HLL +  LVF  +    +     G + YVQNSFM S   HPFW+E++ E+            TGP ++ + ++ Y +   S  D +IY  +YFNP SW   +  +  CK  N++TD +   C+      G++   YH+  WG
Sbjct:  130 IPMIIHQTWKTR-QLPPRFRKWSRSWRRCFPEWELWLWTDESSKRFIYKRYPWFLEKYRSYDQEIKRADAARYFILYHFGGLYVDLDYECLRPFDHLL-DIPLVFDSMRVGNKWAYANGTFPYVQNSFMASTKGHPFWMEVIQEMTTRSGDQWPQGATGPYLIMDTLRNYSQ---SHSDFRIYPPQYFNPFSWDIYDNPY--CKDLNAMTDREIDLCKSQY--PGAYAISYHTQTWG 357          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8GI25 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008668g1 PE=4 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 6.904e-50
Identity = 96/261 (36.78%), Postives = 145/261 (55.56%), Query Frame = 2
Query:  725 VTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDIN----HVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKER------YPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG*LANVALDDKGHSNV 1477
            V R++HQSW N  +LP  F+R+  S+ +C+P ++Y  WTD+ NR  +A+H+ WFL ++DS+   + +ADV R FY++HYGG+Y D+D ECL  FEH+LAN SL FG ++    +    +       ++NSFMYS+P HPF+ EL+  + +  T       +GP ++   I   ++R      +     + IY    FNP SW   N     C++F   ++E  A+CR       S+V QYH+ VW         DKG  NV
Sbjct:   88 VIRLVHQSWVN-ATLPPLFARWAGSFGRCFPTYRYALWTDEDNRRLIAEHYPWFLARFDSYGVGVQKADVSRLFYMYHYGGLYCDLDCECLANFEHMLANTSLAFGAMDGKMIYSSSDSSYVDEGQIENSFMYSRPKHPFFWELI-RVLNTTTEGLPIMTSGPYLIMRGIHSARKRGLDKTKFDGLPYLTIYPPHLFNPYSWIRHNA--PSCRLFGDFSEESLARCRNSF--KTSYVIQYHTQVW---------DKGKHNV 333          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8FXP5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 9.641e-50
Identity = 107/327 (32.72%), Postives = 164/327 (50.15%), Query Frame = 2
Query:  560 LFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPT-----------VTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDIN----HVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKER------YPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG*LANVALDDKGHSNV 1477
            L  SD  GH         +  I  G N++      A  +      ++  L + P+           V R++HQSW N  +LP  F+R+  S+ +C+P ++Y  WTD+ NR  +A+H+ WFL ++DS+   + +ADV R FY++HYGG+Y D+D ECL  FEH+LAN SL FG ++    +    +       ++NSFMYS+P HPF+ EL+  + +  T       +GP ++   I   ++R      +     + IY    FNP SW   N     C++F   ++E  A+CR       S+V QYH+ VW         DKG  NV
Sbjct:   28 LLPSDGRGHRKP------ARGIQRGLNATPTSSKKASTVDRHRGGRQFPLLDDPSIAASVGSRDQPVIRLVHQSWVN-ATLPPLFARWAGSFGRCFPTYRYALWTDEDNRRLIAEHYPWFLARFDSYGVGVQKADVSRLFYMYHYGGLYCDLDCECLANFEHMLANTSLAFGAMDGKMIYSSSDSSYVDEGQIENSFMYSRPKHPFFWELI-RVLNTTTEGLPIMTSGPYLIMRGIHSARKRGLDKTKFDGLPYLTIYPPHLFNPYSWIRHNA--PSCRLFGDFSEESLARCRNSF--KTSYVIQYHTQVW---------DKGKHNV 333          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 103.605 bits (257), Expect = 1.669e-24
Identity = 78/269 (29.00%), Postives = 132/269 (49.07%), Query Frame = 2
Query:  497 MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKT-----SSTADNVTGPLVMSNLIQKYKE-RYPSSDDIKIYEARYF 1285
            M  +LKY I F I   ++LL + Y     ++  LL   + + +        +  +  ++++  +P K P+L     + +IIHQ++K    +P  +          +P++KY+ WTD+   EF+ + + WFL  ++++   I RAD  RYF L HYGG+Y D+D+ C +  + LLA  + +        R T   G   V N  M S P HPF+L+ L  + H          T    TGPL +S + ++YK  R P +  ++I +  Y+
Sbjct:    1 MRKELKYLICFNI---LLLLSIIY-----YTFDLLTLCIDDTV--------KDAILEEDLNPDAPPK-PQL-----IPKIIHQTYKTE-DIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL--------RKTSPLG---VSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYY 235          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 98.5969 bits (244), Expect = 6.877e-23
Identity = 64/207 (30.92%), Postives = 105/207 (50.72%), Query Frame = 2
Query:  725 VTRIIHQSWKNNGSLPSAFSRFVPSWKKC---YPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTS-----STADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNF 1321
            + +IIHQ++K N  +P    ++V   +KC   +P++ Y+ WTD+ +  F+ + + WFL  + S+   I RAD  RYF L HYGGIY D+D+ C +  + LL            VP   +      V N  M S P HPF+L+++  + H K +      T    TGPL +S + ++YK    ++++  +   R   P  +   N +F
Sbjct:   62 IPKIIHQTYKTN-DIPE---QWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLK-----------VPAFLRKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAV---RILQPADYKMHNNSF 250          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: OCH1 (Mannosyltransferase of the cis-Golgi apparatus; initiates the polymannose outer chain elongation of N-linked oligosaccharides of glycoproteins [Source:SGD;Acc:S000003006])

HSP 1 Score: 56.6102 bits (135), Expect = 4.694e-9
Identity = 30/102 (29.41%), Postives = 54/102 (52.94%), Query Frame = 2
Query:  725 VTRIIHQSWK---NNGSLPSAFSRFVPSWKKCY-PNWKYMFWTDKANREFVAKHFS---WFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFE 1009
            + + + Q+WK   ++ + PS+F  +  +W   Y P+++Y   +D +   F+   ++     ++ +   P  I +AD  RY  LF  GGIYSDMD   L+P +
Sbjct:   96 IPQRVWQTWKVGADDKNFPSSFRTYQKTWSGSYSPDYQYSLISDDSIIPFLENLYAPVPIVIQAFKLMPGNILKADFLRYLLLFARGGIYSDMDTMLLKPID 197          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000016238.1 (SMESG000016238.1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 306/312 (98.08%), Postives = 307/312 (98.40%), Query Frame = 2
Query:  497 MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 1432
            MNAKLKYFILF   FAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNG LPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPL MSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKI+NSITDEQHAKCREHLVKSGSFVAQYHSHVWG
Sbjct:    1 MNAKLKYFILFNFGFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGPLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLAMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIYNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 312          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000037127.1 (SMESG000037127.1)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 305/312 (97.76%), Postives = 307/312 (98.40%), Query Frame = 2
Query:  497 MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 1432
            MNAKLKY I+FIISFAIVLLLLFYSDALGHSNKLLIK LSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEF TVTRIIHQSWKNNG LPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPL MSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKI+NSITDEQHAKCREHLVKSGSFVAQYHSHVWG
Sbjct:    1 MNAKLKYLIVFIISFAIVLLLLFYSDALGHSNKLLIKTLSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFQTVTRIIHQSWKNNGPLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLAMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIYNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 312          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000016239.1 (SMESG000016239.1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 303/312 (97.12%), Postives = 304/312 (97.44%), Query Frame = 2
Query:  497 MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 1432
            MNAKLKYFILF   FAIVL LLFYSDALGHSNKLLIK LSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNN SLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIY DMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPL MSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKI+NSITDEQHAKCREHLVKSGSFVAQYHSHVWG
Sbjct:    1 MNAKLKYFILFNFGFAIVLFLLFYSDALGHSNKLLIKTLSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNASLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYPDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLAMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIYNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 312          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000016240.1 (SMESG000016240.1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 280/312 (89.74%), Postives = 282/312 (90.38%), Query Frame = 2
Query:  497 MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 1432
            MNAKLKYFILFIISFAIV LLLF SDALGHSNKLLIK LSE                        SKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVC+YFYLFHYGGIY DMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPL MSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKI+NSITDE HAKCREHLVKSGSFVAQYHSHVWG
Sbjct:    1 MNAKLKYFILFIISFAIVFLLLFNSDALGHSNKLLIKTLSET-----------------------SKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCKYFYLFHYGGIYPDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLAMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIYNSITDELHAKCREHLVKSGSFVAQYHSHVWG 289          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000016223.1 (SMESG000016223.1)

HSP 1 Score: 291.967 bits (746), Expect = 2.280e-95
Identity = 132/279 (47.31%), Postives = 190/279 (68.10%), Query Frame = 2
Query:  596 LLIKILSENIFNGQNSSRQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVPSWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYFYLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQNSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKERYPSSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSGSFVAQYHSHVWG 1432
            +L+ IL   +   + SS   K+ + ++   +P           + RIIHQSWK+  +  + F +  PSWK C+P W+Y FWTD  NR F+   + WFL  YDSF + I+RAD  RYFY++H+GGIY+D+DNEC++PFEHLLAN+S+VFGDI+HV ++T +K   YVQNSFMYS P HPFW+EL+  I    + ++AD  TGP  ++++I+ Y  R P+S  IKIYE +YFNPI+WGN+  N K CK  N++T+ ++ +CR+  ++ GS+V QYH+HVWG
Sbjct:   21 ILMVILFNYVVRTKISSEISKLRSLSLKNETP-----------IPRIIHQSWKSKKNFLNLFKKISPSWKICFPAWEYKFWTDDDNRNFIRNFYPWFLPTYDSFKSGIFRADCARYFYMYHFGGIYTDLDNECVKPFEHLLANYSMVFGDIHHVFKITTIKKVTYVQNSFMYSSPKHPFWIELIYRIMKKGSQASADVATGPYALTSMIETYINRKPNSHGIKIYEPKYFNPITWGNKLFNHKSCKSHNAMTEVEYLECRKFHIQQGSYVIQYHTHVWG 288          
The following BLAST results are available for this feature:
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UT67|IMT2_SCHPO5.340e-2531.50Inositol phosphoceramide mannosyltransferase 2 OS=... [more]
sp|P33300|SUR1_YEAST1.159e-2229.00Mannosyl phosphorylinositol ceramide synthase SUR1... [more]
sp|Q10323|IMT3_SCHPO1.927e-2133.15Inositol phosphoceramide mannosyltransferase 3 OS=... [more]
sp|P38287|CSH1_YEAST4.775e-2130.92Mannosyl phosphorylinositol ceramide synthase CSH1... [more]
sp|O14084|IMT1_SCHPO2.497e-1926.48Inositol phosphoceramide mannosyltransferase 1 OS=... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DTA43.335e-5437.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2R2MRS02.697e-5240.34inositol phosphoceramide mannosyltransferase 2-lik... [more]
A0A1S3KDX75.006e-5038.40mannosyl phosphorylinositol ceramide synthase CSH1... [more]
A0A1I8GI256.904e-5036.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FXP59.641e-5032.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SUR11.669e-2429.00Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
CSH16.877e-2330.92Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
OCH14.694e-929.41Mannosyltransferase of the cis-Golgi apparatus; in... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016238.10.000e+098.08SMESG000016238.1[more]
SMESG000037127.10.000e+097.76SMESG000037127.1[more]
SMESG000016239.10.000e+097.12SMESG000016239.1[more]
SMESG000016240.10.000e+089.74SMESG000016240.1[more]
SMESG000016223.12.280e-9547.31SMESG000016223.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029533 ID=SMED30029533|Name=inositol phosphoceramide mannosyltransferase 2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1582bp
CCAACATGATTTCGATCATGGGTGCGCAATGGTTATTAAAATCGTGCGGC
ATATCAGGTAAATTATCCCTAGGACCTGCAAGTGAAAGTCAGATCAATGA
GATGAATAATACCTTAGTTTAAAACTCCTGTACGTCCAACAATATATATG
AAATAGTTGATCAAAGTTATATTTAAGAGCTTGAATTATGATCATATTTC
CTTATGAAATCATAATTCAACTCTTAAAATTTAACTTTAAGTTATATAAC
AATATAAAAAACAACTTACTTAGCAGCCATTTAAAAAATGGCTGAAATGC
ATTTATTTTTTCACAAAAAATAAATTCCGCCAAGTTGATTTATGTGTCAA
CTTGAATTATAGCGGAATTTATCTCAATGGGGCTTGGTGTATTGAGAACT
AATTGCAAAATAGAACAATGTCAAAGTGCAAATCAATATCAATAATTATT
TGACCTTTAATTCAGCCAATCAAATCATAGATTTTCTTGACTTTCAATGA
ATGCGAAATTAAAATATTTCATTCTCTTTATCATCAGTTTTGCCATCGTT
TTGCTTCTCTTGTTCTACTCAGATGCGCTGGGACATTCCAATAAATTGCT
GATAAAGATTCTGAGTGAGAACATTTTCAATGGGCAAAACTCATCGAGAC
AAGGCAAGGTGCCAGCACAAAATATATCAACTGGAAGCCCTTCTAAACGA
CCAAAGCTGGAAGAGTTCCCAACCGTCACTAGGATCATCCACCAGTCATG
GAAAAACAACGGATCGTTACCATCCGCGTTCAGCAGGTTCGTACCGTCCT
GGAAGAAATGCTATCCCAATTGGAAGTACATGTTCTGGACTGACAAAGCT
AATCGAGAATTTGTTGCCAAGCATTTTTCTTGGTTCCTGAAGAAATATGA
CAGCTTCCCAACTGAGATCTATCGGGCTGATGTTTGTAGGTATTTCTACT
TGTTTCATTACGGTGGAATCTACTCCGACATGGACAACGAGTGTTTGCAG
CCGTTCGAGCATTTACTCGCCAACCACAGCTTGGTATTTGGTGACATCAA
TCATGTTCCGCGGGTTACCAAGCTGAAAGGTTATAATTACGTTCAGAATT
CCTTCATGTATTCCAAACCGAATCATCCATTTTGGTTGGAATTGCTGATG
GAAATATTCCATGGCAAAACGTCTTCTACAGCAGACAATGTCACTGGTCC
TCTGGTCATGTCAAATTTGATTCAGAAATACAAGGAGCGATATCCTTCAT
CGGACGACATCAAGATCTACGAGGCGCGATATTTCAATCCCATATCTTGG
GGCAATCAAAACCAAAATTTCAAAGATTGCAAAATATTTAATTCAATAAC
GGATGAGCAGCACGCAAAGTGCAGGGAGCATTTGGTGAAGTCAGGATCCT
TCGTGGCCCAATATCATTCCCATGTATGGGGTTGACTCGCAAACGTTGCA
CTGGACGATAAAGGACATTCCAATGTGTATACATGTGTGACATGTATATT
TTATATAGTTATTATTATATTTTTTTGAGTACAATAAATTTGAGATTTAA
ATTTTTATTTATGCATTCTTGCTAAACTGTGA
back to top

protein sequence of SMED30029533-orf-1

>SMED30029533-orf-1 ID=SMED30029533-orf-1|Name=SMED30029533-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=313bp
MNAKLKYFILFIISFAIVLLLLFYSDALGHSNKLLIKILSENIFNGQNSS
RQGKVPAQNISTGSPSKRPKLEEFPTVTRIIHQSWKNNGSLPSAFSRFVP
SWKKCYPNWKYMFWTDKANREFVAKHFSWFLKKYDSFPTEIYRADVCRYF
YLFHYGGIYSDMDNECLQPFEHLLANHSLVFGDINHVPRVTKLKGYNYVQ
NSFMYSKPNHPFWLELLMEIFHGKTSSTADNVTGPLVMSNLIQKYKERYP
SSDDIKIYEARYFNPISWGNQNQNFKDCKIFNSITDEQHAKCREHLVKSG
SFVAQYHSHVWG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007577GlycoTrfase_DXD_sugar-bd_CS
IPR029044Nucleotide-diphossugar_trans
Vocabulary: molecular function
TermDefinition
GO:0000030mannosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005622intracellular
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006675mannosyl-inositol phosphorylceramide metabolic process
GO:0006688glycosphingolipid biosynthetic process
GO:0030148sphingolipid biosynthetic process
GO:0051999mannosyl-inositol phosphorylceramide biosynthetic process
GO:0097502mannosylation