Glutamate [NMDA] receptor subunit 1

Overview
NameGlutamate [NMDA] receptor subunit 1
Smed IDSMED30029526
Length (bp)3273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate [NMDA] receptor subunit 1 (SMED30029526) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate [NMDA] receptor subunit 1 (SMED30029526) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate [NMDA] receptor subunit 1 (SMED30029526) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate [NMDA] receptor subunit 1 (SMED30029526) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029526

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30029526SMESG000010110.1 SMESG000001343.1 Contig45545uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029526SMESG000010110.1 SMESG000001343.1 Contig45545newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_8187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_8187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_8187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_8187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_5682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_5682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_5682_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30029526SMESG000010110.1 SMESG000001343.1 Contig44496uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029526SMESG000010110.1 SMESG000001343.1 Contig44496newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v6_5682_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v6_8187_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029526SMESG000010110.1 SMESG000001343.1 OX_Smed_1.0.21424ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_8187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30029526SMESG000010110.1 SMESG000001343.1 dd_Smed_v4_5682_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Human
Match: GRIN1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4584])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 309/602 (51.33%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  344 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 887          

HSP 2 Score: 168.318 bits (425), Expect = 0.000e+0
Identity = 109/316 (34.49%), Postives = 162/316 (51.27%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RL     ERES               D+ +  +  + + F     D    N T LL   +  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G++GLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQF-----DPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Human
Match: GRIN1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4584])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 309/602 (51.33%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  344 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 887          

HSP 2 Score: 168.318 bits (425), Expect = 0.000e+0
Identity = 109/316 (34.49%), Postives = 162/316 (51.27%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RL     ERES               D+ +  +  + + F     D    N T LL   +  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G++GLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQF-----DPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Human
Match: GRIN1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4584])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 309/602 (51.33%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  323 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 866          

HSP 2 Score: 170.629 bits (431), Expect = 0.000e+0
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RLE   ++ +  +  + + F     D    N T LL   +  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G++GLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEE-RESKAEKVLQF-----DPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Human
Match: GRIN1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4584])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 310/613 (50.57%), Postives = 394/613 (64.27%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESD 2893
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++     R  L  + D
Sbjct:  344 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQSTGGGRGALQNQKD 898          

HSP 2 Score: 168.318 bits (425), Expect = 0.000e+0
Identity = 109/316 (34.49%), Postives = 162/316 (51.27%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RL     ERES               D+ +  +  + + F     D    N T LL   +  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G++GLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQF-----DPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Human
Match: GRIN1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4584])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 310/613 (50.57%), Postives = 394/613 (64.27%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESD 2893
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++     R  L  + D
Sbjct:  323 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQSTGGGRGALQNQKD 877          

HSP 2 Score: 171.014 bits (432), Expect = 0.000e+0
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RLE   ++ +  +  + + F     D    N T LL   +  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G++GLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEE-RESKAEKVLQF-----DPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 361.688 bits (927), Expect = 3.340e-114
Identity = 227/583 (38.94%), Postives = 314/583 (53.86%), Query Frame = 2
Query: 1103 KIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPL---NLKKEVPCT---HTDPLT--KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEE--------------DALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGC-DRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKR 2782
            +I    T ++ F+DK +R+   YDI+N H     V  + VG                   ++L LD   I W G                    TK    S+P           L+VVT    PFV   PI    +C    N +   ++  ++  +   ++ PLT      ++CC G  IDLL  L+         T FT+ LHL     V  + +E      +G++GEL    AD+A+  +TI PER   V+FT+P+ Y G+ IL K     S + SFLQP +++LW  + +SV +V L +Y LD  SPF RF  A     ++              + +N   AMWF WGVLLNSG+ E TPRS SARVLG+VW GF MI+VASYTANLAAFLVLD+PE  ++G+ D RLRNP  +F F TV +S V QYFKR VE ++M+R ME +NV  A EA+  +  G L AFIWDS R+ FEA+R C+L T G +FGR+ YG+ ++K++PW   ++ A+L   E G ME LD  WI      C      SPA LGL NM  +FI+V++G+  G+FL F+E++Y +R
Sbjct:  331 EICGTSTSRVHFNDKCERIGVEYDIINFHMERKQVGNM-VG-------------------DILRLDEDSIEWAGG-------------------TKPLEISLPKH---------LRVVTVADPPFVYTTPIGSPSQCAELGNTVVEWSIFDKIVVSGPWYSCPLTLENSTEYFCCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGV-VQASETTGITISGVIGELDGDTADMAIGGITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSANFSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVRRASEAVHSLLNGSLDAFIWDSTRLEFEAARHCELRTRGSLFGRSAYGIGLQKNSPWTPHITSAILRMSESGVMEKLDQKWIDRGGPNCVVEAHKSPARLGLVNMKDIFILVSSGVALGIFLSFVEVSYGRR 864          

HSP 2 Score: 71.633 bits (174), Expect = 3.340e-114
Identity = 50/210 (23.81%), Postives = 101/210 (48.10%), Query Frame = 3
Query:  360 SASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWRE-ISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANC 986
            S+++T +FY +PV+G+  R + FS K  + +F+R   P S+EA V+  ++   ++R+ + L    D      +   E+       F+I    +   + ++++     +  + +    +  IVL+AK++ A RI   A  L   GK   WIV+E   +   +P G +G +L   + S  ++D+ S++   + + +   ++    I  P  C
Sbjct:  114 SSAYTLSFYKLPVVGVMVRDAEFSKKNIYPTFVRPTAPLSDEAFVFLHMLLSLKYRQVVVLSVKRDINADQFVEEFEKR---RVEFKIIVQRYIEVELNENLNDTLAESFEEV---TSNIIVLFAKKDDAVRIFANAGDLTGKGK--VWIVSESAGEAHNVPNGSLGCRLGQTAFSV-LRDSFSILKSAMETIFRESKI---DIFPPVEC 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 361.688 bits (927), Expect = 3.340e-114
Identity = 227/583 (38.94%), Postives = 314/583 (53.86%), Query Frame = 2
Query: 1103 KIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPL---NLKKEVPCT---HTDPLT--KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEE--------------DALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGC-DRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKR 2782
            +I    T ++ F+DK +R+   YDI+N H     V  + VG                   ++L LD   I W G                    TK    S+P           L+VVT    PFV   PI    +C    N +   ++  ++  +   ++ PLT      ++CC G  IDLL  L+         T FT+ LHL     V  + +E      +G++GEL    AD+A+  +TI PER   V+FT+P+ Y G+ IL K     S + SFLQP +++LW  + +SV +V L +Y LD  SPF RF  A     ++              + +N   AMWF WGVLLNSG+ E TPRS SARVLG+VW GF MI+VASYTANLAAFLVLD+PE  ++G+ D RLRNP  +F F TV +S V QYFKR VE ++M+R ME +NV  A EA+  +  G L AFIWDS R+ FEA+R C+L T G +FGR+ YG+ ++K++PW   ++ A+L   E G ME LD  WI      C      SPA LGL NM  +FI+V++G+  G+FL F+E++Y +R
Sbjct:  331 EICGTSTSRVHFNDKCERIGVEYDIINFHMERKQVGNM-VG-------------------DILRLDEDSIEWAGG-------------------TKPLEISLPKH---------LRVVTVADPPFVYTTPIGSPSQCAELGNTVVEWSIFDKIVVSGPWYSCPLTLENSTEYFCCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGV-VQASETTGITISGVIGELDGDTADMAIGGITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSANFSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVRRASEAVHSLLNGSLDAFIWDSTRLEFEAARHCELRTRGSLFGRSAYGIGLQKNSPWTPHITSAILRMSESGVMEKLDQKWIDRGGPNCVVEAHKSPARLGLVNMKDIFILVSSGVALGIFLSFVEVSYGRR 864          

HSP 2 Score: 71.633 bits (174), Expect = 3.340e-114
Identity = 50/210 (23.81%), Postives = 101/210 (48.10%), Query Frame = 3
Query:  360 SASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWRE-ISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANC 986
            S+++T +FY +PV+G+  R + FS K  + +F+R   P S+EA V+  ++   ++R+ + L    D      +   E+       F+I    +   + ++++     +  + +    +  IVL+AK++ A RI   A  L   GK   WIV+E   +   +P G +G +L   + S  ++D+ S++   + + +   ++    I  P  C
Sbjct:  114 SSAYTLSFYKLPVVGVMVRDAEFSKKNIYPTFVRPTAPLSDEAFVFLHMLLSLKYRQVVVLSVKRDINADQFVEEFEKR---RVEFKIIVQRYIEVELNENLNDTLAESFEEV---TSNIIVLFAKKDDAVRIFANAGDLTGKGK--VWIVSESAGEAHNVPNGSLGCRLGQTAFSV-LRDSFSILKSAMETIFRESKI---DIFPPVEC 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 198.364 bits (503), Expect = 1.036e-51
Identity = 135/460 (29.35%), Postives = 225/460 (48.91%), Query Frame = 2
Query: 1418 PKSFMKKTLLKVVTKRSIPFVEARPIKKG-EKCDTSNNPLNLKKEVPCTHTDPLTKIVTHY-CCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFE-NTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKD---FKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASR--TCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAY 2773
            P+    K  +KVVT    PF+    +    +KC  +   +    +V  T    + K  T   CC GYC+DLL +LAN  G       FTY L+ V D + G  K EN    W G++ +L+  +AD+ V  + +  ERA  ++F+ PF   G++I+VK      +  +FL+PFE +T  +++ + +HV A+ ++L +  SP+  F + K    E    +L  + W  W  L ++ +    P+S  +R++ +VWA F +  +A YTANLAAF++       +SGI D  L  P      F+F TV      +  KR       Y     Y   +    I+ VK  +L AFI+D+  + + A +   C L+T G+     GYG+   K++P    ++  +L + ++G +E L   W+         +++  A LG+ N    F+++A GI+  V ++  E  Y
Sbjct:  454 PQGAADKFHVKVVTLHEPPFIAVSDVDPDTQKCPGNQGSICDWGDVEYTDGAGVKKNRTLLKCCSGYCVDLLNKLANDIG-------FTYTLYKVRDEKWGL-KTENG---WNGLIADLMHNKADMCVTSLKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYS-FNMQKYPPPEHK-FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVLDYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHTSLVNHYMLQYQQKGDLERLQNFWLTGACTPDSHSQTQSAPLGIENFLSAFVLLAGGIIVSVIVLGFEHIY 900          

HSP 2 Score: 63.1586 bits (152), Expect = 1.129e-9
Identity = 42/190 (22.11%), Postives = 84/190 (44.21%), Query Frame = 3
Query:  273 VCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFY-NIPVMGISARQSAFS--DKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYS----DDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQI 821
            +C  +++ +  +   + +   Y+  T       T A Y  IP++  +A  + F+  +       ++  PP   +AR    L+R + W +  +V S    +D+    +   LE  S+ +  F +    H     D DV     D    ++  Q + I+LYA    A  I   A++++M+G+++ WI T+ +
Sbjct:  108 LCNNVTSNNVALIIFVTASETYDSTTAAEQYFLTAASYTGIPIIAWNADNAGFTFENDLGPYRIIQMAPPIEHQARAMLALLRRYNWPKFGVVTSEMAGNDRFVTAIREELELFSNKSTKFEMIHFSHMNTKNDTDVDLKLAD----VKKNQAKIILLYANAAQAGTIFSHAEKMDMIGEKYLWIGTQSV 293          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 191.045 bits (484), Expect = 1.448e-49
Identity = 132/419 (31.50%), Postives = 219/419 (52.27%), Query Frame = 2
Query: 1604 KGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKR-EQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKL------------AKSSSTEEDA-------LNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFK--RQVEYATMYRTMESYNV--NSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPA----TLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYK 2776
            +G+CIDLL  L+   G       FTY +H V DG+ G +K  N +  W GM+GE+L GEA++AVAP+T+   R+  V+FTKPF  LG++IL K  +  + +L SFL P    +W  +A S+  V L +Y +   +P+  + L            A + +T ++A        +  + +W+    +L  G   G PR+ S R+LG  W  F ++I+++YTANLAA L + RP   I  +DD  L N Q    + T++     Q+F+  R   +  M++ M+  +V   S  + +++    +  A++ +S  + +E  + C+L   G V G  GYG+A+ K + W   +S+ +L + +RG +E   T W   K   C  T S+       L + N+AG+FI +  GIV    ++  E+ ++
Sbjct:  466 EGFCIDLLAELSKDLG-------FTYTIHAVKDGKYGNDKYGNGS--WDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLSLGISILYKVPDDQQPDLFSFLNPLSWQIWTAIATSIITVTLGMYFVANVTPY-EWNLNFSCCTAHEPHPAAAFATNQEAPIVMSNNYSFWNTVWYVLSTMLKGGCDFG-PRAVSTRLLGGTWWVFYLVIISAYTANLAAVLTVSRPYIPIKNLDD--LAN-QTTISYGTIRGGSTMQFFQESRIAAHVKMWQYMKDKDVFVTSNGKGVERALSMNY-AYLMESTSLEYETQQNCNLTQIGGVLGSKGYGIALAKKSEWTDRISRQILLYAKRGIIEMKKTKWWRSKGAACASTASAVKHDRFALSMYNVAGLFITLGVGIVLAAIVVIFELIHR 869          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 187.193 bits (474), Expect = 2.902e-48
Identity = 135/433 (31.18%), Postives = 224/433 (51.73%), Query Frame = 2
Query: 1604 KGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKR---EQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAK-------SSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQ--VEYATMYRTMESYN----VNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEG--CDRTESSPATLGL-TNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGN 2845
            +G+CIDLL  +            F Y +  V DG  G E   +++ RW G++G L   EADL+++ +TIT  RA  V+FT PF +LG++IL+ R   E  K +L +FL+P   T+W+ + +S  +V+  +++L +FSP+  + L +       +   +++   + ++ WF  G L+  G  +  PR+ + R++ +VW  F  II++SYTA LAAFL ++R    I    D  L N QK  ++  +KS     +F+      Y  M+  MES +    VNS+ E I +VK G   A++ +S+ + +   R C+L + G +    GYG+A+ K +P    +S+ VL   ER  +E+L   W   + EG  C    S  AT     N+ G+F ++  G++    L   E   + R      +L +    +D +RGN
Sbjct:  430 EGFCIDLLNEMTQ-------VLKFNYTIIEVQDGTYGIE---DESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQG-SDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQD--LANQQK-IRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGY-AYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRREGPSCGPPPSEKATNSKPQNIFGIFYVLLTGLIVAFLLACGEYCIESRHEAFRLKLTIVGKFMDWYRGN 847          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Fly
Match: Nmdar1 (gene:FBgn0010399 transcript:FBtr0078763)

HSP 1 Score: 529.25 bits (1362), Expect = 0.000e+0
Identity = 310/612 (50.65%), Postives = 398/612 (65.03%), Query Frame = 2
Query: 1109 IDGRTGKIKFDDKGDRVMPVYDIVNV-HGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGE-KCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDT------KRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVK--AEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESDFHRYFNS 2914
            I G TG++ FDD GDR+   YD++N+      HV  V   +Y + R++             + ++  +IIWPG    +R+K                       P+  M  T L+++T    PFV  R +   E +C+          E PC   +        +CC+GYCIDLL  L+ R         FTYDL L  DG+ G     N+T      K WTG++GEL++  AD+ VAP+TI PERA  +EF+KPFKY G+TIL K+    S L SFLQPF NTLW+LV +SVHVVALVLYLLDRFSPFGRFKL+ S S EE ALNLSSA+WFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVL+RP+  +SGI+DARLRN  ++   ATVK S V+ YF+RQVE + MYRTME+ N  +AE+AI  VKKG L AFIWDS+R+ +EAS+ C+L+TAGE+FGR+GYG+ ++K +PW   ++ A+L FHE GFME LD  WI      + C+  E +P TLGL NMAGVFI+V  GI  GV LI IE+ YKK +  K+K L++A++A D+WRG IEKRK +R +L+ +  ++   NS
Sbjct:  346 ITGETGQVAFDDNGDRIYAGYDVINIREQQKKHV--VGKFSYDSMRAKMR-----------MRINDSEIIWPGK---QRRK-----------------------PEGIMIPTHLRLLTIEEKPFVYVRRMGDDEFRCEPD--------ERPCPLFNNSDATANEFCCRGYCIDLLIELSKRIN-------FTYDLALSPDGQFGHYILRNNTGAMTLRKEWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFKLSHSDSNEEKALNLSSAVWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLSGINDARLRNTMENLTCATVKGSSVDMYFRRQVELSNMYRTMEANNYATAEQAIQDVKKGKLMAFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFMEKLDKQWIFHGHVQQNCELFEKTPNTLGLKNMAGVFILVGVGIAGGVGLIIIEVIYKKHQVKKQKRLDIARHAADKWRGTIEKRKTIRASLAMQRQYNVGLNS 903          

HSP 2 Score: 171.4 bits (433), Expect = 0.000e+0
Identity = 117/343 (34.11%), Postives = 185/343 (53.94%), Query Frame = 3
Query:  120 YTIGALLSNESMIDEFKQSVDEAN--KKFEDMDIKFEVRAELMAKRALIAAEQVC-KLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERES----DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTI-QAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYKIVLLDQ*LESKSSTGE 1121
            Y IG +LSN    + F  ++   N  +++    + +  +   M K  +     VC KLI   + R+++++VSH   + D  P + S+T  FY+IPV+GIS+R +AFSDK  H SFLRTVPPY  +A VW E++  F + ++ +++S D +G+ +L R +  S    DD     +  TV    + +  ++S FT+ L  ++  Q+R  ++YA  E A+ I + A +  M G+   WIVTEQ L     P G++GLQL HA S+  HI+D+V V    +ASA I + ++  TI +AP +C              G S    E GK ++      Q L+S++ TGE
Sbjct:   39 YNIGGVLSNSDSEEHFSTTIKHLNFDQQYVPRKVTYYDKTIRMDKNPIKTVFNVCDKLI---ENRVYAVVVSHEQTSGDLSPAAVSYTSGFYSIPVIGISSRDAAFSDKNIHVSFLRTVPPYYHQADVWLEMLSHFAYTKVIIIHSSDTDGRAILGRFQTTSQTYYDD---VDVRATVELIVEFEPKLES-FTEHLIDMKTAQSRVYLMYASTEDAQVIFRDAGEYNMTGEGHVWIVTEQALFSNNTPDGVLGLQLEHAHSDKGHIRDSVYV----LASA-IKEMISNETIAEAPKDC--------------GDSAVNWESGKRLF------QYLKSRNITGE 349          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 199.134 bits (505), Expect = 4.641e-52
Identity = 134/408 (32.84%), Postives = 212/408 (51.96%), Query Frame = 2
Query: 1604 KGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSK-SNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPF---GRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFK--RQVEYATMYRTMESYN----VNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDR----TESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRR 2785
            +G+CIDLL+ +A + G       F Y + LV D   G    E  T  W G+V EL+   ADLAVA MTI   R + ++FTKPF  LG+ IL K   S+ + L SF+ P    +W+ V  +  +V+  L+++ RFSP+         K +   E+  ++S++ WF  G  L  G G   P++ S R++G  W  F +II++SYTANLAAFL ++R    IS I+ A     Q +  + T++      +F+  +   Y  M+R ME+      V + E+ I +V +G   AF+ +S  + +   R C+L   G +    GYG+A  K +PW  ++S A+L   E+G ++ L   W     + C+R     ES    LG+ N+ GVF+++  G+   V +   E  +  R+
Sbjct:  453 EGFCIDLLKAIATQVG-------FQYKIELVPDNMYGVYIPE--TNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLN-PKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVER---MISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSY-AFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWNSRK 846          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 199.134 bits (505), Expect = 4.641e-52
Identity = 134/408 (32.84%), Postives = 212/408 (51.96%), Query Frame = 2
Query: 1604 KGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSK-SNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPF---GRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFK--RQVEYATMYRTMESYN----VNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDR----TESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRR 2785
            +G+CIDLL+ +A + G       F Y + LV D   G    E  T  W G+V EL+   ADLAVA MTI   R + ++FTKPF  LG+ IL K   S+ + L SF+ P    +W+ V  +  +V+  L+++ RFSP+         K +   E+  ++S++ WF  G  L  G G   P++ S R++G  W  F +II++SYTANLAAFL ++R    IS I+ A     Q +  + T++      +F+  +   Y  M+R ME+      V + E+ I +V +G   AF+ +S  + +   R C+L   G +    GYG+A  K +PW  ++S A+L   E+G ++ L   W     + C+R     ES    LG+ N+ GVF+++  G+   V +   E  +  R+
Sbjct:  453 EGFCIDLLKAIATQVG-------FQYKIELVPDNMYGVYIPE--TNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLN-PKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVER---MISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSY-AFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWNSRK 846          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 193.741 bits (491), Expect = 2.573e-50
Identity = 134/407 (32.92%), Postives = 215/407 (52.83%), Query Frame = 2
Query: 1607 GYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSK-SNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEE----DALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQV--EYATMYRTME----SYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPA----TLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKR 2782
            G+C+D+L  ++   G       F Y L LV D + GA+  E  T  W GMV +L+  +ADLAV  MTIT  R + ++FTKPF  LG++IL K   S+ + L SF+ P    +W+ V ++  +V+L +Y++ + SP   +K   +   E     +  +L+ + WF  G  +     +  PR+ S R++   W  F++IIVASYTANLAAFL  +R    I+ I++A     Q +  + T+ S     +F+  V   Y  ++R+M+    S    + E+ I +V +G+  AF+ +S  + +   R C+L   G +    GYG+A  K +PW  ++S A+L   ERG ++ L   W     E C R  +S      +LGL ++ GVF+++ AGI+    + F E  Y  R
Sbjct:  432 GFCVDILETISREVG-------FDYILDLVPDRKYGAKDPE--TGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPI-EWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQS-PDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTER---MINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNY-AFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEFWYNFR 823          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 189.119 bits (479), Expect = 7.769e-49
Identity = 134/407 (32.92%), Postives = 214/407 (52.58%), Query Frame = 2
Query: 1607 GYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSK-SNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEE----DALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQV--EYATMYRTME----SYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDR----TESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKR 2782
            G+C+D+L  ++   G       F Y L LV D + GA+  E  T  W GMV +L+   ADLAV  MTIT  R + ++FTKPF  LG++IL K   S+ + L SF+ P    +W+ V ++  +V+L +Y++ + SP   +K   +   E     +  +L+ + WF  G  +     +  PR+ S R++   W  F++IIVASYTANLAAFL  +R    I+ I++A     Q +  + T+ S     +F+  V   Y  ++R+M+    S    + E+ I +V +G+  AF+ +S  + +   R C+L   G +    GYG+A  K +PW  ++S A+L   ERG ++ L   W     E C R     +S   +LGL ++ GVF+++ AGI+    + F E  Y  R
Sbjct:  432 GFCVDILETISREVG-------FDYILDLVPDRKYGAKDPE--TGEWNGMVAQLMK-YADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPI-EWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQS-PDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTER---MINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNY-AFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEFWYNFR 822          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Zebrafish
Match: grin1b (glutamate receptor, ionotropic, N-methyl D-aspartate 1b [Source:ZFIN;Acc:ZDB-GENE-051202-2])

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 315/599 (52.59%), Postives = 396/599 (66.11%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLK-KEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFT-PFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F+D GDR    Y I+N   +     LV+VG Y   +              ++N    KIIWPG +T K                          PK +   T LK+VT    PFV  +P  +   C   +    +K K+V CT    T P   IV   CC G+CIDLL +LA        FT  FTY++HLV DG+ G ++  N ++ K W GM+GELLSG AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  340 RVLMSSKYPDGLTGRVEFNDDGDRRFAHYSILNYQKT----RLVQVGVYNGSQV-------------VMNAQR-KIIWPGGETEK--------------------------PKGYQMSTRLKIVTIHQEPFVYVKPTLRDGTCKEEHTVNGVKIKKVICTGPNETIPGRPIVPQ-CCYGFCIDLLIKLA--------FTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 882          

HSP 2 Score: 176.792 bits (447), Expect = 0.000e+0
Identity = 114/316 (36.08%), Postives = 168/316 (53.16%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +++REF+W  I L+ SDD EG+    RL     ERE+               D+ +  +  + + F  D      +N T LL+  +  + R I+L A ++ A  I K A+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVTQANNIYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDMMREFQWNHIILIVSDDHEGRAAQKRLETLLEERETKSKNRNYENLDQLSFDNKRGPKAEKVLLFSQD------TNLTALLQEAKELEARVIILSASEDEAAAIYKVARQLNMTGSGYVWLVGEREMSGKALSEAPDGLLGLQLINGKNESAHIYDAVAVVAQSIQELFEKENIT----EPPRGCVGN 328          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Zebrafish
Match: grin1b (glutamate receptor, ionotropic, N-methyl D-aspartate 1b [Source:ZFIN;Acc:ZDB-GENE-051202-2])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 313/596 (52.52%), Postives = 394/596 (66.11%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLK-KEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFT-PFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIE 2851
            R ++  K  DG TG+++F+D GDR    Y I+N   +     LV+VG Y   +              ++N    KIIWPG +T K                          PK +   T LK+VT    PFV  +P  +   C   +    +K K+V CT    T P   IV   CC G+CIDLL +LA        FT  FTY++HLV DG+ G ++  N ++ K W GM+GELLSG AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++
Sbjct:  319 RVLMSSKYPDGLTGRVEFNDDGDRRFAHYSILNYQKT----RLVQVGVYNGSQV-------------VMNAQR-KIIWPGGETEK--------------------------PKGYQMSTRLKIVTIHQEPFVYVKPTLRDGTCKEEHTVNGVKIKKVICTGPNETIPGRPIVPQ-CCYGFCIDLLIKLA--------FTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQ 858          

HSP 2 Score: 180.259 bits (456), Expect = 0.000e+0
Identity = 111/296 (37.50%), Postives = 165/296 (55.74%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +++REF+W  I L+ SDD EG+    RLE   ++ +  +  + + F  D      +N T LL+  +  + R I+L A ++ A  I K A+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVTQANNIYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDMMREFQWNHIILIVSDDHEGRAAQKRLETLLEE-RETKAEKVLLFSQD------TNLTALLQEAKELEARVIILSASEDEAAAIYKVARQLNMTGSGYVWLVGEREMSGKALSEAPDGLLGLQLINGKNESAHIYDAVAVVAQSIQELFEKENIT----EPPRGCVGN 307          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Zebrafish
Match: grin1a (glutamate receptor, ionotropic, N-methyl D-aspartate 1a [Source:ZFIN;Acc:ZDB-GENE-051202-1])

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 311/599 (51.92%), Postives = 391/599 (65.28%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLN-LKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  +G TG+++F+D GDR    Y I+N   S     L++VG Y GT               +++     KIIWPG +T +                          P+ F   T LK+VT    PFV  +P      C     P   L K+V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GI AG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  340 RVLMSSKYPEGLTGRVEFNDDGDRKYAHYSILNYQKS----RLIQVGIYNGT---------------QVVMNKQRKIIWPGGETER--------------------------PRGFQMSTRLKIVTIHQEPFVYVKPTTLEGTCKEEYTPNGVLIKKVICTGPNETIPGRPIVPQ-CCYGFCIDLLIKLALTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIAAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 882          

HSP 2 Score: 175.637 bits (444), Expect = 0.000e+0
Identity = 114/316 (36.08%), Postives = 168/316 (53.16%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN+ +     K    +      A+  A  VC+ LIS+   ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW +++REFRW  I L+ SDD EG+    RL     ERE+               D+ +  +  + + F      + ++N T LL   +  + R I+L A +E A  + K A+ L M G  + W+V E+ +    L   P GLIGLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVTQANQVYGRDKFKLTAISVTHKANAIQMALSVCEDLISS---QVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAHVWFDMMREFRWNHIILIVSDDHEGRAAQKRLETLLEERETKNKKRNYENQDQLSYDNKRGPKAEKVLQF------NQETNLTALLLEAKELEARVIILSASEEDAAAVYKTARFLNMTGSGYVWLVGEREMSGKALSEAPDGLIGLQLINGKNESAHISDAVAVVAQSIQELFEKENIT----EPPRGCVGN 328          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Zebrafish
Match: grin1a (glutamate receptor, ionotropic, N-methyl D-aspartate 1a [Source:ZFIN;Acc:ZDB-GENE-051202-1])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 310/599 (51.75%), Postives = 390/599 (65.11%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLN-LKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  +G TG+++F+D GDR    Y I+N   S     L++VG Y GT               +++     KIIWPG +T +                          P+ F   T LK+VT    PFV  +P      C     P   L K+V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GI AG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++  K
Sbjct:  340 RVLMSSKYPEGLTGRVEFNDDGDRKYAHYSILNYQKS----RLIQVGIYNGT---------------QVVMNKQRKIIWPGGETER--------------------------PRGFQMSTRLKIVTIHQEPFVYVKPTTLEGTCKEEYTPNGVLIKKVICTGPNETIPGRPIVPQ-CCYGFCIDLLIKLALTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIAAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDNK 882          

HSP 2 Score: 176.022 bits (445), Expect = 0.000e+0
Identity = 114/316 (36.08%), Postives = 168/316 (53.16%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN+ +     K    +      A+  A  VC+ LIS+   ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW +++REFRW  I L+ SDD EG+    RL     ERE+               D+ +  +  + + F      + ++N T LL   +  + R I+L A +E A  + K A+ L M G  + W+V E+ +    L   P GLIGLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVTQANQVYGRDKFKLTAISVTHKANAIQMALSVCEDLISS---QVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAHVWFDMMREFRWNHIILIVSDDHEGRAAQKRLETLLEERETKNKKRNYENQDQLSYDNKRGPKAEKVLQF------NQETNLTALLLEAKELEARVIILSASEEDAAAVYKTARFLNMTGSGYVWLVGEREMSGKALSEAPDGLIGLQLINGKNESAHISDAVAVVAQSIQELFEKENIT----EPPRGCVGN 328          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Zebrafish
Match: grin1a (glutamate receptor, ionotropic, N-methyl D-aspartate 1a [Source:ZFIN;Acc:ZDB-GENE-051202-1])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 309/597 (51.76%), Postives = 390/597 (65.33%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLN-LKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEK 2854
            R ++  K  +G TG+++F+D GDR    Y I+N   S     L++VG Y GT               +++     KIIWPG +T +                          P+ F   T LK+VT    PFV  +P      C     P   L K+V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GI AG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N+++
Sbjct:  340 RVLMSSKYPEGLTGRVEFNDDGDRKYAHYSILNYQKS----RLIQVGIYNGT---------------QVVMNKQRKIIWPGGETER--------------------------PRGFQMSTRLKIVTIHQEPFVYVKPTTLEGTCKEEYTPNGVLIKKVICTGPNETIPGRPIVPQ-CCYGFCIDLLIKLALTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIAAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQQ 880          

HSP 2 Score: 176.022 bits (445), Expect = 0.000e+0
Identity = 114/316 (36.08%), Postives = 168/316 (53.16%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN+ +     K    +      A+  A  VC+ LIS+   ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW +++REFRW  I L+ SDD EG+    RL     ERE+               D+ +  +  + + F      + ++N T LL   +  + R I+L A +E A  + K A+ L M G  + W+V E+ +    L   P GLIGLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVTQANQVYGRDKFKLTAISVTHKANAIQMALSVCEDLISS---QVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAHVWFDMMREFRWNHIILIVSDDHEGRAAQKRLETLLEERETKNKKRNYENQDQLSYDNKRGPKAEKVLQF------NQETNLTALLLEAKELEARVIILSASEEDAAAVYKTARFLNMTGSGYVWLVGEREMSGKALSEAPDGLIGLQLINGKNESAHISDAVAVVAQSIQELFEKENIT----EPPRGCVGN 328          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Xenopus
Match: grin1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:NCBI gene;Acc:780048])

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 304/607 (50.08%), Postives = 387/607 (63.76%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTH-------------YCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+I+F++ GDR    Y I+N+        LV+VG +        D                KIIWPG +T +                          P+ +   T LK+VT    PFV  +P      C          +E    + DP+ K++ +              CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S  +L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  344 RVLMSSKYPDGVTGRIEFNEDGDRKFANYSIMNLQNR----KLVQVGIFNGSHVIQND---------------RKIIWPGGETER--------------------------PQGYQMSTRLKIVTIHQEPFVYVKPTMTDGTC----------REEYTINGDPIKKVICNGPNETIPGRPTVPQCCYGFCIDLLIKLAREMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLNILKSHENGFMEELDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 885          

HSP 2 Score: 166.777 bits (421), Expect = 0.000e+0
Identity = 109/316 (34.49%), Postives = 165/316 (52.22%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGK-------TLLSRLERES-------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP   D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW E++R F W  + L+ SDD EG+       TLL   E +S             D+ +  +  + + F     +    N T LL   +  + R I+L A ++ A  + K+A  L+M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV+V  Q I   +  + +T      P  C  N
Sbjct:   29 IGAVLSTKKHEQIFREAVNQANKRHGTWKIQLNATSVTHRPNAIQMALSVCEDLISS---QVYAILVSHPPAPTDHLTPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLETLLEEKESKSKKRNYENLDQLSYDNKRGPKADKVLQF-----EPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMTGAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVAAQAIHELFEMENIT----DPPRGCVGN 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Xenopus
Match: grin1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:NCBI gene;Acc:780048])

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 304/607 (50.08%), Postives = 387/607 (63.76%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTH-------------YCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+I+F++ GDR    Y I+N+        LV+VG +        D                KIIWPG +T +                          P+ +   T LK+VT    PFV  +P      C          +E    + DP+ K++ +              CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S  +L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  323 RVLMSSKYPDGVTGRIEFNEDGDRKFANYSIMNLQNR----KLVQVGIFNGSHVIQND---------------RKIIWPGGETER--------------------------PQGYQMSTRLKIVTIHQEPFVYVKPTMTDGTC----------REEYTINGDPIKKVICNGPNETIPGRPTVPQCCYGFCIDLLIKLAREMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLNILKSHENGFMEELDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 864          

HSP 2 Score: 171.4 bits (433), Expect = 0.000e+0
Identity = 106/296 (35.81%), Postives = 162/296 (54.73%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP   D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW E++R F W  + L+ SDD EG+    +LE   ++ K  +  + + F     +    N T LL   +  + R I+L A ++ A  + K+A  L+M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV+V  Q I   +  + +T      P  C  N
Sbjct:   29 IGAVLSTKKHEQIFREAVNQANKRHGTWKIQLNATSVTHRPNAIQMALSVCEDLISS---QVYAILVSHPPAPTDHLTPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLETLLEE-KESKADKVLQF-----EPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMTGAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVAAQAIHELFEMENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Xenopus
Match: grin1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:NCBI gene;Acc:780048])

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 304/607 (50.08%), Postives = 387/607 (63.76%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTH-------------YCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+I+F++ GDR    Y I+N+        LV+VG +        D                KIIWPG +T +                          P+ +   T LK+VT    PFV  +P      C          +E    + DP+ K++ +              CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S  +L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  344 RVLMSSKYPDGVTGRIEFNEDGDRKFANYSIMNLQNR----KLVQVGIFNGSHVIQND---------------RKIIWPGGETER--------------------------PQGYQMSTRLKIVTIHQEPFVYVKPTMTDGTC----------REEYTINGDPIKKVICNGPNETIPGRPTVPQCCYGFCIDLLIKLAREMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLNILKSHENGFMEELDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 885          

HSP 2 Score: 167.162 bits (422), Expect = 0.000e+0
Identity = 109/316 (34.49%), Postives = 165/316 (52.22%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGK-------TLLSRLERES-------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP   D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW E++R F W  + L+ SDD EG+       TLL   E +S             D+ +  +  + + F     +    N T LL   +  + R I+L A ++ A  + K+A  L+M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV+V  Q I   +  + +T      P  C  N
Sbjct:   29 IGAVLSTKKHEQIFREAVNQANKRHGTWKIQLNATSVTHRPNAIQMALSVCEDLISS---QVYAILVSHPPAPTDHLTPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLETLLEEKESKSKKRNYENLDQLSYDNKRGPKADKVLQF-----EPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMTGAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVAAQAIHELFEMENIT----DPPRGCVGN 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Xenopus
Match: grin1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:NCBI gene;Acc:780048])

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 304/607 (50.08%), Postives = 387/607 (63.76%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTH-------------YCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+I+F++ GDR    Y I+N+        LV+VG +        D                KIIWPG +T +                          P+ +   T LK+VT    PFV  +P      C          +E    + DP+ K++ +              CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S  +L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  323 RVLMSSKYPDGVTGRIEFNEDGDRKFANYSIMNLQNR----KLVQVGIFNGSHVIQND---------------RKIIWPGGETER--------------------------PQGYQMSTRLKIVTIHQEPFVYVKPTMTDGTC----------REEYTINGDPIKKVICNGPNETIPGRPTVPQCCYGFCIDLLIKLAREMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLNILKSHENGFMEELDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 864          

HSP 2 Score: 171.4 bits (433), Expect = 0.000e+0
Identity = 106/296 (35.81%), Postives = 162/296 (54.73%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP   D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW E++R F W  + L+ SDD EG+    +LE   ++ K  +  + + F     +    N T LL   +  + R I+L A ++ A  + K+A  L+M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV+V  Q I   +  + +T      P  C  N
Sbjct:   29 IGAVLSTKKHEQIFREAVNQANKRHGTWKIQLNATSVTHRPNAIQMALSVCEDLISS---QVYAILVSHPPAPTDHLTPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLETLLEE-KESKADKVLQF-----EPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMTGAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVAAQAIHELFEMENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Xenopus
Match: grin1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:NCBI gene;Acc:780048])

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 306/618 (49.51%), Postives = 389/618 (62.94%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTH-------------YCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESD 2893
            R ++  K  DG TG+I+F++ GDR    Y I+N+        LV+VG +        D                KIIWPG +T +                          P+ +   T LK+VT    PFV  +P      C          +E    + DP+ K++ +              CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S  +L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++   I     SA  D
Sbjct:  341 RVLMSSKYPDGVTGRIEFNEDGDRKFANYSIMNLQNR----KLVQVGIFNGSHVSHND---------------RKIIWPGGETER--------------------------PQGYQMSTRLKIVTIHQEPFVYVKPTMTDGTC----------REEYTINGDPIKKVICNGPNETIPGRPTVPQCCYGFCIDLLIKLAREMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLNILKSHENGFMEELDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQGAMIGNGGTSASLD 893          

HSP 2 Score: 167.162 bits (422), Expect = 0.000e+0
Identity = 109/316 (34.49%), Postives = 165/316 (52.22%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGK-------TLLSRLERES-------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP   D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW E++R F W  + L+ SDD EG+       TLL   E +S             D+ +  +  + + F     +    N T LL   +  + R I+L A ++ A  + K+A  L+M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV+V  Q I   +  + +T      P  C  N
Sbjct:   26 IGAVLSTKKHEQIFREAVNQANKRHGTWKIQLNATSVTHRPNAIQMALSVCEDLISS---QVYAILVSHPPAPTDHLTPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLETLLEEKESKSKKRNYENLDQLSYDNKRGPKADKVLQF-----EPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMTGAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVAAQAIHELFEMENIT----DPPRGCVGN 329          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Mouse
Match: Grin1 (glutamate receptor, ionotropic, NMDA1 (zeta 1) [Source:MGI Symbol;Acc:MGI:95819])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 308/602 (51.16%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+C+DLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  323 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCVDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 866          

HSP 2 Score: 172.94 bits (437), Expect = 0.000e+0
Identity = 110/301 (36.54%), Postives = 157/301 (52.16%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RL     ERES   K  +            D    N T LL   R  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEERESKAEKVLQF-----------DPGTKNVTALLMEARDLEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Mouse
Match: Grin1 (glutamate receptor, ionotropic, NMDA1 (zeta 1) [Source:MGI Symbol;Acc:MGI:95819])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 308/602 (51.16%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+C+DLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  344 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCVDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 887          

HSP 2 Score: 171.014 bits (432), Expect = 0.000e+0
Identity = 111/316 (35.13%), Postives = 162/316 (51.27%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RL     ERES               D+ +  +  + + F     D    N T LL   R  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQF-----DPGTKNVTALLMEARDLEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Mouse
Match: Grin1 (glutamate receptor, ionotropic, NMDA1 (zeta 1) [Source:MGI Symbol;Acc:MGI:95819])

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 308/602 (51.16%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+C+DLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  323 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCVDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 866          

HSP 2 Score: 172.94 bits (437), Expect = 0.000e+0
Identity = 107/296 (36.15%), Postives = 159/296 (53.72%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RLE   ++ +  +  + + F     D    N T LL   R  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEE-RESKAEKVLQF-----DPGTKNVTALLMEARDLEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Mouse
Match: Grin1 (glutamate receptor, ionotropic, NMDA1 (zeta 1) [Source:MGI Symbol;Acc:MGI:95819])

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 308/602 (51.16%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+C+DLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  344 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCVDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 887          

HSP 2 Score: 171.014 bits (432), Expect = 0.000e+0
Identity = 111/316 (35.13%), Postives = 162/316 (51.27%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RL     ERES               D+ +  +  + + F     D    N T LL   R  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQF-----DPGTKNVTALLMEARDLEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Mouse
Match: Grin1 (glutamate receptor, ionotropic, NMDA1 (zeta 1) [Source:MGI Symbol;Acc:MGI:95819])

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 309/613 (50.41%), Postives = 394/613 (64.27%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESD 2893
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+C+DLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++     R  L  + D
Sbjct:  323 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCVDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQSTGGGRGALQNQKD 877          

HSP 2 Score: 172.94 bits (437), Expect = 0.000e+0
Identity = 107/296 (36.15%), Postives = 159/296 (53.72%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RLE   ++ +  +  + + F     D    N T LL   R  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEE-RESKAEKVLQF-----DPGTKNVTALLMEARDLEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. UniProt/SwissProt
Match: sp|B4KD90|NMDA1_DROMO (Glutamate [NMDA] receptor subunit 1 OS=Drosophila mojavensis OX=7230 GN=Nmdar1 PE=3 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 310/606 (51.16%), Postives = 397/606 (65.51%), Query Frame = 2
Query: 1109 IDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGE-KCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDT------KRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVK--AEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESDFH 2899
            I G TG++ FDD GDR+   YD++N+    +H     VG +         +DS +  + ++ ++  +IIW G    +R+K                       P+  M  T LKV+T    PFV  R +   E +C+          E PC   +        +CC+GYCIDLL  L+ R         FTYDL L  DG+ G     N+T      K WTG++GEL++  AD+ VAP+TI PERA  +EF+KPFKY G+TIL K+    S L SFLQPF NTLW+LV +SVHVVALVLYLLDRFSPFGRFKL+ S S EE ALNLSSA+WFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVL+RP+  +SGI+DARLRN  ++   ATVK S V+ YF+RQVE + MYRTMES N  +AE+AI  VKKG L AFIWDS+R+ +EAS+ C+L+TAGE+FGR+GYG+ ++K +PW   ++ A+L FHE GFME LD  WI      + C+  E +P TLGL NMAGVFI+V  GI  GV LI IE+ YKK +  K+K L++A++A D+WRG IEKRK +R +L+ +  ++
Sbjct:  343 ITGETGQVAFDDNGDRIYAGYDVINIR---DHQKQHIVGKFS--------YDSLKAKM-IMRINDSQIIWGGK---QRRK-----------------------PEGIMIPTHLKVLTIEEKPFVYVRRMGDDEFRCEPD--------ERPCPLFNASDATANEFCCRGYCIDLLIELSKRIN-------FTYDLALSPDGQFGHYILRNNTGAMTLRKEWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFKLSHSDSNEEKALNLSSAIWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLSGINDARLRNTMENLTCATVKGSSVDMYFRRQVELSNMYRTMESNNYVTAEQAIQDVKKGKLMAFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFMEKLDKQWIFHGHVQQNCELFEKTPNTLGLKNMAGVFILVGVGIAGGVCLIIIEVIYKKHQVKKQKRLDIARHAADKWRGTIEKRKTIRASLAMQRQYN 895          

HSP 2 Score: 169.088 bits (427), Expect = 0.000e+0
Identity = 107/308 (34.74%), Postives = 174/308 (56.49%), Query Frame = 3
Query:  120 YTIGALLSNESMIDEFKQSVDEAN--KKFEDMDIKFEVRAELMAKRALIAAEQVC-KLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESD---DNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTI-QAPANCSVNPYKVETKK 1019
            Y IG +LS+    + F+ ++   N  +++    + +  +   M K  +     VC KLI   ++R+++++VSH   + D  P + S+T  FY+IPV+GIS+R +AFSDK  H SFLRTVPPY  +A VW E++  F + ++ +++S D +G+ +L R +  S    D+   R   TV    + +  ++S FT+ L  ++  Q+R  ++YA  E A+ I + A +  M G+   WIVTEQ L     P G +GLQL HA S+  HI+D+V V    +ASA I + ++  TI +AP +C  +    E+ K
Sbjct:   36 YNIGGVLSSSESEEHFRTTIAHLNFDQQYVPRKVTYYDKTIRMDKNPIKTVFNVCDKLI---EKRVYAVVVSHGQTSGDLSPAAVSYTTGFYSIPVIGISSRDAAFSDKNIHVSFLRTVPPYYHQADVWLEMLSHFLYTKVIIIHSSDTDGRAILGRFQTTSQTYYDDVDARA--TVELIVEFEPKLES-FTEHLIDMKTAQSRVYLVYASTEDAQVIFRDAAEYNMTGEGHVWIVTEQALHAKNTPDGALGLQLEHAHSDKGHIRDSVYV----LASA-IKEMISNETIAEAPKDCGDSAVNWESGK 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. UniProt/SwissProt
Match: sp|P35439|NMDZ1_RAT (Glutamate receptor ionotropic, NMDA 1 OS=Rattus norvegicus OX=10116 GN=Grin1 PE=1 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 309/602 (51.33%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  323 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 866          

HSP 2 Score: 173.326 bits (438), Expect = 0.000e+0
Identity = 110/301 (36.54%), Postives = 157/301 (52.16%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RL     ERES   K  +            D    N T LL   R  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEERESKAEKVLQF-----------DPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. UniProt/SwissProt
Match: sp|Q05586|NMDZ1_HUMAN (Glutamate receptor ionotropic, NMDA 1 OS=Homo sapiens OX=9606 GN=GRIN1 PE=1 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 309/602 (51.33%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  323 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 866          

HSP 2 Score: 170.629 bits (431), Expect = 0.000e+0
Identity = 105/296 (35.47%), Postives = 159/296 (53.72%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RLE   ++ +  +  + + F     D    N T LL   +  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G++GLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEE-RESKAEKVLQF-----DPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. UniProt/SwissProt
Match: sp|Q5R1P0|NMDZ1_CANLF (Glutamate receptor ionotropic, NMDA 1 OS=Canis lupus familiaris OX=9615 GN=GRIN1 PE=2 SV=2)

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 309/602 (51.33%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  344 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 887          

HSP 2 Score: 169.859 bits (429), Expect = 0.000e+0
Identity = 111/316 (35.13%), Postives = 161/316 (50.95%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RL     ERES               D  +  +  + + F     D    N T LL   R  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKSKKRNYENLDQLSYDHKRGPKAEKVLQF-----DPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 332          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. UniProt/SwissProt
Match: sp|P35438|NMDZ1_MOUSE (Glutamate receptor ionotropic, NMDA 1 OS=Mus musculus OX=10090 GN=Grin1 PE=1 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 308/602 (51.16%), Postives = 392/602 (65.12%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCD----TSNNPLNLKKEVPCT---HTDPLT-KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F++ GDR    Y I+N+        LV+VG Y      P D                KIIWPG +T K                          P+ +   T LK+VT    PFV  +P      C      + +P+   K+V CT    T P + +     CC G+C+DLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG+AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S ++L  HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  323 RVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNR----KLVQVGIYNGTHVIPND---------------RKIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPV---KKVICTGPNDTSPGSPRHTVPQCCYGFCVDLLIKLARTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 866          

HSP 2 Score: 172.94 bits (437), Expect = 0.000e+0
Identity = 107/296 (36.15%), Postives = 159/296 (53.72%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPY-NPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS       F+++V++ANK+     I+    +      A+  A  VC+ LIS+   ++++++VSHPP  N    P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS ++ VW E++R + W  I L+ SDD EG+    RLE   ++ +  +  + + F     D    N T LL   R  + R I+L A ++ A  + +AA  L M G  + W+V E+ +    L   P G+IGLQL +  +ESAHI DAV VV Q +      + +T      P  C  N
Sbjct:   29 IGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEE-RESKAEKVLQF-----DPGTKNVTALLMEARDLEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKENIT----DPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. TrEMBL
Match: A0A5K4F0R5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 392/661 (59.30%), Postives = 479/661 (72.47%), Query Frame = 2
Query: 1055 WQDYL*DCPPRSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHV--------------SLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGR-------------------------------------FKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSA 2884
            W+DY      R M+ +   DGRTG ++F++ GDR+ P+YDIVN   +   +              +LV VG+YG  +  P +W S EP   LL++++ K+IWPGN  +KR++ VC++R N   C K     V +AP SF KKT LKVVT  S+PFV+  P K  +KC+ S++PL  K E+ CTHTDP T I  HYCC GYCIDLLR LANRTG+E   TPFTYDLHLVGDG+VG + +EN+T +WTG++GE+LSG ADLAVAP++ITPERAARVEFTKPFKYLG+TILVKRE+++SNL SFLQPFE++LWVLVALSVHVVA VLYLLD FSPFGR                                      +  +    +E+ +NLSSA++FAW VLLNSGIGEGTP SFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDD RLRNPQKDF FAT++ SPVE YFKRQVE+ATMYR ME+ N +S EEAI  +K G LKAFIWDSAR+++E S  C+LITAGEVFGRN YGL MKK+NPWLYE+SQAVLNFHERG ME+LDT WI +K+  C+RTESSPATLGLTNMAGVFIM+  G+ AG  L F+E+   KRR  ++K+ EL+   + +WR  ++KR+  R  L+A
Sbjct:  129 WKDYATKLF-RDMLAMNFTDGRTGHLEFNEYGDRIKPIYDIVNAQITNQDINNLSAQKSFEFERPTLVSVGSYGVHQPTPMEWISDEPHPSLLSINLSKLIWPGNSIVKRQQLVCIQRANDGKCQKTEKRLVHAAPISFKKKTHLKVVTIESVPFVQTHP-KLSDKCNESDDPLVFKTEIECTHTDPTTGIKKHYCCYGYCIDLLRLLANRTGLELTSTPFTYDLHLVGDGQVG-DVDENETHKWTGIIGEILSGTADLAVAPVSITPERAARVEFTKPFKYLGITILVKRERARSNLGSFLQPFESSLWVLVALSVHVVAFVLYLLDHFSPFGRTNSDLDMSVDGSGSYSTLRQFDNEKQLNDKNTLTLTHLRQQQQQKEDEEGMNLSSAVYFAWAVLLNSGIGEGTPHSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDVRLRNPQKDFLFATIRGSPVEMYFKRQVEFATMYRVMETNNYDSVEEAIQAIKSGTLKAFIWDSARLNYEVSIDCELITAGEVFGRNSYGLVMKKNNPWLYELSQAVLNFHERGIMETLDTKWIHIKSNNCERTESSPATLGLTNMAGVFIMIGMGLAAGAILTFVEVLCAKRRCEQKKKHELSTATMQQWRDTVQKRQNDRYFLNA 786          

HSP 2 Score: 110.538 bits (275), Expect = 9.505e-21
Identity = 54/139 (38.85%), Postives = 84/139 (60.43%), Query Frame = 3
Query:  669 NFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQS-YSWLEVGKTIYKIVL 1082
            +F  LL+P+R EQTR I+L+ +++FAE +  AA++L ML  EWAWIVTEQ L    +P G+IG++L   +E  H+ DAV + TQ I      D   M  + +   CS NP ++++K    G+S Y W +    +++ +L
Sbjct:    3 DFISLLQPVRNEQTRVILLFLRRKFAEYVFLAARKLGMLEAEWAWIVTEQALDASNIPNGVIGVRLLQVTELDHVADAVRIATQSILHLVRTDYDAMKHLHSVKACSDNPSEIQSKSKLPGRSPYMWKDYATKLFRDML 141          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. TrEMBL
Match: A0A4S2LNE1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007498 PE=3 SV=1)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 395/646 (61.15%), Postives = 465/646 (71.98%), Query Frame = 2
Query: 1091 MIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVS----------------------LVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLA------------------------------------KSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEK 2854
            M+ V   DGRTG+I+FD  GDRV PVY+IVN       +S                      L+ +G YG  +  P  W S  P+ +LL+++M  I+WPGN   +R + VCV+RN    C +   + + SAP SF KKT L+VVT  S PFV  RP   GE+C+ S++P   + EV CTHTDP T + +HYCC G+CIDLLR LANRTG E N T FTYDLHLVGDG++G E  ENDT+RWTG+VGE+LSG ADLAVAP++ITPERA RVEF+KPFKYLG+TIL+KRE++KSNL SFLQPFENTLWVLVAL+VH VA VLYLLDRFSPFG  K +                                     SS+T ++ L LSSA++FAWGVLLNSGIGEGTPRSF ARVLGMVWAGFAMIIVASYTANLAAFLVLDRPE+SISGIDD RLRNPQKDF F TV+ S V+ YFKRQ+EY+TMYR M+SYN  S EEA++ VK G LKAFIWDS R++FEA+  CDLITAGEVFGR+GYGLAMKK NPWL E+SQAVLNFHERGFME LD+ WI V A+ C+RTESSPATLGLTNMAGVFIMVAAGI++GVF+ F EIA  K+RG  E    LA NAV  WR N+ +
Sbjct:  344 MLQVNFSDGRTGRIEFDQHGDRVRPVYEIVNAQFPREQLSDTGTVTQTSGLSGSAFGFQRPELIPIGHYGNPQPIPLSWYSPIPYPKLLSINMSAIVWPGNLIDQRAQLVCVQRNEDGTCRQTDKQVIASAPLSFKKKTHLRVVTALSKPFVNQRPKLSGERCNESDDPTQPRMEVECTHTDPDTGVTSHYCCSGFCIDLLRHLANRTGFEVNPTLFTYDLHLVGDGQIGEEVVENDTRRWTGIVGEILSGMADLAVAPISITPERATRVEFSKPFKYLGITILIKRERAKSNLGSFLQPFENTLWVLVALAVHAVAWVLYLLDRFSPFGLGKTSFSDAQKPPSYTEKPPPYLNKLSEEVVDAGGHQGPPDNSSATPKEGLTLSSAVYFAWGVLLNSGIGEGTPRSFCARVLGMVWAGFAMIIVASYTANLAAFLVLDRPESSISGIDDMRLRNPQKDFTFGTVRGSAVDMYFKRQMEYSTMYRVMQSYNRASVEEAVEAVKSGALKAFIWDSPRLNFEAASNCDLITAGEVFGRSGYGLAMKKGNPWLEELSQAVLNFHERGFMEKLDSVWIHVNADDCERTESSPATLGLTNMAGVFIMVAAGIISGVFITFAEIACAKKRGTDEHHSHLALNAVHMWRENVRR 989          

HSP 2 Score: 308.145 bits (788), Expect = 0.000e+0
Identity = 154/345 (44.64%), Postives = 222/345 (64.35%), Query Frame = 3
Query:   63 LFVSRYFNNFNIVNARTIKYTIGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERES----DDNKHFRITRTVHFPADEDDDVK-SNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYKIVL 1082
            + +S  F    + +   +++TIGAL+S+ + +  F++ V+  + +  D  ++F+ +  L++  AL A EQVC L + T  RM +L+VSHP      PPLS SFT +FY +P +GISARQ+AFSDKYSH SFLRTVPPYS EA +W +LI  F WRE+ +++S+DQ+ K LLS LER S      NK+F+I R V    DE+D  +  +F  LL+PIR EQTRAI+L+ ++ FAE I  AA++L ML  EWAWIVTEQ L    +PQG+IG++L  + E  H+ DAV V TQGI S   A+   M  +QA + C  +P ++++   + GQ+Y W E  + +Y  +L
Sbjct:    1 MLISAAFIALLLPSISGVEFTIGALVSDANTLANFERLVNSVSDEINDNLVRFDAQGGLLSLNALKATEQVCSLFNMTKGRMLALVVSHPSGAVGAPPLSVSFTTSFYYLPTIGISARQAAFSDKYSHVSFLRTVPPYSREAAIWADLIVAFGWREVCVIHSNDQDAKALLSGLERLSFLDPAGNKYFKIMRQVVINTDEEDAARVRDFVSLLRPIRNEQTRAILLFLRRSFAEYIFAAARKLGMLDAEWAWIVTEQALYASNIPQGVIGVRLLQSGELDHLADAVRVATQGILSLARANPHVMPVLQAVSACREDPLEIQSHPTQSGQTYGWNEYARKLYNHML 345          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. TrEMBL
Match: A0A075A8H0 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08421 PE=3 SV=1)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 397/644 (61.65%), Postives = 464/644 (72.05%), Query Frame = 2
Query: 1091 MIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVS----------------------LVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLA------------------------------------KSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNI 2848
            M+ V   DGRTG+I+FD  GDRV PVY+IVN       +S                      LV +G YG  +  P  W S  P+ +LL+++M  I+WPGN   +R + VCV+RN    C +   + + SAP SF KKT L+VVT  S PFV  RP   GE+C+ S++P   + EV CTHTDP T + +HYCC G+CIDLLR LANRTG E N T FTYDLHLVGDG++G E  ENDT+RWTG+VGE+LSG ADLAVAP++ITPERA RVEF+KPFKYLG+TIL+KRE++KSNL SFLQPFENTLWVLVALSVH VA VLYLLDRFSPFG  K+A                                     SS+T ++ L LSSA++FAWGVLLNSGIGEGTPRSF ARVLGMVWAGFAMIIVASYTANLAAFLVLDRPE+SISGIDD RLRNPQKDF F TV+ S V+ YFKRQ+EY+TMYR M+SYN  S EEA++ VK G LKAFIWDS R++FEA+  CDLITAGEVFGR+GYGLAMKK NPWL E+SQAVLNFHERGFME LD+ WI V A+ C+RTESSPATLGLTNMAGVFIMVAAGI++GVF+ F EIA  K+R   E    LA NAV  WR N+
Sbjct:  344 MLQVNFSDGRTGRIEFDQHGDRVRPVYEIVNAQFPRGQISDTGTVTQTSGLSGSAFGFQRPELVPIGHYGNPQPIPLLWYSSIPYPKLLSINMSAIVWPGNLIDQRAQLVCVQRNEDGTCRQTDKQVIASAPLSFKKKTHLRVVTALSKPFVNRRPKLSGERCNESDDPTQPRMEVECTHTDPDTGVTSHYCCSGFCIDLLRHLANRTGFEVNPTLFTYDLHLVGDGQIGEEVVENDTRRWTGIVGEILSGMADLAVAPISITPERATRVEFSKPFKYLGITILIKRERAKSNLGSFLQPFENTLWVLVALSVHAVAWVLYLLDRFSPFGLGKMAFSDAQKPPSFPEKPPPYLNKPSEEAVDAGEHQGPPDNSSATPKEGLTLSSAVYFAWGVLLNSGIGEGTPRSFCARVLGMVWAGFAMIIVASYTANLAAFLVLDRPESSISGIDDMRLRNPQKDFTFGTVRGSAVDMYFKRQMEYSTMYRVMQSYNRASVEEAVEAVKSGALKAFIWDSPRLNFEAASNCDLITAGEVFGRSGYGLAMKKGNPWLEELSQAVLNFHERGFMEKLDSVWIHVNADDCERTESSPATLGLTNMAGVFIMVAAGIISGVFITFAEIACAKKRRTDEHHSHLALNAVHMWRENV 987          

HSP 2 Score: 311.997 bits (798), Expect = 0.000e+0
Identity = 156/345 (45.22%), Postives = 223/345 (64.64%), Query Frame = 3
Query:   63 LFVSRYFNNFNIVNARTIKYTIGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERES----DDNKHFRITRTVHFPADEDDDVK-SNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYKIVL 1082
            + +S  F    + +   +++TIGAL+S+ +++  F++ V+  + +  D  ++F  +  L++  AL A EQVC L + T  RM +LIVSHP      PPLS SFT +FY +P +GISARQ+AFSDKYSH SFLRTVPPYS EA +W +LI  F WRE+ +++S+DQ+ K LLS LER S      NK+F+I R V    DE+D  +  +F  LL+PIR EQTRAI+L+ ++ FAE I  AA++L ML  EWAWIVTEQ L    +PQG+IG++L  +SE  H+ DAV V TQGI S   A+   M  +QA + C  +P ++++   + GQ+Y W E  + +Y  +L
Sbjct:    1 MLISAAFIALLLPSISGVEFTIGALVSDANILANFERLVNSVSDEINDNLVRFNAKGGLLSLNALKATEQVCSLFNVTKGRMLALIVSHPSGAVGAPPLSVSFTTSFYYLPTIGISARQAAFSDKYSHVSFLRTVPPYSREAAIWADLIVAFGWREVCVIHSNDQDAKALLSGLERLSILDPAGNKYFKIMRQVAINTDEEDAARVRDFVSLLRPIRNEQTRAILLFLRRSFAEYIFAAARKLGMLDAEWAWIVTEQALYASNIPQGVIGVRLLQSSELDHLADAVRVATQGILSLARANPHVMPVLQAVSACREDPLEIQSHPTQSGQTYGWNEYARKLYNHML 345          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. TrEMBL
Match: A0A3R7JKC9 (Glutamate [NMDA] receptor subunit 1 OS=Clonorchis sinensis OX=79923 GN=Nmdar1 PE=3 SV=1)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 399/648 (61.57%), Postives = 467/648 (72.07%), Query Frame = 2
Query: 1091 MIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVH---------GSPNHVS-------------LVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLA------------------------------------KSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            M+ V   DGRTG+I+FD  GDRV PVY+IVN           G+    S             LV +G YG  +  P  W S  P+ +LL+++M  I+WPGN   +R + VCV+RN    C +   + + SAP SF KKT L+VVT  S PFV  RP   GE+C+ S++P   + EV CTHTDP T + +HYCC G+CIDLLR LANRTG E N T FTYDLHLVGDG++G E  ENDT+RWTG+VGE+LSG ADLAVAP++ITPERA RVEF+KPFKYLG+TIL+KRE++KSNL SFLQPFENTLWVLVALSVH VA VLYLLDRFSPFG  K A                                     SS+T ++ L LSSA++FAWGVLLNSGIGEGTPRSF ARVLGMVWAGFAMIIVASYTANLAAFLVLDRPE+SISGIDD RLRNPQKDF F TV+ S V+ YFKRQ+EY+TMYR M+SYN  S EEA++ VK G LKAFIWDS R++FEA+  CDLITAGEVFGR+GYGLAMKK NPWL E+SQAVLNFHERGFME LD+ WI V A+ C+RTESSPATLGLTNMAGVFIMVAAGI++GVF+ F EIA  K+R   E    LA NAV  WR N+ K++
Sbjct:  263 MLQVNFSDGRTGRIEFDQHGDRVRPVYEIVNAQFPREQRSDSGTVTQTSGLSGSAFGFQRPELVPIGHYGNPQPIPVLWYSPIPYPKLLSINMSAIVWPGNLIDQRAQLVCVQRNEDGTCRQTDKQVIASAPLSFKKKTHLRVVTALSKPFVNRRPKLSGERCNESDDPTQPRMEVECTHTDPDTGVTSHYCCSGFCIDLLRHLANRTGFEVNPTLFTYDLHLVGDGQIGEEVVENDTRRWTGIVGEILSGMADLAVAPISITPERATRVEFSKPFKYLGITILIKRERTKSNLGSFLQPFENTLWVLVALSVHAVAWVLYLLDRFSPFGLGKAAFSDAQKPPSYPEKPPPYLNKLSEEVVDAGGYQGPPDNSSATPKEGLTLSSAVYFAWGVLLNSGIGEGTPRSFCARVLGMVWAGFAMIIVASYTANLAAFLVLDRPESSISGIDDMRLRNPQKDFTFGTVRGSAVDMYFKRQMEYSTMYRVMQSYNRASVEEAVEAVKSGALKAFIWDSPRLNFEAASNCDLITAGEVFGRSGYGLAMKKGNPWLEELSQAVLNFHERGFMEKLDSVWIHVNADDCERTESSPATLGLTNMAGVFIMVAAGIISGVFITFAEIACAKKRRTDEHHSHLALNAVHMWRENVRKKQ 910          

HSP 2 Score: 265.774 bits (678), Expect = 0.000e+0
Identity = 131/264 (49.62%), Postives = 178/264 (67.42%), Query Frame = 3
Query:  306 MFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERES----DDNKHFRITRTVHFPADEDDDVK-SNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYKIVL 1082
            M +L+VSHP      PPLS SFT +FY +P +GISARQ+AFSDKYSH SFLRTVPPYS EA +W +LI  F WRE+ +++S+DQ+ K+LLS LER S      NK+F+I R V    DE+D  +  +F  LL+PIR EQTRAI+L+ ++ FAE I  AA++L ML  EWAWIVTEQ L    +PQG+IG++L  + E  H+ DAV V TQGI S   A+   M  +QA + C  +P +++++  + GQ+Y W E  + +Y  +L
Sbjct:    1 MLALVVSHPSGAVGAPPLSVSFTTSFYYLPTIGISARQAAFSDKYSHVSFLRTVPPYSREAAIWADLIVAFGWREVCVIHSNDQDAKSLLSGLERLSILDPAGNKYFKIMRQVAINTDEEDAARVRDFVSLLRPIRNEQTRAILLFLRRSFAEYIFAAARKLGMLDAEWAWIVTEQALYASNIPQGVIGVRLLQSGELDHLADAVRVATQGILSMARANPHVMPVLQAVSACREDPLEIQSQPTQSGQTYGWNEYARKLYNHML 264          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. TrEMBL
Match: A0A4Z2D3T5 (Glutamate [NMDA] receptor subunit 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_004854 PE=3 SV=1)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 392/653 (60.03%), Postives = 479/653 (73.35%), Query Frame = 2
Query: 1055 WQDYL*DCPPRSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVH---------GSPNHV-----SLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGR-------------------------------------FKLAKSSSTE-EDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKR 2857
            W+DY      R M+ + + DGRTG ++F++ GDR+ P+YDIVN            +P  +     +LV VG+YG  +  P +W S EP   LL+++  K++WPGN  +KR++ VC++R N   C K     V +AP SF KKT LKVVT  S+PFV  RP K  +KC  S++P   K E+ CTHTDP+T +  HYCC GYCIDLLR +ANRTG+E   TPFTYDLHLVGDG++G + +EN+T +WTG++GE+LS  ADLAVAP++ITPERAARVEFTKPFKYLG+TILVKRE+++SNL SFLQPFE++LWVLVALSVHVVA VLYLLDRFSPFG+                                      +  K  S + E+ +NLS+A++FAW VLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDD RLRNPQKDF FAT++ SPVE YFKRQVE+ATMYR ME+ N +S EEAI  +K G LKAFIWDSAR+++E S  C+LITAGEVFGRN YGL MKK+NPWLYE+SQAVLNFHERG ME+LDT WI +K+  C+RTESSPATLGLTNMAGVFIM+  G+VAG  L  +E+   KR+G ++K+LEL+  AV  WR NI+KR
Sbjct:   90 WKDYAIKLF-RQMLAMNLTDGRTGHLEFNEYGDRIKPIYDIVNAQIINQDMNGLSTPKSIEFERPTLVSVGSYGVPQPTPIEWLSDEPHPPLLSINSSKLVWPGNSIVKRQQLVCIQRANDGKCQKTEKRLVHAAPISFKKKTHLKVVTIESVPFVHTRP-KLNDKCKESDDPSVFKAEIECTHTDPVTGVKKHYCCYGYCIDLLRLMANRTGLELTSTPFTYDLHLVGDGQIG-DIDENETHKWTGIIGEILSSTADLAVAPVSITPERAARVEFTKPFKYLGITILVKRERARSNLGSFLQPFESSLWVLVALSVHVVAFVLYLLDRFSPFGQTTSDLDLSTNGSGSYSNLRQLDSENQTSDKSGQSITHLQQHKEQSQDGEEGMNLSTAVYFAWAVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDVRLRNPQKDFLFATIRGSPVEMYFKRQVEFATMYRVMETNNYDSVEEAIQAIKSGSLKAFIWDSARLNYEVSIDCELITAGEVFGRNSYGLVMKKNNPWLYELSQAVLNFHERGIMETLDTKWIHIKSNNCERTESSPATLGLTNMAGVFIMIGMGLVAGAILTLVEVLCAKRKGERKKKLELSSVAVQHWRDNIQKR 739          

HSP 2 Score: 73.559 bits (179), Expect = 2.406e-9
Identity = 38/102 (37.25%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  780 MLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQS-YSWLEVGKTIYKIVL 1082
            ML  EWAWIVTEQ L    +P G+IG++L   SE  H+ DAV + TQ I     +D   M  + +   CS NP ++++K    G+S Y W +    +++ +L
Sbjct:    1 MLEAEWAWIVTEQALDASNIPNGVIGVRLLQVSEVDHVADAVRIATQSILHLVRSDYDAMKHLHSVKACSDNPSEIQSKSKLLGRSTYLWKDYAIKLFRQML 102          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Cavefish
Match: grin1b (glutamate receptor, ionotropic, N-methyl D-aspartate 1b [Source:ZFIN;Acc:ZDB-GENE-051202-2])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 313/599 (52.25%), Postives = 396/599 (66.11%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKC--DTSNNPLNLKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F+D GDR    Y I+N   +     LV+VG Y   +              ++N    KIIWPG +T K                          P+ +   T LK+VT    PFV  +P  +   C  + + N + +KK V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+ G L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  319 RVLMSSKYPDGLTGRVEFNDDGDRRFAHYSILNYQKT----RLVQVGVYNGSQV-------------VMNTQR-KIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLRDGTCKEEYTVNGVLIKK-VICTGPNETIPGRPIVPQ-CCYGFCIDLLIKLAMTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDGKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 861          

HSP 2 Score: 183.341 bits (464), Expect = 0.000e+0
Identity = 113/296 (38.18%), Postives = 166/296 (56.08%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +++REFRW  I L+ SDD EG+    RLE   ++ +  +  + + F  D      +N T LL+  +  + R I+L A ++ A  I KAA+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVSQANNIYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDMMREFRWNHIILIVSDDHEGRAAQKRLETLLEE-RETKAEKVLLFSQD------TNLTALLQEAKDLEARVIILSASEDEAAAIYKAARQLNMTGSGYVWLVGEREMSGKALSEAPDGLLGLQLINGKNESAHIYDAVAVVAQSIQELFEKENIT----EPPRGCVGN 307          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Cavefish
Match: grin1b (glutamate receptor, ionotropic, N-methyl D-aspartate 1b [Source:ZFIN;Acc:ZDB-GENE-051202-2])

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 313/599 (52.25%), Postives = 396/599 (66.11%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKC--DTSNNPLNLKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  DG TG+++F+D GDR    Y I+N   +     LV+VG Y   +              ++N    KIIWPG +T K                          P+ +   T LK+VT    PFV  +P  +   C  + + N + +KK V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+ G L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK
Sbjct:  340 RVLMSSKYPDGLTGRVEFNDDGDRRFAHYSILNYQKT----RLVQVGVYNGSQV-------------VMNTQR-KIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLRDGTCKEEYTVNGVLIKK-VICTGPNETIPGRPIVPQ-CCYGFCIDLLIKLAMTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDGKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK 882          

HSP 2 Score: 180.259 bits (456), Expect = 0.000e+0
Identity = 116/317 (36.59%), Postives = 169/317 (53.31%), Query Frame = 3
Query:  123 TIGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
             IGA+LS +     FK +V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +++REFRW  I L+ SDD EG+    RL     ERE+               D+ +  +  + + F  D      +N T LL+  +  + R I+L A ++ A  I KAA+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   25 NIGAVLSQKRYEQVFKDAVSQANNIYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDMMREFRWNHIILIVSDDHEGRAAQKRLETLLEERETKSKNRNYENLDQLSYDNKRGPKAEKVLLFSQD------TNLTALLQEAKDLEARVIILSASEDEAAAIYKAARQLNMTGSGYVWLVGEREMSGKALSEAPDGLLGLQLINGKNESAHIYDAVAVVAQSIQELFEKENIT----EPPRGCVGN 328          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Cavefish
Match: grin1a (glutamate receptor, ionotropic, N-methyl D-aspartate 1a [Source:ZFIN;Acc:ZDB-GENE-051202-1])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 312/599 (52.09%), Postives = 393/599 (65.61%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLN-LKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRK 2860
            R ++  K  +G TG+++F+D GDR    Y I+N   S     L++VG Y GT+               +LN    KIIWPG +T +                          P+ F   T LK+VT    PFV  +P  +   C     P   L K+V CT    T P   IV   CC G+C+DLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GI AG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++  K
Sbjct:  319 RVLMSSKYPEGLTGRVEFNDDGDRKYAHYSILNYQKS----RLIQVGIYNGTQ--------------VVLN-KQRKIIWPGGETER--------------------------PRGFQMSTRLKIVTIHQEPFVYVKPTMQDGTCREEYTPNGVLIKKVICTGPNETIPGRPIVPQ-CCYGFCVDLLIKLAMTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIAAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDNK 861          

HSP 2 Score: 177.563 bits (449), Expect = 0.000e+0
Identity = 111/296 (37.50%), Postives = 164/296 (55.41%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN  +     K    +      A+  A  VC+ LIS+   ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW +++REFRW  I L+ SDD EG+    RLE   ++ +  +  + + F      + ++N T LL   +  + R I+L A +E A  + K A+ L M G  + W+V E+ +    L   P GLIGLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVAQANVVYGRDKFKLTAISVTHKANAIQMALSVCEDLISS---QVYAILVSHPPQSSDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAHVWFDMMREFRWNHIILIVSDDHEGRAAQKRLETLLEE-RETKAEKVLQF------NQETNLTALLLEAKELEARVIILSASEEDAAAVYKTARFLNMTGSGYVWLVGEREMSGKALSEAPDGLIGLQLINGKNESAHISDAVAVVAQSIQELFEKENIT----EPPRGCVGN 307          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Cavefish
Match: grin1a (glutamate receptor, ionotropic, N-methyl D-aspartate 1a [Source:ZFIN;Acc:ZDB-GENE-051202-1])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 317/615 (51.54%), Postives = 400/615 (65.04%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLN-LKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKIL-----RKTLSAESD 2893
            R ++  K  +G TG+++F+D GDR    Y I+N   S     L++VG Y GT+               +LN    KIIWPG +T +                          P+ F   T LK+VT    PFV  +P  +   C     P   L K+V CT    T P   IV   CC G+C+DLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELLSG AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GI AG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++    +     RK+  AESD
Sbjct:  340 RVLMSSKYPEGLTGRVEFNDDGDRKYAHYSILNYQKS----RLIQVGIYNGTQ--------------VVLN-KQRKIIWPGGETER--------------------------PRGFQMSTRLKIVTIHQEPFVYVKPTMQDGTCREEYTPNGVLIKKVICTGPNETIPGRPIVPQ-CCYGFCVDLLIKLAMTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIAAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQPSSSVETQDDRKSGRAESD 898          

HSP 2 Score: 174.096 bits (440), Expect = 0.000e+0
Identity = 114/316 (36.08%), Postives = 167/316 (52.85%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN  +     K    +      A+  A  VC+ LIS+   ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW +++REFRW  I L+ SDD EG+    RL     ERE+               D+ +  +  + + F      + ++N T LL   +  + R I+L A +E A  + K A+ L M G  + W+V E+ +    L   P GLIGLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVAQANVVYGRDKFKLTAISVTHKANAIQMALSVCEDLISS---QVYAILVSHPPQSSDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAHVWFDMMREFRWNHIILIVSDDHEGRAAQKRLETLLEERETKNKKRNYENLDQLSYDNKRGPKAEKVLQF------NQETNLTALLLEAKELEARVIILSASEEDAAAVYKTARFLNMTGSGYVWLVGEREMSGKALSEAPDGLIGLQLINGKNESAHISDAVAVVAQSIQELFEKENIT----EPPRGCVGN 328          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Cavefish
Match: grin1b (glutamate receptor, ionotropic, N-methyl D-aspartate 1b [Source:ZFIN;Acc:ZDB-GENE-051202-2])

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 312/598 (52.17%), Postives = 395/598 (66.05%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKC--DTSNNPLNLKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKR 2857
            R ++  K  DG TG+++F+D GDR    Y I+N   +     LV+VG Y   +              ++N    KIIWPG +T K                          P+ +   T LK+VT    PFV  +P  +   C  + + N + +KK V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+ G L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ R
Sbjct:  323 RVLMSSKYPDGLTGRVEFNDDGDRRFAHYSILNYQKT----RLVQVGVYNGSQV-------------VMNTQR-KIIWPGGETEK--------------------------PRGYQMSTRLKIVTIHQEPFVYVKPTLRDGTCKEEYTVNGVLIKK-VICTGPNETIPGRPIVPQ-CCYGFCIDLLIKLAMTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDGKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQVR 864          

HSP 2 Score: 183.341 bits (464), Expect = 0.000e+0
Identity = 113/296 (38.18%), Postives = 166/296 (56.08%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +++REFRW  I L+ SDD EG+    RLE   ++ +  +  + + F  D      +N T LL+  +  + R I+L A ++ A  I KAA+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   30 IGAVLSQKRYEQVFKDAVSQANNIYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDMMREFRWNHIILIVSDDHEGRAAQKRLETLLEE-RETKAEKVLLFSQD------TNLTALLQEAKDLEARVIILSASEDEAAAIYKAARQLNMTGSGYVWLVGEREMSGKALSEAPDGLLGLQLINGKNESAHIYDAVAVVAQSIQELFEKENIT----EPPRGCVGN 311          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.616 bits (540), Expect = 1.821e-57
Identity = 131/407 (32.19%), Postives = 227/407 (55.77%), Query Frame = 2
Query: 1565 TDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFE-NTXXXXXXXXXXXXXXXXXXXDRFSPFG-RFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKD---FKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRT--CDLIT--AGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIM--VAAGIVAGVFL 2752
            T+P +      CCKG+CID+L++L+           FTYDL+LV +G+ G++ N      W GM+GE+++  A +AV  +TI  ER+  V+F+ PF   G++++V R     + ++FL+PF  +   ++  L + V  + +++ + FSP G   +L+        A  +  ++W  W ++ N+ +    PR  +++ +  VWA FA+I +ASYTANLAAF++ +     +SG+ D + ++P +    F+F TV +   E+  +    Y  M+  M  ++  S E+A+  +K G L AFI+D+A +++ A +   C L+T  +G+VF   GYG+A++K + W   +  A+L F   G M+ L+  W+     G +R +   + L + NMAGVF M  VA G+   VF+
Sbjct:  384 TNPSSSPYVKKCCKGFCIDILKKLSKTV-------KFTYDLYLVTNGKHGSKIN----GVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGKEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLEHSPPFRFGTVPNGSTERNIRNN--YLQMHGYMSKFHQKSVEDALMSLKAGKLDAFIYDAAVLNYMAGKDEGCRLVTIGSGKVFVATGYGIALQKSSRWKRAIDLALLQFIGDGEMDELEMIWLTGICHG-ERNDVMSSQLDIDNMAGVFYMLLVAMGLSFIVFV 776          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 181.8 bits (460), Expect = 6.261e-49
Identity = 135/435 (31.03%), Postives = 220/435 (50.57%), Query Frame = 2
Query: 1604 KGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQ-SKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEE------------------------------DALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQV--EYATMYRTMESYN----VNSAEEAIDQVKKGDLK-AFIWDSARISF-EASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAE---GCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKR 2782
            +GYC+DL + +A    I E F    Y   +V DG  GA     DTK W GMVGEL+ G AD+A+AP+TI+  R   ++F+KPF  LG++I++K+ Q SK  + SFL P    +W+ +  +   V++VL+L+ RFSP+  ++    +  E                               +   + +++WF+ G  +  G  E +PRS S R++G VW  F +II++SYTANLAAFL ++R  + I   DD      Q +  + T+ S   +++F+R     Y  M+  M+       V +  + + +V+K   K A++ +S    + E  + CD +  G      GYG+A  K +     ++ AVL  +E+G ++ L   W   K E   G   ++   + L L+N+AGVF ++  G+   + +  IE  YK R
Sbjct:   60 EGYCVDLGQEIA----IHEQFE---YKWSVVPDGAYGARNP--DTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPY-EWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGC-EISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLA---KQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR 480          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.992 bits (393), Expect = 4.997e-42
Identity = 105/329 (31.91%), Postives = 175/329 (53.19%), Query Frame = 2
Query: 1778 EADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQ-SKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFK---LAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQ--VEYATMYRTMESYN---VNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPAT-LGLTNMAGVFIMVAAGI 2734
            +ADLAVAP+TI   R   ++F+KPF  LG++IL ++   +   + SFL P    +W+ + L+   V+ VL+++ RFSP+  +        S   E+   + ++ WF  G L+  G  E  P++ S R++G +W  F +II++SYTANLAAFL ++R E+ IS  DD      Q   ++  V+      +FK+     Y  M+  M S     + + EE I +V   D  A + +S  I +   R C+L   G +    GYG+     +P+  +++ A+L   E G +  +   W   +  GC   +S+ A+ LG+ N+ G+FI++AAG+
Sbjct:    9 KADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQG-SELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLA---KQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTDY-AMLMESTNIEYVTQRNCNLTQIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWW--RGNGCPEEDSNEASALGVQNIGGIFIVLAAGL 330          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 3.494e-20
Identity = 56/175 (32.00%), Postives = 86/175 (49.14%), Query Frame = 2
Query: 2036 SSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFK--RQVEYATMYRTMESYN----VNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAM 2542
            S   E+   + +++WF  G L+  G  E  PR+ S R++G +W  F +I+++SYTANLAAFL ++R E+ I   DD      Q   ++  V+      +FK  R   Y  M+  M S +    V + EE I +    D  A + +S  I     R C+L   G +    GYG+ M
Sbjct:   16 SDVLENNFTMLNSLWFGVGALMQQG-SELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLA---KQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRHQTALVKNNEEGIHRALTTDF-AMLMESTTIEHVTQRYCNLTQIGGLIDSKGYGVGM 185          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 7.740e-20
Identity = 70/215 (32.56%), Postives = 119/215 (55.35%), Query Frame = 2
Query: 1604 KGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASI 2248
            +G+ +D++  L+   G       F+Y++ +  D   G  + +     W+GM+GELL+  AD+A++ +TITPER + V+FTK +    + +  +R    + L + L P E   W  + L+V +V L++YLL+R +P  R +   S S       L +++W  +G  +  G  E +  S SAR++  VW  FA I+V+SYTA+L A L ++R +  I
Sbjct:   21 QGFSVDVMDALSKSLG-------FSYEIFMPADLSYGLPQADGT---WSGMIGELLNKRADVAISALTITPERESVVDFTKRYMDYSVGVAARRPADSAGLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTP--RREPRHSPS-------LPASLWLVYGSFMQQG-PELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLTINRMDPPI 215          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 486.108 bits (1250), Expect = 5.755e-156
Identity = 302/589 (51.27%), Postives = 375/589 (63.67%), Query Frame = 2
Query: 1088 SMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNI 2848
            +++ V +  G TG I F+  GDR   VY ++N   S +    V VG Y        +                 IIWPGN                          + + P        L+VVT    PFV  +PI    +C  S+   N  K V CT T   T         G+C+DLL RL  +         FTY + L  DG  G+ +  N +DTK+W GMVGE++ G+ADL VA +TI  ERA  +EF+KPFKY GLTILVK+ +  ++L SFL+PF+  LW+LV LSVH+VA++LYLLDRFSPFGRFKLA+    EE ALNLSSAMWF+WGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRP+A +SGIDD  LRNP K F +ATV +S V+ YF+RQVE ++MY  ME YNV +A+E I++VK G+LKAFIWDS  + +EAS+ C L TAGE+FGR+GYG+ M K +PW   +S A+LNFHE G ME L+T WI   A  C+   +SPATLGL +M GVFIMVAAGI AG+ +I +EI Y K RG KE++ ELAK   D+WR NI
Sbjct:  320 ALVNVSLPRGTTGPIAFNSDGDRKNAVYRLMNRRQSSSDAVDV-VGLYENGHVSINE----------------SIIWPGN--------------------------LNTTPTGVFLSNHLRVVTLVGEPFVYVKPIPTSGRC--SDLDTNTAKHVLCTGTVSDTD-------SGFCMDLLIRLGEKVN-------FTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEK-EETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVELSSMYTFMEGYNVKTAKEGIEKVKNGELKAFIWDSPVLYYEASKDCTLTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEELETTWI--DASKCNTENTSPATLGLQHMLGVFIMVAAGIGAGIVIIILEILYHKHRGWKEEQKELAKKTTDKWRANI 846          

HSP 2 Score: 183.341 bits (464), Expect = 2.164e-47
Identity = 102/288 (35.42%), Postives = 172/288 (59.72%), Query Frame = 3
Query:   63 LFVSRYFNNFNIVNARTIKYTIGALLSNESMIDEFKQSVDEANKKFEDM-DIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKM---PKLPQGLIGLQLAHA-SESAHIKDAVSV 911
            LF+   F+ +++ +A+T  + IGA+LS+   I  F+++++  N   E    +K    + ++++  + +A  VC+ + A  +++  +IVSHP    D PP+S S+ C FY IPV+GISAR+S FSDK  H SFLRT+PPYS++A VW  L++ F W ++ L+ S+DQ+ + +++R    ++ +   +I +TV FP+  +     N T  L+ ++  Q+R I+  A  + A  +   A  L+M G+ + WIVT+Q L       LPQG IG++L H  SE + +KDA  +
Sbjct:    7 LFLLLAFSTYSVDSAKT--FNIGAMLSSTDAIGAFQEAIEAVNVNNETFPGVKLNASSFILSQNPIRSALDVCEQLVA--KQVHIVIVSHPNGTTD-PPISVSYACGFYRIPVIGISARESIFSDKTIHESFLRTIPPYSDQADVWLRLLKYFEWNKVILLTSNDQDSRAIITRFSTLAEKSD-IKIEKTVMFPSGSE-----NVTSYLQQLQKTQSRVILFSASPQDASVVYYNATSLKMTGEGYIWIVTQQALSGVARENLPQGAIGIELLHGNSEISQLKDATVI 283          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 206.838 bits (525), Expect = 3.676e-55
Identity = 159/475 (33.47%), Postives = 247/475 (52.00%), Query Frame = 2
Query: 1406 VPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKS-NLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRF---------KLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARV-LGMVWAGFAMIIVAS-YTANLAAFLVLDRPEASISGIDD-ARLRNPQKDFKFATVKSSPVEQYFKRQV--EYATMYRTMESYN--VNSAEEAIDQVKKGDLKAFIWDSARISFEASR--TC-DLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLT--NMAGVFIMVAAGIVAGVFLIFIE 2764
            VP+     ++   LKVVT    PF+ A+    G+                           T    +GYCI+LLR+L+           F ++++LV D   GA+  +  TK W G+V E+L+G ADLAV  +TI+PER   ++FT+P+  LGLT+L+K + ++  N  + L+PF   LW+ +  ++ +V   L+L   FSPFG +         K+        D L+L  A+W      +        P S S R+ + + W  FAM+IV S YTANLAAFL + R  + IS +DD AR    QKD  + TV +S  + +F+      + TM++ M  ++  VN++ E I++V   +  AFIWDSA + F A    +C  LIT+G VFGR GYG  + KD+P+  ++S A+L     G+ME LD  W+    +  +  E + +   LT  +++GVFI++ AGI     ++ +E
Sbjct:  433 VPTDSTHILENRTLKVVTIAEAPFIFAQTQTNGQG-------------------------ETRVIIEGYCIELLRKLSE-------MLRFKFEVYLVPDNNFGAQ--DPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYW--FAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLAR----QKDISYGTVLNSQPQAFFESASVPSFVTMWQYMRYHHTFVNNSAEGIEKVMNENY-AFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAEAAEKAKSENQLTFEDLSGVFIVLIAGIGVSCVVLVLE 866          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Nematostella
Match: EDO34363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ5])

HSP 1 Score: 181.415 bits (459), Expect = 5.707e-50
Identity = 120/397 (30.23%), Postives = 215/397 (54.16%), Query Frame = 2
Query: 1598 CCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLAS--FLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPF--GRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFK--RQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARIS--FEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIE 2764
            C  G  I+LL  +         +  FTY+ +L+ D + G+   +  T  W GMVG++++GEAD+A+A +TIT  R+  ++F+ P+  +G+ IL + + +  ++ +  F+ P  + LW ++  ++  V +VL++L  +  +  GR             ++L  +M ++W   ++   G G P S SAR++ + +A   +I+  SYTA LAAF V ++    ISGI+D +++NP  DFKFAT++ S  E YF+  +  +   +Y  M+  NV   E+ + ++  G+ K +I D   +     +S  C L   G  FG +GYG+A+ K++PW   +S A++  ++   +E+L + W+  K    D    SP+ L + N+ G+F++V AG       + IE
Sbjct:    1 CISGQMIELLELI-------REYVHFTYEFYLIRDHKYGSV--DPVTGLWNGMVGDIITGEADMALATLTITASRSRVIDFSSPYGEVGIGILARTDTTLGSVVNMDFMIPLSSQLWTVILATILFVIIVLWVLGDWEWYLKGRSHFIPDYKRR---VSLLESMTYSWSTFVHVQAGTGLPMSTSARLVALFFALAMLIVNTSYTAELAAFKVKEQFVPPISGIEDPKMQNPPPDFKFATLRDSSTEAYFRFSKDEKLRRIYEHMKDNNVEMVEDGVAKLISGEFKLYIDDQPYLEHLVSSSGNCMLRMIGRPFGISGYGIALAKNSPWTRPISNAIIKLNDMKALENLWSKWLKRKCVTQDEFGKSPSGLSIENVNGLFVVVCAGFAMCALFLGIE 385          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Nematostella
Match: EDO44842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE9])

HSP 1 Score: 174.481 bits (441), Expect = 4.688e-48
Identity = 113/351 (32.19%), Postives = 195/351 (55.56%), Query Frame = 2
Query: 1598 CCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKD-FKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGD---LKAFIWDSARIS-FEASRT-CDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNW 2632
            CC G CIDL++ L+   G    F P    +  +  G  G+ KN     +WTG++GE+++G AD+A++ ++IT +R+  V+F++PF + G TILV +         FL+PF+ + W+L+   +++VA+V+ L +  +P  + +  ++   E D   +  ++W  +    +  +    PR  S+RV+   W+   ++I A YTANLAAF+VL      I GI+D+R++NP     KF T++ + VE+YFK  + +  +Y  M +Y  N + E +  VK+G    + AFIW+SA +  + A+ T C L+T G++F  +G+  A  K +PW   +S  +L + +      L   W
Sbjct:    2 CCYGLCIDLIKLLSRDIG----FIPV---IETIQGGRAGSFKN----GKWTGLIGEVVAGNADMAMSSISITSQRSKFVDFSEPFIHTGSTILVAKRHGSFKGDGFLKPFKVSAWLLIFAVLYLVAVVVLLFESHNPGLQRQKHRNYRGEFD---IHQSVWLMFSRFFSGILNAPIPRFVSSRVVLSSWSFATLMIDALYTANLAAFMVLQDQAHYIDGINDSRIQNPLASVLKFTTIRDTSVEKYFK--INFPHVYSFMRNYRFNHSSEGVRAVKEGYVIVIDAFIWESATMERYVANDTRCSLLTVGKLFDTSGFAAAFPKGSPWTRNISDFILKYQQTDVQGELRDKW 336          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 155.992 bits (393), Expect = 4.975e-41
Identity = 122/402 (30.35%), Postives = 214/402 (53.23%), Query Frame = 2
Query: 1604 KGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKS-NLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFG-RFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRP-EASISGIDDARLRNPQKDFKFATVKSSPVEQYF-KRQVE-YATMYRTMESYNVNSAEEAIDQVKKGDLK------AFIWDSARISFEASRT-CDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGC---DRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIE 2764
            +G+  DL+  L+ +         F Y++ +  +   G++       +W G++GEL+  EAD+A+ P+TIT ER   ++F+KPF    + +++++   +  NL +FL PF+  LW+     V +V+L+++ LDRFSP G + +  KS   E D  +LS+++WFA   +L  G G+ TPRS S RVL   +  F +I++++YTANLAA+   +R   + I+ ++D      Q   K+   +   +  +F + +V+ YATM++ M+     S E  ++  + G LK      A++ D   + +   R  C+ +    +     Y LAM++++ W   +S A+L   E G +E     W    +E C     T+SSP  L L ++AGVFI++  G    + L+ +E
Sbjct:   28 RGFSKDLMELLSRKLN-------FRYEICISKESSYGSKVE----GQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQG-GDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLV---SQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMK-----SQETFVNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWDDSSE-CPTGPSTDSSPQRLELHSLAGVFIILGGGATISLVLLLVE 408          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Medaka
Match: ENSORLT00000044529.1 (glutamate receptor ionotropic, NMDA 1 [Source:NCBI gene;Acc:101175170])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 317/612 (51.80%), Postives = 399/612 (65.20%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKC--DTSNNPLNLKKEVPCTH---TDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESDF 2896
            R ++  K  DG TG+I+F+D GDR    Y I+N    P  V  V+VG + GT               +++     KIIWPG +T K                          P  +   T LK+VT    PFV  +P K    C  + + N + +KK V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK  R     ++ F
Sbjct:  322 RVLMSSKYPDGLTGRIEFNDDGDRRFATYSILNYQQKPGRV--VQVGIFNGT---------------QVVMNPQRKIIWPGGETEK--------------------------PVGYQMSTKLKIVTIHQEPFVYVKPTKSDGTCKEEYTVNGVLIKK-VICTGPNGTTPGQPIVPQ-CCYGFCIDLLIKLAMSMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPEPKTSF 878          

HSP 2 Score: 181.415 bits (459), Expect = 0.000e+0
Identity = 111/296 (37.50%), Postives = 166/296 (56.08%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            +GA+LS +     FK++V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +L+REFRW  I L+ SDD EG+    +LE   ++ +  +  + + F  D      +N T LL   R  + R I+L A ++ A  + KAA+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q +   +  + +T    + P  C  N
Sbjct:   29 VGAVLSQKRYEQVFKEAVSQANALYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDLMREFRWNHIILIVSDDHEGRAAQKKLETLLEE-RETKAEKVLLFNQD------TNLTALLLEARDLEARVIILSASEDEAAAVYKAARQLNMTGSGYVWLVGEREMNGKALNEAPDGLLGLQLINGKNESAHIADAVAVVAQSLQELFEKENIT----EPPRGCVGN 310          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Medaka
Match: ENSORLT00000032602.1 (glutamate receptor ionotropic, NMDA 1 [Source:NCBI gene;Acc:101175170])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 317/612 (51.80%), Postives = 399/612 (65.20%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKC--DTSNNPLNLKKEVPCTH---TDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESDF 2896
            R ++  K  DG TG+I+F+D GDR    Y I+N    P  V  V+VG + GT               +++     KIIWPG +T K                          P  +   T LK+VT    PFV  +P K    C  + + N + +KK V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ RK  R     ++ F
Sbjct:  343 RVLMSSKYPDGLTGRIEFNDDGDRRFATYSILNYQQKPGRV--VQVGIFNGT---------------QVVMNPQRKIIWPGGETEK--------------------------PVGYQMSTKLKIVTIHQEPFVYVKPTKSDGTCKEEYTVNGVLIKK-VICTGPNGTTPGQPIVPQ-CCYGFCIDLLIKLAMSMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPEPKTSF 899          

HSP 2 Score: 180.644 bits (457), Expect = 0.000e+0
Identity = 114/310 (36.77%), Postives = 167/310 (53.87%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLER--------------ESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            +GA+LS +     FK++V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +L+REFRW  I L+ SDD EG+    +LE               E+ D ++F   RT         +  +N T LL   R  + R I+L A ++ A  + KAA+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q +   +  + +T    + P  C  N
Sbjct:   29 VGAVLSQKRYEQVFKEAVSQANALYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDLMREFRWNHIILIVSDDHEGRAAQKKLETLLEERETKTKNRNYENLDQQNFDFRRTPKAEKVLLFNQDTNLTALLLEARDLEARVIILSASEDEAAAVYKAARQLNMTGSGYVWLVGEREMNGKALNEAPDGLLGLQLINGKNESAHIADAVAVVAQSLQELFEKENIT----EPPRGCVGN 331          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Medaka
Match: ENSORLT00000020602.2 (glutamate receptor ionotropic, NMDA 1 [Source:NCBI gene;Acc:101175170])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 314/599 (52.42%), Postives = 394/599 (65.78%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKC--DTSNNPLNLKKEVPCTH---TDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKR 2857
            R ++  K  DG TG+I+F+D GDR    Y I+N    P  V  V+VG + GT               +++     KIIWPG +T K                          P  +   T LK+VT    PFV  +P K    C  + + N + +KK V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++ R
Sbjct:  325 RVLMSSKYPDGLTGRIEFNDDGDRRFATYSILNYQQKPGRV--VQVGIFNGT---------------QVVMNPQRKIIWPGGETEK--------------------------PVGYQMSTKLKIVTIHQEPFVYVKPTKSDGTCKEEYTVNGVLIKK-VICTGPNGTTPGQPIVPQ-CCYGFCIDLLIKLAMSMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQVR 868          

HSP 2 Score: 181.415 bits (459), Expect = 0.000e+0
Identity = 111/296 (37.50%), Postives = 166/296 (56.08%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            +GA+LS +     FK++V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +L+REFRW  I L+ SDD EG+    +LE   ++ +  +  + + F  D      +N T LL   R  + R I+L A ++ A  + KAA+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q +   +  + +T    + P  C  N
Sbjct:   32 VGAVLSQKRYEQVFKEAVSQANALYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDLMREFRWNHIILIVSDDHEGRAAQKKLETLLEE-RETKAEKVLLFNQD------TNLTALLLEARDLEARVIILSASEDEAAAVYKAARQLNMTGSGYVWLVGEREMNGKALNEAPDGLLGLQLINGKNESAHIADAVAVVAQSLQELFEKENIT----EPPRGCVGN 313          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Medaka
Match: ENSORLT00000020603.2 (glutamate receptor ionotropic, NMDA 1 [Source:NCBI gene;Acc:101175170])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 313/597 (52.43%), Postives = 393/597 (65.83%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKC--DTSNNPLNLKKEVPCTH---TDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIE 2851
            R ++  K  DG TG+I+F+D GDR    Y I+N    P  V  V+VG + GT               +++     KIIWPG +T K                          P  +   T LK+VT    PFV  +P K    C  + + N + +KK V CT    T P   IV   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GIVAG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N++
Sbjct:  343 RVLMSSKYPDGLTGRIEFNDDGDRRFATYSILNYQQKPGRV--VQVGIFNGT---------------QVVMNPQRKIIWPGGETEK--------------------------PVGYQMSTKLKIVTIHQEPFVYVKPTKSDGTCKEEYTVNGVLIKK-VICTGPNGTTPGQPIVPQ-CCYGFCIDLLIKLAMSMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQ 884          

HSP 2 Score: 181.03 bits (458), Expect = 0.000e+0
Identity = 114/310 (36.77%), Postives = 167/310 (53.87%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLER--------------ESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            +GA+LS +     FK++V +AN  +     K    +      A+  A  VC+ LIS    ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A+VW +L+REFRW  I L+ SDD EG+    +LE               E+ D ++F   RT         +  +N T LL   R  + R I+L A ++ A  + KAA+QL M G  + W+V E+ +    L   P GL+GLQL +  +ESAHI DAV+VV Q +   +  + +T    + P  C  N
Sbjct:   29 VGAVLSQKRYEQVFKEAVSQANALYGKDKFKMNAISVTHKPNAIQMALSVCEDLIS---NQVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAQVWFDLMREFRWNHIILIVSDDHEGRAAQKKLETLLEERETKTKNRNYENLDQQNFDFRRTPKAEKVLLFNQDTNLTALLLEARDLEARVIILSASEDEAAAVYKAARQLNMTGSGYVWLVGEREMNGKALNEAPDGLLGLQLINGKNESAHIADAVAVVAQSLQELFEKENIT----EPPRGCVGN 331          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Medaka
Match: grin1a (glutamate receptor ionotropic, NMDA 1 [Source:NCBI gene;Acc:101169874])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 311/598 (52.01%), Postives = 392/598 (65.55%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTY-GTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLN--LKKEVPCT---HTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEK--NENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEK 2854
            R ++  K  +G TG+++F+D GDR    Y I+N   S     LV+VG Y GT               +++  +  KIIWPG +T K                          P+ F   T LK+VT    PFV  +P      C      LN  L K+V CT    T P   I+   CC G+CIDLL +LA           FTY++HLV DG+ G ++  N ++ K W GM+GELL G AD+ VAP+TI  ERA  +EF+KPFKY GLTILVK+E  +S L SF+QPF++TLW+LV LSVHVVA++LYLLDRFSPFGRFK+  S   EEDAL LSSAMWF+WGVLLNSGIGEG PRSFSAR+LGMVWAGFAMIIVASYTANLAAFLVLDRPE  I+GI+D RLRNP   F +ATVK S V+ YF+RQVE +TMYR ME +N  SA EAI  V+   L AFIWDSA + FEAS+ CDL+T GE+F R+G+G+ M+KD+PW   +S A+L+ HE GFME LD  W  V+ + CD   ++PATL   NMAGVF++VA GI AG+FLIFIEIAYK+ +  + K+++LA  AV+ WR N+++
Sbjct:  340 RVLMSSKYPEGLTGRVEFNDDGDRKYAHYSILNYQKS----RLVQVGIYNGT---------------QVVMNNQRKIIWPGGETEK--------------------------PQGFQMSTRLKIVTIHQEPFVYVKPTMLDGTCKEELT-LNGVLIKKVICTGPNETIPGRPIIPQ-CCYGFCIDLLIKLAMTMN-------FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLGGLADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKV-NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLAILSSHENGFMEDLDKTW--VRYQECDSRSNAPATLTFENMAGVFMLVAGGIAAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQQ 880          

HSP 2 Score: 175.637 bits (444), Expect = 0.000e+0
Identity = 115/316 (36.39%), Postives = 167/316 (52.85%), Query Frame = 3
Query:  126 IGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCK-LISATDQRMFSLIVSHPPYNPD-TPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRL-----ERES---------------DDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKL---PQGLIGLQLAHA-SESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVN 995
            IGA+LS +     FK +V +AN+ +     K    +      A+  A  VC+ LIS+   ++++++VSHPP + D   P   S+T  FY IPV+G++ R S +SDK  H SFLRTVPPYS +A VW +L+REF W  I L+ SDD EG+    RL     ERE+               D+ +  +  + + F  +      +N T LL   +  + R I+L A +E A  + KAA+ L M G  + W+V E+ +    L   P GLIGLQL +  +ESAHI DAV+VV Q I   +  + +T    + P  C  N
Sbjct:   26 IGAVLSQKRYEQVFKDAVTQANQVYGRDKFKLTAISVTHKPNAIQMALSVCEDLISS---QVYAILVSHPPQSNDHLTPTPVSYTAGFYRIPVVGLTTRMSIYSDKSIHLSFLRTVPPYSHQAHVWFDLMREFNWNHIILIVSDDHEGRAAQKRLETLLEERETKNKKRNYENLDQLSYDNKRGPKAEKVLQFSQE------TNLTALLLEAKELEARVIILSASEEDAAAVYKAARFLNMTGSGYVWLVGEREMSGKALTEAPDGLIGLQLINGKNESAHINDAVAVVAQSIQELFEKENIT----EPPRGCVGN 328          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Planmine SMEST
Match: SMESG000001343.1 (SMESG000001343.1)

HSP 1 Score: 1290.4 bits (3338), Expect = 0.000e+0
Identity = 653/654 (99.85%), Postives = 654/654 (100.00%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESDFHRYFNSLKGVDIVGDSSGATGSLLATQNSNNISMSGHKDTRIFFDNEIQV 3046
            +SMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYLLDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIEKRKILRKTLSAESDFHRYFNSLKGVDIVGDSSGATGSLLATQNSNNISMSGHKDTRIFFDNEIQV
Sbjct:  307 KSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYLLDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIEKRKILRKTLSAESDFHRYFNSLKGVDIVGDSSGATGSLLATQNSNNISMSGHKDTRIFFDNEIQV 960          

HSP 2 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 3
Query:  153 MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK 1073
            MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK
Sbjct:    1 MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK 307          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Planmine SMEST
Match: SMESG000010110.1 (SMESG000010110.1)

HSP 1 Score: 1224.92 bits (3168), Expect = 0.000e+0
Identity = 621/622 (99.84%), Postives = 622/622 (100.00%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIEKRKILRKTLSAESDFHRYFNSLKGVDIVGDSSG 2950
            +SMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYLLDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIEKRKILRKTLSAESDFHRYFNSLKGVDIVGDSSG
Sbjct:  307 KSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYLLDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIEKRKILRKTLSAESDFHRYFNSLKGVDIVGDSSG 928          

HSP 2 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 3
Query:  153 MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK 1073
            MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK
Sbjct:    1 MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK 307          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Planmine SMEST
Match: SMESG000010110.1 (SMESG000010110.1)

HSP 1 Score: 1159.44 bits (2998), Expect = 0.000e+0
Identity = 588/589 (99.83%), Postives = 589/589 (100.00%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIE 2851
            +SMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYLLDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIE
Sbjct:  338 KSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYLLDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIE 926          

HSP 2 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 338/338 (100.00%), Postives = 338/338 (100.00%), Query Frame = 3
Query:   60 MLFVSRYFNNFNIVNARTIKYTIGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK 1073
            MLFVSRYFNNFNIVNARTIKYTIGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK
Sbjct:    1 MLFVSRYFNNFNIVNARTIKYTIGALLSNESMIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK 338          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Planmine SMEST
Match: SMESG000010110.1 (SMESG000010110.1)

HSP 1 Score: 1159.44 bits (2998), Expect = 0.000e+0
Identity = 588/589 (99.83%), Postives = 589/589 (100.00%), Query Frame = 2
Query: 1085 RSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGXXXXXXXXXXNAVDRWRGNIE 2851
            +SMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYLLDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIE
Sbjct:  307 KSMIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTKRSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTKKSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYLLDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKDFKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIE 895          

HSP 2 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 3
Query:  153 MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK 1073
            MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK
Sbjct:    1 MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQRMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSSFLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDDNKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAERILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDAVSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLEVGKTIYK 307          
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Planmine SMEST
Match: SMESG000009938.1 (SMESG000009938.1)

HSP 1 Score: 203.756 bits (517), Expect = 4.210e-53
Identity = 135/481 (28.07%), Postives = 233/481 (48.44%), Query Frame = 2
Query: 1418 PKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNLKKEVP---------------CTHTDPLT----------KIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLHLVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEFTKPFKYLGLTILVKREQSKSNLASFLQPFEN-TXXXXXXXXXXXXXXXXXXXDRFSPFGRFKLAKSSSTEED-ALNLSSAMWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKD---FKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKAFIWDSARISFEAS--RTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLNFHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVAGVFLIFIE 2764
            PK    K  L+V T + +PFV      +  KCD +  P  + ++ P                 +  P T           I  H CC G  +DLL  +            F  DL  V DG+ G    +     W G+V  LL G+ADL +  + ITP R+ +++F+ PF   G+ I+V   +   +  +FL+P++  +  +++  SVH     L++ +  SP G   L + +    D   +L  ++W  W +L  + +    PR  ++R L  +WA FA++ +ASYTANLAAF++       +SGI D RL NP      F+FATV S   E+  K  + +  M++ M+++N  + ++ I  +K G++ AFI+DS  + ++A+  + C L T G ++   GYG+   K + W  +++  +L +   G ++     W+  + +     +S+   LG+TN    FI++ AG+     ++F+E
Sbjct:  491 PKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLN-------FVVDLFEVPDGKWGGWTPQG----WNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHG---LDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVK--INFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVLDYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLE 955          
The following BLAST results are available for this feature:
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN10.000e+051.33glutamate ionotropic receptor NMDA type subunit 1 ... [more]
GRIN10.000e+051.33glutamate ionotropic receptor NMDA type subunit 1 ... [more]
GRIN10.000e+051.33glutamate ionotropic receptor NMDA type subunit 1 ... [more]
GRIN10.000e+050.57glutamate ionotropic receptor NMDA type subunit 1 ... [more]
GRIN10.000e+050.57glutamate ionotropic receptor NMDA type subunit 1 ... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmr-13.340e-11438.94NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
nmr-13.340e-11438.94NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
nmr-21.036e-5129.35NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
glr-51.448e-4931.50GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-42.902e-4831.18GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmdar10.000e+050.65gene:FBgn0010399 transcript:FBtr0078763[more]
CG111554.641e-5232.84gene:FBgn0039927 transcript:FBtr0333701[more]
CG111554.641e-5232.84gene:FBgn0039927 transcript:FBtr0089195[more]
Ekar2.573e-5032.92gene:FBgn0039916 transcript:FBtr0110906[more]
Ekar7.769e-4932.92gene:FBgn0039916 transcript:FBtr0344874[more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin1b0.000e+052.59glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin1b0.000e+052.52glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin1a0.000e+051.92glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin1a0.000e+051.75glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin1a0.000e+051.76glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin10.000e+050.08glutamate ionotropic receptor NMDA type subunit 1 ... [more]
grin10.000e+050.08glutamate ionotropic receptor NMDA type subunit 1 ... [more]
grin10.000e+050.08glutamate ionotropic receptor NMDA type subunit 1 ... [more]
grin10.000e+050.08glutamate ionotropic receptor NMDA type subunit 1 ... [more]
grin10.000e+049.51glutamate ionotropic receptor NMDA type subunit 1 ... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grin10.000e+051.16glutamate receptor, ionotropic, NMDA1 (zeta 1) [So... [more]
Grin10.000e+051.16glutamate receptor, ionotropic, NMDA1 (zeta 1) [So... [more]
Grin10.000e+051.16glutamate receptor, ionotropic, NMDA1 (zeta 1) [So... [more]
Grin10.000e+051.16glutamate receptor, ionotropic, NMDA1 (zeta 1) [So... [more]
Grin10.000e+050.41glutamate receptor, ionotropic, NMDA1 (zeta 1) [So... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4KD90|NMDA1_DROMO0.000e+051.16Glutamate [NMDA] receptor subunit 1 OS=Drosophila ... [more]
sp|P35439|NMDZ1_RAT0.000e+051.33Glutamate receptor ionotropic, NMDA 1 OS=Rattus no... [more]
sp|Q05586|NMDZ1_HUMAN0.000e+051.33Glutamate receptor ionotropic, NMDA 1 OS=Homo sapi... [more]
sp|Q5R1P0|NMDZ1_CANLF0.000e+051.33Glutamate receptor ionotropic, NMDA 1 OS=Canis lup... [more]
sp|P35438|NMDZ1_MOUSE0.000e+051.16Glutamate receptor ionotropic, NMDA 1 OS=Mus muscu... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F0R59.505e-2159.30Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4S2LNE10.000e+061.15Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A8H00.000e+061.65Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7JKC90.000e+061.57Glutamate [NMDA] receptor subunit 1 OS=Clonorchis ... [more]
A0A4Z2D3T52.406e-960.03Glutamate [NMDA] receptor subunit 1 OS=Schistosoma... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin1b0.000e+052.25glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin1b0.000e+052.25glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin1a0.000e+052.09glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin1a0.000e+051.54glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin1b0.000e+052.17glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010716.11.821e-5732.19pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
gria1b6.261e-4931.03glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000005084.14.997e-4231.91pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000002503.13.494e-2032.00pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
ENSPMAT00000000621.17.740e-2032.56pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355455.755e-15651.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302033.676e-5533.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343635.707e-5030.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448424.688e-4832.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412914.975e-4130.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044529.10.000e+051.80glutamate receptor ionotropic, NMDA 1 [Source:NCBI... [more]
ENSORLT00000032602.10.000e+051.80glutamate receptor ionotropic, NMDA 1 [Source:NCBI... [more]
ENSORLT00000020602.20.000e+052.42glutamate receptor ionotropic, NMDA 1 [Source:NCBI... [more]
ENSORLT00000020603.20.000e+052.43glutamate receptor ionotropic, NMDA 1 [Source:NCBI... [more]
grin1a0.000e+052.01glutamate receptor ionotropic, NMDA 1 [Source:NCBI... [more]
back to top
BLAST of Glutamate [NMDA] receptor subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001343.10.000e+099.85SMESG000001343.1[more]
SMESG000010110.10.000e+099.84SMESG000010110.1[more]
SMESG000010110.10.000e+099.83SMESG000010110.1[more]
SMESG000010110.10.000e+099.83SMESG000010110.1[more]
SMESG000009938.14.210e-5328.07SMESG000009938.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029526 ID=SMED30029526|Name=Glutamate [NMDA] receptor subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3273bp
CCGAAAACACTTATAGATATTCTAGGATGTCGGATATCAAGTCATTTGTG
TTATATATTATGTTATTTGTCTCTCGTTACTTTAATAATTTCAATATTGT
AAATGCGAGAACAATTAAGTATACGATTGGTGCTTTGCTTAGTAATGAGA
GTATGATCGACGAATTTAAGCAATCTGTTGATGAAGCAAATAAAAAATTC
GAGGATATGGATATAAAATTTGAGGTCAGAGCTGAACTCATGGCCAAACG
AGCTTTGATAGCAGCAGAGCAAGTTTGTAAACTGATTAGTGCTACAGATC
AAAGAATGTTTAGTTTAATTGTAAGTCACCCTCCTTATAATCCGGATACA
CCACCATTGAGTGCATCTTTTACCTGCGCATTTTATAACATTCCAGTAAT
GGGAATTAGTGCTAGACAATCGGCATTTAGTGATAAATATTCTCATTCGA
GTTTCCTGCGAACTGTACCTCCTTACAGTGAAGAAGCACGCGTCTGGACC
GAATTAATCCGAGAATTTCGATGGCGTGAAATCAGTCTCGTTTATTCAGA
TGATCAGGAGGGCAAAACGTTACTGTCGAGGTTAGAAAGGGAATCAGATG
ACAATAAACATTTCCGGATTACTCGAACAGTTCATTTTCCGGCCGACGAA
GATGATGATGTAAAAAGTAATTTCACGGATTTATTAAAGCCAATCAGGGC
CGAGCAAACTCGCGCCATCGTTCTGTATGCCAAACAAGAATTTGCGGAAC
GAATTTTAAAGGCGGCTCAGCAATTGGAAATGCTGGGTAAAGAATGGGCT
TGGATTGTTACTGAGCAAATTTTAAAGATGCCAAAATTGCCCCAAGGATT
GATTGGATTACAATTAGCACATGCTTCAGAAAGTGCCCATATAAAAGATG
CTGTCTCAGTTGTAACTCAAGGCATTGCATCGGCTTATATTGCTGATCAA
GTGACCATGTCGACAATACAAGCACCGGCTAATTGTTCTGTGAATCCCTA
TAAAGTAGAGACTAAGAAAGGTCGTCATGGCCAAAGTTATTCATGGCTAG
AAGTTGGCAAGACTATTTATAAGATTGTCCTCCTAGATCAATGATTGGAG
TCAAAATCATCGACGGGCGAACGGGTAAAATTAAATTCGATGATAAAGGG
GATCGAGTCATGCCGGTTTATGATATCGTCAATGTTCATGGATCACCGAA
TCACGTGAGCTTGGTGAAAGTTGGAACATATGGAACAAAACGTAGTCGGC
CAGAAGATTGGGATTCGAAGGAGCCATTTATTGAGTTGCTAAATCTCGAC
ATGGGAAAAATTATATGGCCGGGTAATGATACATTAAAACGTAAAAAAGA
GGTTTGTGTAAAGCGCAATAATCGTAGTGATTGCACTAAAAAATCAGTTG
AAAGTGTTCCATCAGCTCCAAAGAGTTTTATGAAGAAAACATTGTTAAAA
GTTGTTACGAAACGCAGTATACCATTTGTAGAAGCTAGACCAATCAAGAA
AGGTGAAAAATGTGATACTAGCAATAATCCTTTGAATCTGAAAAAGGAAG
TACCTTGTACACACACGGATCCATTGACGAAAATTGTTACACATTATTGC
TGTAAGGGATATTGTATTGATTTGCTTAGACGACTCGCAAATCGCACCGG
AATCGAAGAAAATTTTACGCCTTTCACATATGATCTTCATCTTGTTGGTG
ATGGAGAAGTAGGCGCGGAAAAGAATGAAAACGACACTAAACGCTGGACT
GGAATGGTTGGAGAATTACTGTCTGGGGAGGCGGATTTAGCAGTTGCTCC
GATGACAATCACTCCGGAACGAGCCGCTAGAGTTGAATTCACTAAACCGT
TTAAATATCTCGGCTTGACGATTTTAGTGAAACGGGAGCAATCGAAATCT
AATTTGGCATCATTTCTGCAACCCTTTGAAAACACTTTATGGGTCTTGGT
TGCTCTTTCTGTTCATGTAGTTGCTCTGGTACTCTATTTGCTTGATCGTT
TCTCTCCTTTTGGGCGATTTAAATTAGCTAAAAGCTCCAGCACTGAGGAA
GATGCGCTGAATCTTAGCAGTGCTATGTGGTTCGCTTGGGGTGTTTTACT
CAATTCAGGTATTGGGGAAGGAACTCCTCGTAGTTTTAGTGCTCGCGTTC
TTGGGATGGTTTGGGCTGGGTTCGCTATGATAATTGTGGCTAGTTATACG
GCTAATCTCGCTGCGTTTCTTGTTCTTGATCGTCCAGAAGCTTCCATATC
AGGAATTGATGATGCTAGATTACGAAATCCCCAGAAAGACTTCAAATTTG
CCACAGTCAAAAGTAGTCCAGTTGAACAATATTTTAAAAGACAAGTGGAA
TACGCTACGATGTATCGTACAATGGAATCGTATAATGTCAATTCTGCTGA
AGAGGCAATTGATCAAGTAAAAAAGGGGGATTTGAAAGCTTTTATTTGGG
ATTCAGCTCGAATTAGCTTTGAAGCTTCACGAACTTGTGATTTGATAACT
GCCGGGGAAGTGTTTGGTAGAAATGGCTATGGCTTAGCTATGAAGAAAGA
TAATCCCTGGCTTTATGAAATGTCTCAAGCGGTTCTCAATTTTCACGAAA
GAGGGTTTATGGAAAGTCTCGATACTAATTGGATTCTTGTAAAAGCTGAA
GGTTGTGATAGGACTGAATCTAGCCCGGCAACTCTGGGATTGACAAATAT
GGCCGGTGTATTCATAATGGTTGCCGCTGGAATCGTGGCGGGAGTTTTTC
TTATTTTCATTGAAATAGCCTATAAAAAACGACGAGGTCTAAAAGAAAAG
GAACTGGAATTAGCAAAGAATGCTGTTGATAGATGGCGTGGGAATATTGA
GAAGCGAAAGATTTTACGCAAAACCCTTTCTGCTGAAAGCGATTTTCACC
GATATTTCAACAGCCTTAAAGGTGTTGATATTGTTGGCGATTCATCGGGG
GCCACTGGTTCTTTGTTAGCAACTCAAAATTCTAATAACATTTCCATGTC
CGGTCATAAAGATACTAGAATTTTCTTTGATAACGAAATTCAAGTCTAAT
TTTGTTGATCTCATCATTTGATGATATTTCTAAGATTTTTCATATATTAA
GTTATTGTCATTTGGTTTTTTAATTCTGAAACGCATTTTTTTTGTAATTA
ACTTGCAAACAAAGTATTTGATTGGTTAATTTTCCATGTTATGCTGCTTT
TATTAAATAGATATATTTACTTCAAATATTTCTTTATGTATTTCTATATG
AATTGTTAAAATATAAATGCGGG
back to top

protein sequence of SMED30029526-orf-1

>SMED30029526-orf-1 ID=SMED30029526-orf-1|Name=SMED30029526-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
ENTYRYSRMSDIKSFVLYIMLFVSRYFNNFNIVNARTIKYTIGALLSNES
MIDEFKQSVDEANKKFEDMDIKFEVRAELMAKRALIAAEQVCKLISATDQ
RMFSLIVSHPPYNPDTPPLSASFTCAFYNIPVMGISARQSAFSDKYSHSS
FLRTVPPYSEEARVWTELIREFRWREISLVYSDDQEGKTLLSRLERESDD
NKHFRITRTVHFPADEDDDVKSNFTDLLKPIRAEQTRAIVLYAKQEFAER
ILKAAQQLEMLGKEWAWIVTEQILKMPKLPQGLIGLQLAHASESAHIKDA
VSVVTQGIASAYIADQVTMSTIQAPANCSVNPYKVETKKGRHGQSYSWLE
VGKTIYKIVLLDQ*
back to top

protein sequence of SMED30029526-orf-2

>SMED30029526-orf-2 ID=SMED30029526-orf-2|Name=SMED30029526-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=653bp
MIGVKIIDGRTGKIKFDDKGDRVMPVYDIVNVHGSPNHVSLVKVGTYGTK
RSRPEDWDSKEPFIELLNLDMGKIIWPGNDTLKRKKEVCVKRNNRSDCTK
KSVESVPSAPKSFMKKTLLKVVTKRSIPFVEARPIKKGEKCDTSNNPLNL
KKEVPCTHTDPLTKIVTHYCCKGYCIDLLRRLANRTGIEENFTPFTYDLH
LVGDGEVGAEKNENDTKRWTGMVGELLSGEADLAVAPMTITPERAARVEF
TKPFKYLGLTILVKREQSKSNLASFLQPFENTLWVLVALSVHVVALVLYL
LDRFSPFGRFKLAKSSSTEEDALNLSSAMWFAWGVLLNSGIGEGTPRSFS
ARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEASISGIDDARLRNPQKD
FKFATVKSSPVEQYFKRQVEYATMYRTMESYNVNSAEEAIDQVKKGDLKA
FIWDSARISFEASRTCDLITAGEVFGRNGYGLAMKKDNPWLYEMSQAVLN
FHERGFMESLDTNWILVKAEGCDRTESSPATLGLTNMAGVFIMVAAGIVA
GVFLIFIEIAYKKRRGLKEKELELAKNAVDRWRGNIEKRKILRKTLSAES
DFHRYFNSLKGVDIVGDSSGATGSLLATQNSNNISMSGHKDTRIFFDNEI
QV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0005216ion channel activity
GO:0004872receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0004970ionotropic glutamate receptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001828ANF_lig-bd_rcpt
IPR028082Peripla_BP_I
IPR001508Iono_rcpt_met
IPR019594Glu/Gly-bd
IPR001320Iontro_rcpt
IPR018882CaM-bd_C0_NMDA_rcpt_NR1
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 537..561
score: 81.6
coord: 283..308
score: 85.0
coord: 353..380
score: 96.43
coord: 322..346
score: 88.8
coord: 195..223
score: 35.17
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 155..228
e-value: 4.3E-15
score: 66.1
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 169..266
e-value: 4.0E-27
score: 94.7
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 151..517
e-value: 1.0E-69
score: 247.6
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 281..548
e-value: 9.6E-38
score: 129.4
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 258..480
e-value: 4.0E-111
score: 373.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 268..558
e-value: 4.0E-111
score: 373.3
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 171..529
e-value: 4.0E-111
score: 373.3
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 109..591
NoneNo IPR availablePANTHERPTHR18966:SF400GLUTAMATE RECEPTOR, IONOTROPIC, N-METHYL D-ASPARTATE 1Acoord: 109..591
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 282..378
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 167..515
NoneNo IPR availableTMHMMTMhelixcoord: 282..301
NoneNo IPR availableTMHMMTMhelixcoord: 357..379
NoneNo IPR availableTMHMMTMhelixcoord: 538..560
IPR018882Calmodulin-binding domain C0, NMDA receptor, NR1 subunitPFAMPF10562CaM_bdg_C0coord: 559..587
e-value: 5.5E-13
score: 48.7
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 8..78