Splicing factor 3B subunit 3

Overview
NameSplicing factor 3B subunit 3
Smed IDSMED30029523
Length (bp)3763
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Splicing factor 3B subunit 3 (SMED30029523) t-SNE clustered cells

Violin plots show distribution of expression levels for Splicing factor 3B subunit 3 (SMED30029523) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Splicing factor 3B subunit 3 (SMED30029523) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Splicing factor 3B subunit 3 (SMED30029523) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029523

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029523h1SMcG0008186 Contig5912newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029523h1SMcG0008186 Contig5912uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30029523h1SMcG0008186 SmedASXL_016162SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029523h1SMcG0008186 SmedASXL_016162SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30029523h1SMcG0008186 Contig5912newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029523h1SMcG0008186 Contig5912uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30029523h1SMcG0008186 dd_Smed_v4_4241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029523h1SMcG0008186 dd_Smed_v4_4241_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Human
Match: SF3B3 (splicing factor 3b subunit 3 [Source:HGNC Symbol;Acc:HGNC:10770])

HSP 1 Score: 1726.84 bits (4471), Expect = 0.000e+0
Identity = 818/1220 (67.05%), Postives = 1003/1220 (82.21%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE++SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LGDDALVQVYPDGIRHIR D+RV+ W+ P KKTIVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LE+ASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +FS   ++ Y++VG   D IL+P S  GG + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L +YD+GKKKLLRK  NK+    I  IQ    R++V+D+Q+S  WV+Y +R ENQL+IFADDT  RWV    +LD DT A ADKFGNI VVRLP +  D+V+EDP+G+KALW+RG L GASQK EV+ +++VGE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  L GRDHL +RSYYFP KNVIDGDLCE F+++E +KQ+++S EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Human
Match: DDB1 (damage specific DNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:2717])

HSP 1 Score: 201.445 bits (511), Expect = 7.221e-52
Identity = 284/1212 (23.43%), Postives = 488/1212 (40.26%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGK---NIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDV--GFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEM-----VREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHI--RPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGL-SDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASI----IKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYF-----PCKNVIDGDLCEIFSTLEISKQR 3631
            Y +T QK T++   V GHF+  +   +++AK   LE+     T+  ++ +    ++G I  +  F   G  KD L + +      ILEY       +I  +       + G R    G    +DP  R I     +    V  L+RD++        L+A       LH+I V    G + PT   +   Y D      G  V+    +L   E + G         E +E  A+ +I+VP   E   G II  +  ITY N      I  PI ++             VC           + L   E G +F + LE + +M     ++++R++      +A  +  L  G +FV +  G+  L ++    D +++  +  AM     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG    +W ++   +   D  +V+SF+  T VL + GE VEE    GF+    T  C  +    L+Q+    +R +   P   V  W+ P  K I   + N  QVV+A+ G  L Y ++     +L +     E   ++ C+ +  +      S   A+GL +D + R+  L PS  L    M G  + P S+ +    +S             YL   L +G L    ++   G LSD +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + Y    +S+  P+ +     ++L I  ++++  +  + + PL  +PR+             E         S+ E +          P+   Q L+  ++++ L           A   T F   +    + +I     E +   +  QNE A+S+V  K    P+  Y IVGT    ++ P        R      +   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E        L+   HLG   + V V CH   G +V      T  P+   S+++ T+NG IG LV   S  +Y     +++ +     S+   +H  +RS++      P    IDGDL E F  L+IS+ +
Sbjct:    5 YVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYV--VTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIG-RPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKE-------LKAFNIRLEELHVIDVKFLYGCQAPTICFV---YQDPQ----GRHVKTYEVSLREKEFNKG-----PWKQENVEAEASMVIAVP---EPFGGAIIIGQESITYHNGDKYLAIAPPIIKQST----------IVCH-NRVDPNGSRYLLGDME-GRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLN--VDSNEQGSYVVAM-----ETF----------------TNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG-IKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAV-GRALYYLQIHPQ--ELRQIS-HTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKL-PSFELLHKEMLGGEIIPRSILMTTFESSH------------YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIR-TVPLYESPRKICYQ---------EVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSS------TAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPN-TYFIVGT---AMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLF---HLG---EFVNVFCH---GSLVMQNLGETSTPTQ-GSVLFGTVNGMIG-LVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESF--LDISRPK 1104          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Human
Match: DDB1 (damage specific DNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:2717])

HSP 1 Score: 187.193 bits (474), Expect = 1.999e-47
Identity = 269/1164 (23.11%), Postives = 465/1164 (39.95%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGK---NIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDV--GFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEM-----VREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHI--RPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGL-SDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASI----IKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHI 3502
            Y +T QK T++   V GHF+  +   +++AK   LE+     T+  ++ +    ++G I  +  F   G  KD L + +      ILEY       +I  +       + G R    G    +DP  R I     +    V  L+RD++        L+A       LH+I V    G + PT   +   Y D      G  V+    +L   E + G         E +E  A+ +I+VP   E   G II  +  ITY N      I  PI ++             VC           + L   E G +F + LE + +M     ++++R++      +A  +  L  G +FV +  G+  L ++    D +++  +  AM     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG    +W ++   +   D  +V+SF+  T VL + GE VEE    GF+    T  C  +    L+Q+    +R +   P   V  W+ P  K I   + N  QVV+A+ G  L Y ++     +L +     E   ++ C+ +  +      S   A+GL +D + R+  L PS  L    M G  + P S+ +    +S             YL   L +G L    ++   G LSD +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + Y    +S+  P+ +     ++L I  ++++  +  + + PL  +PR+             E         S+ E +          P+   Q L+  ++++ L           A   T F   +    + +I     E +   +  QNE A+S+V  K    P+  Y IVGT    ++ P        R      +   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E        L+   HLG   + V V CH   G +V      T  P+   S+++ T+NG IG LV   S  +Y     +++ +
Sbjct:    5 YVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYV--VTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIG-RPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKE-------LKAFNIRLEELHVIDVKFLYGCQAPTICFV---YQDPQ----GRHVKTYEVSLREKEFNKG-----PWKQENVEAEASMVIAVP---EPFGGAIIIGQESITYHNGDKYLAIAPPIIKQST----------IVCH-NRVDPNGSRYLLGDME-GRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLN--VDSNEQGSYVVAM-----ETF----------------TNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG-IKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAV-GRALYYLQIHPQ--ELRQIS-HTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKL-PSFELLHKEMLGGEIIPRSILMTTFESSH------------YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIR-TVPLYESPRKICYQ---------EVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSS------TAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPN-TYFIVGTA---MVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLF---HLG---EFVNVFCH---GSLVMQNLGETSTPTQ-GSVLFGTVNGMIG-LVTSLSESWYNLLLDMQNRL 1058          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Human
Match: SF3B3 (splicing factor 3b subunit 3 [Source:HGNC Symbol;Acc:HGNC:10770])

HSP 1 Score: 140.584 bits (353), Expect = 1.215e-38
Identity = 65/85 (76.47%), Postives = 75/85 (88.24%), Query Frame = 2
Query: 1196 EEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKR 1450
            EEGDTF+F PR LKNLV +DE++SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R
Sbjct:    1 EEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRR 85          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Human
Match: SF3B3 (splicing factor 3b subunit 3 [Source:HGNC Symbol;Acc:HGNC:10770])

HSP 1 Score: 103.219 bits (256), Expect = 7.928e-26
Identity = 48/72 (66.67%), Postives = 61/72 (84.72%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG 274
            M LYNLTLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG
Sbjct:    1 MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTG 72          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Celegans
Match: teg-4 (Tumorous Enhancer of Glp-1(Gf) [Source:UniProtKB/TrEMBL;Acc:O44985])

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 663/1229 (53.95%), Postives = 878/1229 (71.44%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGT-KVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLT-GIKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADE-EQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPY--SNNGGNIR-------SYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ  ++I +A+ G+FSGT K QEIVV +G  LELL  DT +GKI+ +   ++FGI+R++ AF LT G +D++ V SDSGRIVIL+Y   K  F ++ QET+GK+GCRRIVPG +L  DP GRA+M GA+E+QK+VY++NRDSE +LTISSPLEAH+ +TL   M+G+DVGFENPTFA +E DY DAD D TG A +  ++ LT+YELDLGLNHVVRKY+E L +  N LI+VPGG +GPSG+I+C ENY+ YKN GDQPDIRCPIPRRRN+L+D +R ML + +ATH T K ++FFL Q E GDIFK+TLETD ++V EM+LKYFDTVP A ++C+LK+GFLFVA EFGNH LYQI +L +GDD+ EFSSAM   E D  +F P  LK+L+ ID M+SL+P+    I D+A ED  Q+  L GRG RSSL++L +GLE+S MA SDLPG+PNAVWTVK+  ++ YD+YIVVSF+NATL L+IG+TVEE +DSGFL TTPT+ CA +GDD+LVQ+Y +GIRHIR D+R++ W+AP ++ IVKCA+NRRQV +ALTG ELVYFE+D N G LNEF  RK   ADI CM    +   E  SRFLA+G  D  VR+  LDP++ L  L+ Q LP  PES+ + +      +E  KG    ++LNIGLQNG L R  +D + G + DTRTRYLG++PVKLF++  QG  A+L  S+R WL Y +Q RFHLTP+SY  LEYA+ F S QC EGIVAI  ++LRI+A EKLG  FN  S     TPRR  +HP     I+IETDH +YT  +K  ++ Q+A  ++   +DE E +LA+E+A    +  L E ++GA +A  G WAS I +I   +G+ +   ELPQ+E A  + + +FS  P+E  ++VG  ++ +L+ +    N  +IR       ++ +S  G+  +  H T       A+  F+G  LVG    L +YD+G+KKLL K  NKNFP  IV IQ+   RI+V+D Q+S+ +++Y R+ +NQLV+FADDTT R+V  +CVLD  T A ADKFGN+AVVRLP+ V +DV++DP+ SK++W+RG L GASQKVE++ +F++G+ +TSLQK +L P   E+LVYTTI G IG LV F S D  +FF  LE H+R+E   L GRDHL YRSYY PCK+VIDGD+CE FS ++  KQ+ ++ ELGK  S+I+K LE IR ++AF
Sbjct:    1 MHLYNLTLQGQSAINQAIQGNFSGTPKAQEIVVGRGSALELLTLDTVTGKIKVMCHQDIFGIVRSLLAFRLTAGTRDFIAVGSDSGRIVILQYNAEKTCFERLHQETFGKTGCRRIVPGHFLVGDPRGRALMIGAVERQKLVYIMNRDSEAHLTISSPLEAHKHHTLCYAMVGIDVGFENPTFACLEFDYEDADNDPTGEAAKRTQQTLTFYELDLGLNHVVRKYAEPLNDPGNLLIAVPGGNDGPSGVIVCCENYLVYKNLGDQPDIRCPIPRRRNELDDADRTMLIIATATHKT-KNMYFFLVQAENGDIFKVTLETDEDLVSEMKLKYFDTVPPANALCILKSGFLFVAAEFGNHELYQIASLGEGDDD-EFSSAMGFGENDAAFFEPHELKSLIPIDSMDSLSPLTDAVIGDIAREDAAQIYSLVGRGARSSLKVLRNGLEISEMAVSDLPGNPNAVWTVKKNIEDQYDSYIVVSFVNATLALTIGDTVEEASDSGFLPTTPTIGCAMIGDDSLVQIYSEGIRHIRADKRINEWKAPPRRQIVKCAVNRRQVAVALTGGELVYFELDLN-GTLNEFTERKLFNADIACMTFSEISEGELNSRFLALGTVDNAVRIISLDPNDMLMPLSTQSLPCPPESILLIDT----PNEDGKG-VAAVHLNIGLQNGCLFRNTVDNVTGAIMDTRTRYLGTRPVKLFKVQCQGRSAILCTSSRSWLLYHFQRRFHLTPLSYANLEYAASFCSNQCSEGIVAISASTLRIIAAEKLGVAFNVQSFEHKMTPRRVAVHPSMPCLIVIETDHASYTEVTKNIKRNQMAADVEAMASDETEAQLAQEIATNLRERRLDERVYGAPRAARGKWASAISLISATSGDKLSYFELPQDENAKCVALVQFSKHPNEAMVLVGCGVNEVLNVHDIDPNDTSIRPTRGCVYTFHLSANGDRFDFLHRTETPLPVGAIHDFRGMALVGFGRFLRMYDIGQKKLLAKCENKNFPVSIVNIQSTGQRIIVSDSQESVHFLRY-RKGDNQLVVFADDTTPRYVTCVCVLDYHTVAVADKFGNLAVVRLPERVNEDVQDDPTVSKSVWDRGWLNGASQKVELVSNFFIGDTITSLQKTSLMPGANEALVYTTIGGAIGCLVSFMSKDEVDFFTNLEMHVRSEYPPLCGRDHLAYRSYYAPCKSVIDGDICEQFSLMDTQKQKDVAEELGKTVSEISKKLEDIRTRYAF 1220          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Celegans
Match: ddb-1 (DNA damage-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21554])

HSP 1 Score: 88.1965 bits (217), Expect = 2.749e-17
Identity = 166/790 (21.01%), Postives = 314/790 (39.75%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVL--ELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGIKDY-LVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRA---IMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIE-VDYSDADADTTGGAVEDIR-KNLTYYELDLGLNHVVRKYSER--LEENANFLISVPGGKEGPSGIIICAENYITYK---NFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLE-TDCE---MVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQL---GDDALV-QVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYF------EMDSNSGQLNEFQGRKEAPADIICMALGSVPAE-EQRSRFLAVGLSDQTVRVYLLDP---SNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSL 2341
            Y ++ +K++ ++E+V G+F+G +   ++VA+G  +  +L+ P+     ++ +    ++G +  I        K + L+V ++   + IL Y  GK +           +GC           DP GRA   + +  I +  ++ +  R  E     S  +    S T   H    +V F+ P  +  + VD  + D        +D   K+L + +L++  +   R YS +  +  +++ LI VP       G+I+   N + YK   N G+     C +      LE+      F C        +  F L+ T+ G +  + L  T+ +    V+EMR+ Y     +A S+  +  G +FV +  G+  L ++        EP          G ++     T  N+  I +M             + ++  PQL    G     SLR++ +G+ +  +A  DL G    V       D   D Y++VS  + T VL I GE +E+V         PT+  + L    D  ++ Q     IR +        W     + I K ++N     I L   + VY       EM +   QL      K+   +I C+ L +   +   ++ FL +          +  P   + C + L  + +P +  + CI E+                YL +   +G L+  + D   G   + +   +G++P  L R+  +  + +   S RP + ++   +   + ++ + ++     SS    + +V    NS+
Sbjct:    5 YCVSAKKASVVVESVVGNFTGHENVNLIVARGNRIDVQLVSPE----GLKNVCEIPIYGQVLTIALVKCKRDKRHSLIVVTEKWHMAILAYRDGKVV--------TRAAGC---------IADPTGRATDNLFSLTIHRNGLIAI--RAFEG----SVKMIQWESGTDLRHF---NVRFDYPNVSDFKFVDTGEDDVYRVAFIYDDDHGKHLQFSDLNMH-DKEFRTYSRQASIAADSSVLIPVP---HAIGGVIVLGSNSVLYKPNDNLGEVVPYTCSL------LENTT----FTCHGIVDASGER-FLLSDTD-GRLLMLLLNVTESQSGYTVKEMRIDYLGETSIADSINYIDNGVVFVGSRLGDSQLIRLMT------EP---------NGGSYSVILETYSNIGPIRDM-----------VMVESDGQPQLVTCTGADKDGSLRVIRNGIGIDELASVDLAG---VVGIFPIRLDSNADNYVIVSLSDETHVLQITGEELEDVKLLEINTDLPTIFASTLFGPNDSGIILQATEKQIRLMSSSGLSKFWEPTNGEIISKVSVNAANGQIVLAARDTVYLLTCIVDEMGALDIQLT---AEKKFENEIACLDLSNEGDDPNNKATFLVLAFWSTFAMEVIQLPDLITVCHTDLPTKIIPRSIIATCIEEVH---------------YLLVAFGDGALVYYVFDIKTGTHGEPKKSNVGTRPPSLHRVRNKNRQHLFVCSDRPVIIFSASKKLVFSNVNVKLVDTVCSLSSSAYRDCLVISDGNSM 701          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Celegans
Match: ddb-1 (DNA damage-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21554])

HSP 1 Score: 88.1965 bits (217), Expect = 2.749e-17
Identity = 166/790 (21.01%), Postives = 314/790 (39.75%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVL--ELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGIKDY-LVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRA---IMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIE-VDYSDADADTTGGAVEDIR-KNLTYYELDLGLNHVVRKYSER--LEENANFLISVPGGKEGPSGIIICAENYITYK---NFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLE-TDCE---MVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQL---GDDALV-QVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYF------EMDSNSGQLNEFQGRKEAPADIICMALGSVPAE-EQRSRFLAVGLSDQTVRVYLLDP---SNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSL 2341
            Y ++ +K++ ++E+V G+F+G +   ++VA+G  +  +L+ P+     ++ +    ++G +  I        K + L+V ++   + IL Y  GK +           +GC           DP GRA   + +  I +  ++ +  R  E     S  +    S T   H    +V F+ P  +  + VD  + D        +D   K+L + +L++  +   R YS +  +  +++ LI VP       G+I+   N + YK   N G+     C +      LE+      F C        +  F L+ T+ G +  + L  T+ +    V+EMR+ Y     +A S+  +  G +FV +  G+  L ++        EP          G ++     T  N+  I +M             + ++  PQL    G     SLR++ +G+ +  +A  DL G    V       D   D Y++VS  + T VL I GE +E+V         PT+  + L    D  ++ Q     IR +        W     + I K ++N     I L   + VY       EM +   QL      K+   +I C+ L +   +   ++ FL +          +  P   + C + L  + +P +  + CI E+                YL +   +G L+  + D   G   + +   +G++P  L R+  +  + +   S RP + ++   +   + ++ + ++     SS    + +V    NS+
Sbjct:    5 YCVSAKKASVVVESVVGNFTGHENVNLIVARGNRIDVQLVSPE----GLKNVCEIPIYGQVLTIALVKCKRDKRHSLIVVTEKWHMAILAYRDGKVV--------TRAAGC---------IADPTGRATDNLFSLTIHRNGLIAI--RAFEG----SVKMIQWESGTDLRHF---NVRFDYPNVSDFKFVDTGEDDVYRVAFIYDDDHGKHLQFSDLNMH-DKEFRTYSRQASIAADSSVLIPVP---HAIGGVIVLGSNSVLYKPNDNLGEVVPYTCSL------LENTT----FTCHGIVDASGER-FLLSDTD-GRLLMLLLNVTESQSGYTVKEMRIDYLGETSIADSINYIDNGVVFVGSRLGDSQLIRLMT------EP---------NGGSYSVILETYSNIGPIRDM-----------VMVESDGQPQLVTCTGADKDGSLRVIRNGIGIDELASVDLAG---VVGIFPIRLDSNADNYVIVSLSDETHVLQITGEELEDVKLLEINTDLPTIFASTLFGPNDSGIILQATEKQIRLMSSSGLSKFWEPTNGEIISKVSVNAANGQIVLAARDTVYLLTCIVDEMGALDIQLT---AEKKFENEIACLDLSNEGDDPNNKATFLVLAFWSTFAMEVIQLPDLITVCHTDLPTKIIPRSIIATCIEEVH---------------YLLVAFGDGALVYYVFDIKTGTHGEPKKSNVGTRPPSLHRVRNKNRQHLFVCSDRPVIIFSASKKLVFSNVNVKLVDTVCSLSSSAYRDCLVISDGNSM 701          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Fly
Match: Sf3b3 (gene:FBgn0035162 transcript:FBtr0072597)

HSP 1 Score: 1684.85 bits (4362), Expect = 0.000e+0
Identity = 800/1230 (65.04%), Postives = 982/1230 (79.84%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGAS----------DQSEQQKGNT-GTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQ-YIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQK+T +  AVHG+FSG K QE+++++GK LELLRPD+ +GK+ TLLSTE+FG +RA+ AF LTG  KDY+VV SDSGRIVILEY P KN   KV QET+GKSGCRRIVPGQY A+DP GRA+M GA+EKQK+ Y++NRD++  LTISSPLEAH+SNTLT HM+GVDVGF+NP FA +E+DY +AD D +G A +  ++ LT+YELDLGLNHVVRKYSE LEE+ANFL+SVPGG +GPSG++IC+ENY+TYKN GDQ DIRCPIPRRRNDL+DPERGM+F+CSATH TK  ++FFL QTEQGDIFKITLETD ++V E++LKYFDTVP AT+MCVLKTGFLFVA+EFGNHYLYQI +L D DDEPEFSSAMPLEEG+TF+FAPR LKNLV +DE+ S APII   +ADLANEDTPQL VLCGRGPRS+LR+L HGLEVS MA S+LPG+PNAVWTVK+ AD+ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL CA LGDDALVQVYPDGIRHIR D+RV+ W+AP KK+I KCA+N+RQVVI L+G ELVYFEMD  +G+LNE+  R E PA+I+CMALG+VP  EQRS FLAVGL+D TVR+  LDP+NCL+  +MQ LP   ESLC+ E+G +          D   Q+ GN  GT+YLNIGL NG LLR ++DP+ G+L+DTRTRYLGS+PVKLFRI +QGSEAVLA+S+R WLSY +QNRFHLTP+SYE LEYASGFSSEQC EGIVAI  N+LRILALEKLG +FNQ++ PL YTPR FV+HP +G  +I ETDHNAYT  +K  RK+Q+A +M+ A  DEE+ELA+EMA AF+ E LPED+F + KAG G WAS I+ +  ++G+ +  + L QNEA +SM M KFS   D + Y+ VG   D  L+P  + GG I  YKI  T   LE  H T++D+ P A+C FQGRLL G    L IYD GKKK+LRK  NK+ PY+IV IQA   R+ V+D+Q+S+F+++Y RR ENQL+IFADDT  RWV    +LD DT A ADKFGN+++ RLP  VTDDV+EDP+G+K+LW+RG L GASQK E +C F+VGE++ SLQKATL P G E+L+Y T++G +G  VPF S + Y+FFQ LE H+R EN  L GRDHL YRS Y+P KNV+DGDLCE + ++E +KQ+SI+ ++ + P+ I K LE IR ++AF
Sbjct:    1 MYLYNLTLQKATGVTHAVHGNFSGGKQQEVLLSRGKSLELLRPDSNTGKVHTLLSTEIFGCVRALMAFRLTGGTKDYIVVGSDSGRIVILEYNPSKNALEKVHQETFGKSGCRRIVPGQYFAIDPKGRAVMIGAVEKQKLAYIMNRDTQARLTISSPLEAHKSNTLTYHMVGVDVGFDNPMFACLEIDYEEADMDPSGDAAQRTQQTLTFYELDLGLNHVVRKYSEPLEEHANFLVSVPGGNDGPSGVLICSENYLTYKNLGDQHDIRCPIPRRRNDLDDPERGMIFICSATHRTKS-MYFFLLQTEQGDIFKITLETDDDVVSEIKLKYFDTVPPATAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDDEPEFSSAMPLEEGETFFFAPRALKNLVLVDELPSFAPIITSQVADLANEDTPQLYVLCGRGPRSTLRVLRHGLEVSEMAVSELPGNPNAVWTVKKRADDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLCCAALGDDALVQVYPDGIRHIRSDKRVNEWKAPGKKSITKCAVNQRQVVITLSGRELVYFEMDP-TGELNEYTERSEMPAEIMCMALGTVPEGEQRSWFLAVGLADNTVRILSLDPNNCLTPCSMQALPSPAESLCLVEMGHTESTTQGGLDDDAPAQRSGNNKGTIYLNIGLSNGVLLRTVLDPVSGDLADTRTRYLGSRPVKLFRIKMQGSEAVLAMSSRTWLSYYHQNRFHLTPLSYETLEYASGFSSEQCSEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRTFVIHPDTGRMLIAETDHNAYTEDTKSARKEQMAEEMRSAAGDEERELAREMANAFINEVLPEDVFSSPKAGLGLWASQIRCLDAMHGQTMFSVPLTQNEAIMSMAMLKFSIAADGRYYLAVGIAKDLQLNPRISQGGCIDIYKIDPTCSSLEFMHRTDIDEIPGALCGFQGRLLAGCGRMLRIYDFGKKKMLRKCENKHIPYQIVNIQAMGHRVYVSDVQESVFFIRY-RRAENQLIIFADDTHPRWVTATTLLDYDTIAIADKFGNLSIQRLPHSVTDDVDEDPTGTKSLWDRGLLSGASQKSENICSFHVGEIIMSLQKATLIPGGSEALIYATLSGTVGAFVPFTSREDYDFFQHLEMHMRNENPPLCGRDHLSYRSSYYPVKNVLDGDLCEQYLSIEAAKQKSIAGDMFRTPNQICKKLEDIRTRYAF 1227          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Fly
Match: Sf3b3 (gene:FBgn0035162 transcript:FBtr0331404)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 340/468 (72.65%), Postives = 404/468 (86.32%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTAD 1459
            M LYNLTLQK+T +  AVHG+FSG K QE+++++GK LELLRPD+ +GK+ TLLSTE+FG +RA+ AF LTG  KDY+VV SDSGRIVILEY P KN   KV QET+GKSGCRRIVPGQY A+DP GRA+M GA+EKQK+ Y++NRD++  LTISSPLEAH+SNTLT HM+GVDVGF+NP FA +E+DY +AD D +G A +  ++ LT+YELDLGLNHVVRKYSE LEE+ANFL+SVPGG +GPSG++IC+ENY+TYKN GDQ DIRCPIPRRRNDL+DPERGM+F+CSATH T K ++FFL QTEQGDIFKITLETD ++V E++LKYFDTVP AT+MCVLKTGFLFVA+EFGNHYLYQI +L D DDEPEFSSAMPLEEG+TF+FAPR LKNLV +DE+ S APII   +ADLANEDTPQL VLCGRGPRS+LR+L HGLEVS MA S+LPG+PNAVWTVK+ AD
Sbjct:    1 MYLYNLTLQKATGVTHAVHGNFSGGKQQEVLLSRGKSLELLRPDSNTGKVHTLLSTEIFGCVRALMAFRLTGGTKDYIVVGSDSGRIVILEYNPSKNALEKVHQETFGKSGCRRIVPGQYFAIDPKGRAVMIGAVEKQKLAYIMNRDTQARLTISSPLEAHKSNTLTYHMVGVDVGFDNPMFACLEIDYEEADMDPSGDAAQRTQQTLTFYELDLGLNHVVRKYSEPLEEHANFLVSVPGGNDGPSGVLICSENYLTYKNLGDQHDIRCPIPRRRNDLDDPERGMIFICSATHRT-KSMYFFLLQTEQGDIFKITLETDDDVVSEIKLKYFDTVPPATAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDDEPEFSSAMPLEEGETFFFAPRALKNLVLVDELPSFAPIITSQVADLANEDTPQLYVLCGRGPRSTLRVLRHGLEVSEMAVSELPGNPNAVWTVKKRAD 467          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Fly
Match: pic (gene:FBgn0260962 transcript:FBtr0082709)

HSP 1 Score: 199.904 bits (507), Expect = 1.221e-51
Identity = 274/1226 (22.35%), Postives = 497/1226 (40.54%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLE--LLRPDTTSGKIQTLLSTEVFGIIRAIFAFHL-TGIKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVP--GQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAH--RSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPER----GMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADEL-YDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHV--WRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLP--VNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGA-AKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVI----------DCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFY-----VGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYF-----PCKNVIDGDLCEIFSTLEISKQR 3631
            Y +T QK T+++  + G+F+      +++A+   +E  L+ P+     ++ L    + G I  +  F      KD L + +    ++ILE     ++   V +     S    I    G   A+DP  R I  G    Q +  ++  D +     +S L+A   R + L ++ +    G  NPT  VI         D+ G  V+    NL   E        +    + +E  A  LI VP       G+I+     I Y + G       P+  R++ +    R    G+ ++          LF   A+T +G             V++++++    + +   +  L  GFL++    G+  L ++ +                E  D  Y  P        ++   +LAPI+   + DL  +   Q+    G     SLR++  G+ +   A  DLPG    +W++K   DE  Y+  +V++F+  T +L++ GE VEE    GF     T +C+ +  D L+QV  D +R +    +  V  WR    +TI   + N  Q+++A +  ++ Y  ++   G L E Q R+    ++ C+ +  +   +++S  +AVGL      V L  P   L  +  + L   + P S+ +                G  YL   L +G +   ++D   G+L+D +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + +    +++  P+ +    +N++ +  ++++  +  + + PL   PRR      S    +     + + R   +  +   + + Q              ++ FL +    +   A A+ G       + VI     E +   +    E   S++ AK    P+  Y++  +++            I+  Y  N       K+++  E       T VD +  A+  F G++L G+ + + +Y+   +K LR   N       + ++A    I+V D+  SI  ++ H++ E   V  A D   +W+  + +LD+DT   ++  GN+ V +     T D E       A   R HLG     V V  H       VGE  T +    L         Y T NG IGI+      DFY+F   LE  ++    S+   +H +YR++       P +  IDGDL E F  L   K R
Sbjct:    5 YVVTAQKPTAVVACLTGNFTSPTDLNLIIARNNQVEIDLVTPE----GLRPLKEININGTIAVMRHFRPPDSNKDLLFILTRRYNVMILEARMVNDVITVVTKANGNVSDSVGIPSEGGVIAAIDPKARVI--GMCLYQGLFTIIPMDKD-----ASELKATNLRMDELNVYDVEFLHGCLNPTVIVIH-------KDSDGRHVKSHEINLRDKEF-----MKIAWKQDNVETEATMLIPVPSPI---GGVIVIGRESIVYHD-GSNYHAVAPLTFRQSTINCYARVSSNGLRYLLGNMDGQLYMLFLGTAETSKG-----------VTVKDIKVEQLGEISIPECITYLDNGFLYIGARHGDSQLVRLNS----------------EAIDGSYVVP--------VENFTNLAPILDIAVVDLDRQGQGQIITCSGSFKDGSLRIIRIGIGIQEHACIDLPG-IKGMWSLKVGVDESPYENTLVLAFVGHTRILTLSGEEVEETEIPGFASDLQTFLCSNVDYDQLIQVTSDSVRLVSSATKALVAEWRPTGDRTIGVVSCNTTQILVA-SACDIFYIVIED--GSLRE-QSRRTLAYEVACLDITPLDETQKKSDLVAVGLWTDISAVILSLPD--LETIYTEKLSGEIIPRSILMTTF------------EGIHYLLCALGDGSMYYFIMDQTTGQLTDKKKVTLGTQPTTLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNHMCSLNAQAYPDSLALANKNAVILGTIDEIQKLHIR-TVPLGEGPRRIAYQESSQTFAVSTLRIDVHGRGGAKPLRNSASTQAQNITC----------SSNFLPKPGGGNSTAANAEVGQEIDVHNLLVIDQNTFEVLHAHQFVAPETISSLMSAKLGDDPNTYYVVATSLVIPEEPEPKVGRIIIFHYHEN-------KLTQVAE-------TKVDGTCYALVEFNGKVLAGIGSFVRLYEWTNEKELRMECNIQNMIAALFLKAKGDFILVGDLMRSITLLQ-HKQMEGIFVEIARDCEPKWMRAVEILDDDTFLGSETNGNLFVCQKDSAATTDEERQLLPELA---RFHLG---DTVNVFRHGSLVMQNVGERTTPINGCVL---------YGTCNGAIGIVTQI-PQDFYDFLHGLEERLKKIIKSVGKIEHTYYRNFQINSKVEPSEGFIDGDLIESFLDLSRDKMR 1107          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Zebrafish
Match: sf3b3 (splicing factor 3b, subunit 3 [Source:NCBI gene;Acc:406824])

HSP 1 Score: 1729.92 bits (4479), Expect = 0.000e+0
Identity = 813/1220 (66.64%), Postives = 1003/1220 (82.21%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG++R++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M GA EKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFK+TLETD EMV E+R+KYFDT+PVAT+MCVLKTGFLFV++EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE  SL+PI+ C IADLANEDTPQL V CGRGPRS+LR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KKTI++CA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G  ++ ++  +KG  G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP++ N I+IETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG+G WAS++++I P+ G  +  ++L QNEAA S+ + +F    D+ Y++VG   D IL+P S  GG I +Y+I   G+ LE  H T V+D P A+  FQGR+LVG+   L IYD+GKKKLLRK  NK+ P  +  I     R++V+D+Q+S+FWV+Y RR ENQL+IFADDT  RW+   C+LD DT A+ADKFGNI VVRLP + +DDV+EDP+G+KALW+RG L GASQK E++ ++++GE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ LE H+R+E   L GRDHL +RSYYFP KNVIDGDLCE F++++  KQ+S+S EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNITLQRATGISHAIHGNFSGTKQQEIVVSRGKILELLRPDANTGKVHTLLTMEVFGVVRSLMAFRLTGGTKDYVVVGSDSGRIVILEYHPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMIGATEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEALEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKVTLETDEEMVTEIRMKYFDTIPVATAMCVLKTGFLFVSSEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQESLSPIMSCQIADLANEDTPQLYVACGRGPRSTLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHVEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKTIIRCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGVEKQDELGEKGTIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPETNNLILIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPEAIFGAPKAGSGQWASLVRLINPIQGNTLDLVQLEQNEAAFSVAICRFLNGGDDWYVLVGVARDMILNPRSVGGGYIYTYRIVGGGDKLEFLHKTPVEDVPLAIAPFQGRVLVGVGKLLRIYDLGKKKLLRKCENKHVPNLVTGIHTIGQRVIVSDVQESLFWVRY-RRNENQLIIFADDTYPRWITTACLLDYDTMASADKFGNICVVRLPPNTSDDVDEDPTGNKALWDRGLLNGASQKAEIIINYHIGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHLEMHMRSEFPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMDPHKQKSVSEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Zebrafish
Match: sf3b3 (splicing factor 3b, subunit 3 [Source:NCBI gene;Acc:406824])

HSP 1 Score: 1729.92 bits (4479), Expect = 0.000e+0
Identity = 813/1220 (66.64%), Postives = 1003/1220 (82.21%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG++R++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M GA EKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFK+TLETD EMV E+R+KYFDT+PVAT+MCVLKTGFLFV++EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE  SL+PI+ C IADLANEDTPQL V CGRGPRS+LR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KKTI++CA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G  ++ ++  +KG  G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP++ N I+IETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG+G WAS++++I P+ G  +  ++L QNEAA S+ + +F    D+ Y++VG   D IL+P S  GG I +Y+I   G+ LE  H T V+D P A+  FQGR+LVG+   L IYD+GKKKLLRK  NK+ P  +  I     R++V+D+Q+S+FWV+Y RR ENQL+IFADDT  RW+   C+LD DT A+ADKFGNI VVRLP + +DDV+EDP+G+KALW+RG L GASQK E++ ++++GE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ LE H+R+E   L GRDHL +RSYYFP KNVIDGDLCE F++++  KQ+S+S EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNITLQRATGISHAIHGNFSGTKQQEIVVSRGKILELLRPDANTGKVHTLLTMEVFGVVRSLMAFRLTGGTKDYVVVGSDSGRIVILEYHPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMIGATEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEALEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKVTLETDEEMVTEIRMKYFDTIPVATAMCVLKTGFLFVSSEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQESLSPIMSCQIADLANEDTPQLYVACGRGPRSTLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHVEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKTIIRCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGVEKQDELGEKGTIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPETNNLILIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPEAIFGAPKAGSGQWASLVRLINPIQGNTLDLVQLEQNEAAFSVAICRFLNGGDDWYVLVGVARDMILNPRSVGGGYIYTYRIVGGGDKLEFLHKTPVEDVPLAIAPFQGRVLVGVGKLLRIYDLGKKKLLRKCENKHVPNLVTGIHTIGQRVIVSDVQESLFWVRY-RRNENQLIIFADDTYPRWITTACLLDYDTMASADKFGNICVVRLPPNTSDDVDEDPTGNKALWDRGLLNGASQKAEIIINYHIGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHLEMHMRSEFPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMDPHKQKSVSEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Zebrafish
Match: ddb1 (damage-specific DNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1272])

HSP 1 Score: 171.785 bits (434), Expect = 1.006e-42
Identity = 275/1216 (22.62%), Postives = 478/1216 (39.31%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKN---IFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDV--GFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRR----NDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHV--WRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLD-PSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKA--GTGFWASI----IKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDH-LHYRSYYFPCKN-----VIDGDLCEIFSTLEISKQRSI 3637
            Y +T QK T++   + GHF+  +   +++AK   LE+     T+  ++ +    ++G I  +  F   G  KD L + +      ILEY    +   I  +       + G R    G    +DP  R  M G      +  V+  D EN       L+A       L +I V    G + PT   I   Y D      G  V+    +L   E + G         E +E  A+ +I VP   E   G II  +  ITY N      +  PI ++     ++  DP      +       + +LF  L + E+       L     +++++ ++      +A  +  L  G +FV +  G+  L ++    D +D+  +   M     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG    +W ++  +    D  +V+SF+  T VL + GE VEE    GF+    T  C  +    L+Q+    +R +  D +  V  W+ P  + I   + N  QVV+A+ G  L Y ++   SG+L + +               S  +      + +VGL   +V V LL  P             + P S+ +                G+ YL   L +G L    +D   G LS+ +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + Y    +SE  P+ +     ++L I  ++++  +  + + PL  +P+R      S    ++ +                  ++MQ+A              A         +F ++ +   T F   +    + V+     E +   +  QNE A+SMV  K    P   Y IVGT    ++ P        R      T   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E        L+   HLG   + V V  H  +  V+ +L +++    G  S+++ T+NG IG LV   S  +Y     L++ +     S+   +H   +RS++   K       IDGDL E F  L  +K + +
Sbjct:    5 YVVTAQKPTAVNACITGHFTSAEDLNLLIAKNTRLEIYA--VTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGDSIDIITRAHGNVQDRIG-RPSETGIIGIVDPECR--MIGLRLYDGLFKVIPLDRENR-----ELKAFNIRLEELQVIDVQFLYGCQAPTVCFI---YQDPQ----GRHVKTYEVSLREKEFNKG-----PWKQENVEAEASMVIPVP---EPFGGAIIIGQESITYHNGDKYLAVAPPIIKQSTIVCHNRVDPNGSRYLLGDM----EGRLFMLLLEKEE-------LMDGAVVLKDLHVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLN--VDSNDQGSYVGVM-----ETF----------------TNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG-IKGLWPLRSESSRDTDDMLVLSFVGQTRVLMLSGEEVEETELQGFVDNQQTFFCGNVAHQQLIQITSVSVRLVTQDSKALVSEWKEPQGRNISVASCNNTQVVLAV-GRVLYYLQI--LSGELKQIRYTHTHTHRHFSSTSDSCESSVDIC-WSSVGLCWSSVSVVLLKLPCTVRVHKHTCTDEIIPRSILMTTF------------EGSHYLLCALGDGALFYFGLDIQTGVLSERKKVTLGTQPTVLRTFRSLSTSNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSEGYPDSLALANNSTLTIGTIDEIQKLHIR-TVPLYESPKRICYQEVSQCFGVLSS-----------------RVEMQDASGTTAAVRPSASTQALSSSVSSSKLFPSSTSPHETSFGEEVEVHSLLVVDQHTFEVLHAHQFLQNEYALSMVSCKLGRDP-AVYFIVGT---AMVYPEEAEPKQGRIIVFHYTDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGSFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLF---HLG---EFVNVFSHGSL--VLQNLGESSTPTQG--SVLFGTVNGMIG-LVTSLSEGWYSLLLDLQNRLNKVIKSVGKIEHSTTWRSFHTERKTEQATGFIDGDLIESFLDLGRAKMQEV 1110          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Zebrafish
Match: cpsf1 (cleavage and polyadenylation specific factor 1 [Source:ZFIN;Acc:ZDB-GENE-040709-2])

HSP 1 Score: 57.3806 bits (137), Expect = 1.472e-7
Identity = 82/365 (22.47%), Postives = 140/365 (38.36%), Query Frame = 2
Query:  920 CS-ATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVA---TSMCVLKTGFLFVATEFGNHYLYQIT--------------------------------------NLADGDDEPEF--SSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLA---------NEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTV----------------------KRTA----DELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDA-LVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNS 1774
            CS A+  T  K+   L   + G+I+ +TL TD   +R +R  +FD    +   T M  ++ G+LF+ +  GN  L + T                                      NL D  DE E   S A    +  T+ F           D + ++ P     + + A          E   ++ V  G G   +L +L   +   V+   +LPG  + +WTV                      KR      D+    ++++S  ++T++L  G+ + E+  SGF    PT+    +GD+  ++QV P GIR +    ++H     L   IV C++    VVI      +  F + ++S
Sbjct:  324 CSQASFITSDKMVISL---KGGEIYVLTLITDG--MRSVRAFHFDKAAASVLTTCMMTMEPGYLFLGSRLGNSLLLRYTEKLQETPMEEGKENEEKEKQEEPPNKKKRVDSNWAGKGNLPDELDEIEVYGSEAQSGTQLATYSFE--------VCDSILNIGPCASASMGEPAFLSEEFQTNPEPDLEVVVCSGYGKNGALSVLQKSIRPQVVTTFELPGC-HDMWTVIYCEEKPEKPSAEGDGESPEEEKREPTIEDDKKKHGFLILSREDSTMILQTGQEIMELDTSGFATQGPTVYAGNIGDNKYIIQVSPMGIRLLEGVNQLHFIPVDLGSPIVHCSVADPYVVIMTAEGVVTMFVLKNDS 674          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Zebrafish
Match: cpsf1 (cleavage and polyadenylation specific factor 1 [Source:ZFIN;Acc:ZDB-GENE-040709-2])

HSP 1 Score: 53.1434 bits (126), Expect = 1.381e-6
Identity = 43/178 (24.16%), Postives = 78/178 (43.82%), Query Frame = 2
Query: 1322 QLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTV----------------------KRTA----DELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDA-LVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNS 1774
            ++ V  G G   +L +L   +   V+   +LPG  + +WTV                      KR      D+    ++++S  ++T++L  G+ + E+  SGF    PT+    +GD+  ++QV P GIR +    ++H     L   IV C++    VVI      +  F + ++S
Sbjct:  109 EVVVCSGYGKNGALSVLQKSIRPQVVTTFELPG-CHDMWTVIYCEEKPEKPSAEGDGESPEEEKREPTIEDDKKKHGFLILSREDSTMILQTGQEIMELDTSGFATQGPTVYAGNIGDNKYIIQVSPMGIRLLEGVNQLHFIPVDLGSPIVHCSVADPYVVIMTAEGVVTMFVLKNDS 285          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Xenopus
Match: sf3b3 (splicing factor 3b subunit 3 [Source:NCBI gene;Acc:100101755])

HSP 1 Score: 1727.61 bits (4473), Expect = 0.000e+0
Identity = 813/1220 (66.64%), Postives = 1002/1220 (82.13%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ++T I  A+HG+FSGTK+QEIVV++GK++ELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRI+ILEY P KN+F K+ QET+GKSGCRRIVPGQ++A+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D DDEPEFSSAMPLEEGDTF+F PR LKNLV +DE +SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KK IVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PE+LCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +F+   D+ Y++VG   D IL+P S   G + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L IYD+GKKKLLRK  NK+    IV IQ    R++++D+Q+S  WV+Y +R ENQL+IFADDT  RWV   C+LD DT A ADKFGNI +VRLP +  DDV+EDP+G+KALW+RG L GASQK EV+ +++VGE V S+QK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  + GRDHL +RSYYFP KNVIDGDLCE F+++E  KQ+S++ EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNITLQRATGISFAIHGNFSGTKLQEIVVSRGKIIELLRPDANTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIIILEYHPSKNMFEKIHQETFGKSGCRRIVPGQFIAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDDEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQDSLSPIMSCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKIIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPEALCIVEMGGAERQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFTNTGDDWYVLVGVAKDLILNPRSVAAGLVYTYKLVNNGEKLEFVHKTPVEEVPAAIAPFQGRVLIGVGKLLRIYDLGKKKLLRKCENKHISNFIVGIQTIGQRVILSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTSCLLDYDTVAGADKFGNICIVRLPSNTNDDVDEDPTGNKALWDRGLLNGASQKAEVIVNYHVGETVLSVQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPICGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPVKQKSVAEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Xenopus
Match: sf3b3 (splicing factor 3b subunit 3 [Source:NCBI gene;Acc:100101755])

HSP 1 Score: 1697.56 bits (4395), Expect = 0.000e+0
Identity = 804/1220 (65.90%), Postives = 993/1220 (81.39%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ++T I  A+HG+FSGTK+QEIVV++GK++ELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRI+ILEY P KN+F K+ QET+GKSGCRRIVPGQ++A+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D DDEPEFSSAMPLEEGDTF+F PR LKNLV +DE +SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQV+     H     RV+ W+ P KK IVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PE+LCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +F+   D+ Y++VG   D IL+P S   G + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L IYD+GKKKLLRK  NK+    IV IQ    R++++D+Q+S  WV+Y +R ENQL+IFADDT  RWV   C+LD DT A ADKFGNI +VRLP +  DDV+EDP+G+KALW+RG L GASQK EV+ +++VGE V S+QK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  + GRDHL +RSYYFP KNVIDGDLCE F+++E  KQ+S++ EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNITLQRATGISFAIHGNFSGTKLQEIVVSRGKIIELLRPDANTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIIILEYHPSKNMFEKIHQETFGKSGCRRIVPGQFIAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDDEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQDSLSPIMSCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVHYSYAYH-----RVNEWKTPGKKIIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPEALCIVEMGGAERQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFTNTGDDWYVLVGVAKDLILNPRSVAAGLVYTYKLVNNGEKLEFVHKTPVEEVPAAIAPFQGRVLIGVGKLLRIYDLGKKKLLRKCENKHISNFIVGIQTIGQRVILSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTSCLLDYDTVAGADKFGNICIVRLPSNTNDDVDEDPTGNKALWDRGLLNGASQKAEVIVNYHVGETVLSVQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPICGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPVKQKSVAEELDRTPPEVSKKLEDIRTRYAF 1212          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Xenopus
Match: sf3b3 (splicing factor 3b subunit 3 [Source:NCBI gene;Acc:100101755])

HSP 1 Score: 1632.08 bits (4225), Expect = 0.000e+0
Identity = 771/1144 (67.40%), Postives = 941/1144 (82.26%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFF 3481
            M LYN+TLQ++T I  A+HG+FSGTK+QEIVV++GK++ELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRI+ILEY P KN+F K+ QET+GKSGCRRIVPGQ++A+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D DDEPEFSSAMPLEEGDTF+F PR LKNLV +DE +SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KK IVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PE+LCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +F+   D+ Y++VG   D IL+P S   G + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L IYD+GKKKLLRK  NK+    IV IQ    R++++D+Q+S  WV+Y +R ENQL+IFADDT  RWV   C+LD DT A ADKFGNI +VRLP +  DDV+EDP+G+KALW+RG L GASQK EV+ +++VGE V S+QK TL P G ESLVYTT++GGIGILVPF S++   +F
Sbjct:    1 MFLYNITLQRATGISFAIHGNFSGTKLQEIVVSRGKIIELLRPDANTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIIILEYHPSKNMFEKIHQETFGKSGCRRIVPGQFIAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDDEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQDSLSPIMSCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKIIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPEALCIVEMGGAERQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFTNTGDDWYVLVGVAKDLILNPRSVAAGLVYTYKLVNNGEKLEFVHKTPVEEVPAAIAPFQGRVLIGVGKLLRIYDLGKKKLLRKCENKHISNFIVGIQTIGQRVILSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTSCLLDYDTVAGADKFGNICIVRLPSNTNDDVDEDPTGNKALWDRGLLNGASQKAEVIVNYHVGETVLSVQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEVTVYF 1141          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Xenopus
Match: sf3b3 (splicing factor 3b subunit 3 [Source:NCBI gene;Acc:100101755])

HSP 1 Score: 1441.79 bits (3731), Expect = 0.000e+0
Identity = 695/1091 (63.70%), Postives = 855/1091 (78.37%), Query Frame = 2
Query:  443 IMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            + TGAIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D DDEPEFSSAMPLEEGDTF+F PR LKNLV +DE +SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQV+     H     RV+ W+ P KK IVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PE+LCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +F+   D+ Y++VG   D IL+P S   G + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L IYD+GKKKLLRK  NK+    IV IQ    R++++D+Q+S  WV+Y +R ENQL+IFADDT  RWV   C+LD DT A ADKFGNI +                                  EV+ +++VGE V S+QK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  + GRDHL +RSYYFP KNVIDGDLCE F+++E  KQ+S++ EL + P +++K LE IR ++AF
Sbjct:   51 LFTGAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDDEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQDSLSPIMSCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVHYSYAYH-----RVNEWKTPGKKIIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPEALCIVEMGGAERQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFTNTGDDWYVLVGVAKDLILNPRSVAAGLVYTYKLVNNGEKLEFVHKTPVEEVPAAIAPFQGRVLIGVGKLLRIYDLGKKKLLRKCENKHISNFIVGIQTIGQRVILSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTSCLLDYDTVAGADKFGNICI---------------------------------AEVIVNYHVGETVLSVQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPICGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPVKQKSVAEELDRTPPEVSKKLEDIRTRYAF 1100          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Xenopus
Match: sf3b3 (splicing factor 3b subunit 3 [Source:NCBI gene;Acc:100101755])

HSP 1 Score: 1412.13 bits (3654), Expect = 0.000e+0
Identity = 670/986 (67.95%), Postives = 813/986 (82.45%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNK 3007
            M LYN+TLQ++T I  A+HG+FSGTK+QEIVV++GK++ELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRI+ILEY P KN+F K+ QET+GKSGCRRIVPGQ++A+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D DDEPEFSSAMPLEEGDTF+F PR LKNLV +DE +SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQV+     H     RV+ W+ P KK IVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PE+LCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +F+   D+ Y++VG   D IL+P S   G + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L IYD+GKKKLLRK  NK
Sbjct:    1 MFLYNITLQRATGISFAIHGNFSGTKLQEIVVSRGKIIELLRPDANTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIIILEYHPSKNMFEKIHQETFGKSGCRRIVPGQFIAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDDEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQDSLSPIMSCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVHYSYAYH-----RVNEWKTPGKKIIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPEALCIVEMGGAERQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFTNTGDDWYVLVGVAKDLILNPRSVAAGLVYTYKLVNNGEKLEFVHKTPVEEVPAAIAPFQGRVLIGVGKLLRIYDLGKKKLLRKCENK 979          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Mouse
Match: Sf3b3 (splicing factor 3b, subunit 3 [Source:MGI Symbol;Acc:MGI:1289341])

HSP 1 Score: 1727.99 bits (4474), Expect = 0.000e+0
Identity = 819/1220 (67.13%), Postives = 1003/1220 (82.21%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE++SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LGDDALVQVYPDGIRHIR D+RV+ W+ P KKTIVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LE+ASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +FS   ++ Y++VG   D ILSP S  GG + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L +YD+GKKKLLRK  NK+    I  IQ    R++V+D+Q+S  WV+Y +R ENQL+IFADDT  RWV    +LD DT A ADKFGNI VVRLP +  D+V+EDP+G+KALW+RG L GASQK EV+ +++VGE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  L GRDHL +RSYYFP KNVIDGDLCE F+++E +KQ+++S EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILSPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Mouse
Match: Ddb1 (damage specific DNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1202384])

HSP 1 Score: 201.83 bits (512), Expect = 3.688e-52
Identity = 284/1212 (23.43%), Postives = 490/1212 (40.43%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGK---NIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDV--GFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEM-----VREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHI--RPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGL-SDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASI----IKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYF-----PCKNVIDGDLCEIFSTLEISKQR 3631
            Y +T QK T++   V GHF+  +   +++AK   LE+     T+  ++ +    ++G I  +  F   G  KD L + +      ILEY       +I  +       + G R    G    +DP  R I     +    V  L+RD++        L+A       LH+I V    G + PT   +   Y D      G  V+    +L   E + G         E +E  A+ +I+VP   E   G II  +  ITY N      I  PI ++             VC           + L   E G +F + LE + +M     ++++R++      +A  +  L  G +FV +  G+  L ++    D +++  +  AM     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG    +W ++       D  +V+SF+  T VL + GE VEE    GF+    T  C  +    L+Q+    +R +   P   V  W+ P  K I   + N  QVV+A+ G  L Y ++     +L +     E   ++ C+ +  +      S   A+GL +D + R+  L PS  L    M G  + P S+ +    +S             YL   L +G L    ++   G LSD +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + Y    +S+  P+ +     ++L I  ++++  +  + + PL  +PR+             E         S+ E +          P+   Q L+  ++++ L           A   T F   +    + +I     E +   +  QNE A+S+V  K    P+  Y IVGT    ++ P        R      +   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E        L+   HLG   + V V CH  +  V+ +L +A+    G  S+++ T+NG IG LV   S  +Y     +++ +     S+   +H  +RS++      P    IDGDL E F  L+IS+ +
Sbjct:    5 YVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYV--VTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIG-RPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKE-------LKAFNIRLEELHVIDVKFLYGCQAPTICFV---YQDPQ----GRHVKTYEVSLREKEFNKG-----PWKQENVEAEASMVIAVP---EPFGGAIIIGQESITYHNGDKYLAIAPPIIKQST----------IVCH-NRVDPNGSRYLLGDME-GRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLN--VDSNEQGSYVVAM-----ETF----------------TNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG-IKGLWPLRSDPGRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQGKNISVASCNSSQVVVAV-GRALYYLQIHPQ--ELRQIS-HTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKL-PSFELLHKEMLGGEIIPRSILMTTFESSH------------YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIR-TVPLYESPRKICYQ---------EVSQCFGVLSSRIEVQDSSGGTTALRPSASTQALSSSVSSSKLFSSS------TAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPN-TYFIVGT---AMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLF---HLG---EFVNVFCHGSL--VMQNLGEASTPTQG--SVLFGTVNGMIG-LVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESF--LDISRPK 1104          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Mouse
Match: Ddb1 (damage specific DNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1202384])

HSP 1 Score: 78.9518 bits (193), Expect = 1.527e-14
Identity = 83/323 (25.70%), Postives = 142/323 (43.96%), Query Frame = 2
Query: 2678 EFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYF-----PCKNVIDGDLCEIFSTLEISKQR 3631
            E +   +  QNE A+S+V  K    P+  Y IVGT    ++ P        R      +   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E        L+   HLG   + V V CH  +  V+ +L +A+    G  S+++ T+NG IG LV   S  +Y     +++ +     S+   +H  +RS++      P    IDGDL E F  L+IS+ +
Sbjct:  111 EVLHAHQFLQNEYALSLVSCKLGKDPN-TYFIVGT---AMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLF---HLG---EFVNVFCHGSL--VMQNLGEASTPTQG--SVLFGTVNGMIG-LVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESF--LDISRPK 415          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Mouse
Match: Ddb1 (damage specific DNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1202384])

HSP 1 Score: 72.4034 bits (176), Expect = 1.530e-12
Identity = 108/465 (23.23%), Postives = 184/465 (39.57%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGK---NIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDV--GFENPTFAVIEVDYSDADADTTGGAVEDIR-KNLTYYELDLGLNHVVRK--YSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEM-----VREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPG 1420
            Y +T QK T++   V GHF+  +   +++AK   LE+     T+  ++ +    ++G I  +  F   G  KD L + +      ILEY       +I  +       + G R    G    +DP  R I     +    V  L+RD++        L+A       LH+I V    G + PT   +   Y     D      +D + +++  YE+ L      +     E +E  A+ +I+VP   E   G II  +  ITY N      I  PI ++             VC           + L   E G +F + LE + +M     ++++R++      +A  +  L  G +FV +  G+  L ++    D +++  +  AM     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG
Sbjct:    5 YVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYV--VTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIG-RPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKE-------LKAFNIRLEELHVIDVKFLYGCQAPTICFV---YQPLKGDFGSPKTDDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVP---EPFGGAIIIGQESITYHNGDKYLAIAPPIIKQST----------IVCH-NRVDPNGSRYLLGDME-GRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLN--VDSNEQGSYVVAM-----ETF----------------TNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG 418          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Mouse
Match: Cpsf1 (cleavage and polyadenylation specific factor 1 [Source:MGI Symbol;Acc:MGI:2679722])

HSP 1 Score: 71.2478 bits (173), Expect = 9.620e-12
Identity = 80/334 (23.95%), Postives = 135/334 (40.42%), Query Frame = 2
Query:  980 GDIFKITLETDCEMVREMRLKYFDTVPVA---TSMCVLKTGFLFVATEFGNHYLYQITN------------LADGDDEPEFSS------------AMPLEEGDTFYFAPRTLKNLVQI--------DEMNSLAPIIGCHIADLA-------NEDTPQLA-VLC-GRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTV------------------------KRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDA-LVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNS 1774
            G+I+ +TL TD   +R +R  +FD    +   TSM  ++ G+LF+ +  GN  L + T              AD ++ P                 +P +E D         ++  Q+        D M ++ P     + + A       N   P L  V+C G G   +L +L   +   V+   +LPG  + +WTV                        K   D     ++++S  ++T++L  G+ + E+  SGF    PT+    +GD+  +VQV P GIR +    ++H     L   IV+CA+    VVI      +  F + S+S
Sbjct:  342 GEIYVLTLITDG--MRSVRAFHFDKAAASVLTTSMVTMEPGYLFLGSRLGNSLLLKYTEKLQEPPASSVREAADKEEPPSKKKRVEPAVGWTGGKTVPQDEVDEIEVYGSEAQSGTQLATYSFEVCDSMLNIGPCANAAVGEPAFLSEEFQNSPEPDLEIVVCSGYGKNGALSVLQKSIRPQVVTTFELPGCYD-MWTVIAPVRKEEEETPKAESTEQEPSAPKAEEDGRRHGFLILSREDSTMILQTGQEIMELDTSGFATQGPTVFAGNIGDNRYIVQVSPLGIRLLEGVNQLHFIPVDLGAPIVQCAVADPYVVIMSAEGHVTMFLLKSDS 672          
BLAST of Splicing factor 3B subunit 3 vs. UniProt/SwissProt
Match: sp|Q1LVE8|SF3B3_DANRE (Splicing factor 3B subunit 3 OS=Danio rerio OX=7955 GN=sf3b3 PE=2 SV=1)

HSP 1 Score: 1729.92 bits (4479), Expect = 0.000e+0
Identity = 813/1220 (66.64%), Postives = 1003/1220 (82.21%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG++R++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M GA EKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFK+TLETD EMV E+R+KYFDT+PVAT+MCVLKTGFLFV++EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE  SL+PI+ C IADLANEDTPQL V CGRGPRS+LR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KKTI++CA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G  ++ ++  +KG  G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP++ N I+IETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG+G WAS++++I P+ G  +  ++L QNEAA S+ + +F    D+ Y++VG   D IL+P S  GG I +Y+I   G+ LE  H T V+D P A+  FQGR+LVG+   L IYD+GKKKLLRK  NK+ P  +  I     R++V+D+Q+S+FWV+Y RR ENQL+IFADDT  RW+   C+LD DT A+ADKFGNI VVRLP + +DDV+EDP+G+KALW+RG L GASQK E++ ++++GE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ LE H+R+E   L GRDHL +RSYYFP KNVIDGDLCE F++++  KQ+S+S EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNITLQRATGISHAIHGNFSGTKQQEIVVSRGKILELLRPDANTGKVHTLLTMEVFGVVRSLMAFRLTGGTKDYVVVGSDSGRIVILEYHPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMIGATEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEALEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKVTLETDEEMVTEIRMKYFDTIPVATAMCVLKTGFLFVSSEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQESLSPIMSCQIADLANEDTPQLYVACGRGPRSTLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHVEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKTIIRCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGVEKQDELGEKGTIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPETNNLILIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPEAIFGAPKAGSGQWASLVRLINPIQGNTLDLVQLEQNEAAFSVAICRFLNGGDDWYVLVGVARDMILNPRSVGGGYIYTYRIVGGGDKLEFLHKTPVEDVPLAIAPFQGRVLVGVGKLLRIYDLGKKKLLRKCENKHVPNLVTGIHTIGQRVIVSDVQESLFWVRY-RRNENQLIIFADDTYPRWITTACLLDYDTMASADKFGNICVVRLPPNTSDDVDEDPTGNKALWDRGLLNGASQKAEIIINYHIGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHLEMHMRSEFPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMDPHKQKSVSEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. UniProt/SwissProt
Match: sp|Q921M3|SF3B3_MOUSE (Splicing factor 3B subunit 3 OS=Mus musculus OX=10090 GN=Sf3b3 PE=1 SV=1)

HSP 1 Score: 1727.99 bits (4474), Expect = 0.000e+0
Identity = 819/1220 (67.13%), Postives = 1003/1220 (82.21%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE++SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LGDDALVQVYPDGIRHIR D+RV+ W+ P KKTIVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LE+ASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +FS   ++ Y++VG   D ILSP S  GG + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L +YD+GKKKLLRK  NK+    I  IQ    R++V+D+Q+S  WV+Y +R ENQL+IFADDT  RWV    +LD DT A ADKFGNI VVRLP +  D+V+EDP+G+KALW+RG L GASQK EV+ +++VGE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  L GRDHL +RSYYFP KNVIDGDLCE F+++E +KQ+++S EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILSPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. UniProt/SwissProt
Match: sp|Q15393|SF3B3_HUMAN (Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4)

HSP 1 Score: 1726.84 bits (4471), Expect = 0.000e+0
Identity = 818/1220 (67.05%), Postives = 1003/1220 (82.21%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE++SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LGDDALVQVYPDGIRHIR D+RV+ W+ P KKTIVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LE+ASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +FS   ++ Y++VG   D IL+P S  GG + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L +YD+GKKKLLRK  NK+    I  IQ    R++V+D+Q+S  WV+Y +R ENQL+IFADDT  RWV    +LD DT A ADKFGNI VVRLP +  D+V+EDP+G+KALW+RG L GASQK EV+ +++VGE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  L GRDHL +RSYYFP KNVIDGDLCE F+++E +KQ+++S EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. UniProt/SwissProt
Match: sp|A0JN52|SF3B3_BOVIN (Splicing factor 3B subunit 3 OS=Bos taurus OX=9913 GN=SF3B3 PE=2 SV=1)

HSP 1 Score: 1726.84 bits (4471), Expect = 0.000e+0
Identity = 818/1220 (67.05%), Postives = 1003/1220 (82.21%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE++SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LGDDALVQVYPDGIRHIR D+RV+ W+ P KKTIVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LE+ASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +FS   ++ Y++VG   D IL+P S  GG + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L +YD+GKKKLLRK  NK+    I  IQ    R++V+D+Q+S  WV+Y +R ENQL+IFADDT  RWV    +LD DT A ADKFGNI VVRLP +  D+V+EDP+G+KALW+RG L GASQK EV+ +++VGE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  L GRDHL +RSYYFP KNVIDGDLCE F+++E +KQ+++S EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. UniProt/SwissProt
Match: sp|Q5RBI5|SF3B3_PONAB (Splicing factor 3B subunit 3 OS=Pongo abelii OX=9601 GN=SF3B3 PE=2 SV=1)

HSP 1 Score: 1719.13 bits (4451), Expect = 0.000e+0
Identity = 816/1220 (66.89%), Postives = 1001/1220 (82.05%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ++T I  A+HG+FSGTK QEIVV++GK+LELLRPD  +GK+ TLL+ EVFG+IR++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+M  AIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFKITLETD +MV E+RLKYFDTVPVA +MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE++SL+PI+ C IADLANEDTPQL V CGRGPRSSLR+L HGLEVS  A S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LGDDALVQVYPDGIRHIR D+RV+ W+ P KKTIVKCA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G +++ ++  ++G+ G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LE+ASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP+S N IIIETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG+G WAS+I+V+ P+ G  +  ++L QNEAA S+ + +FS   ++ Y++VG   D IL+P S  GG + +YK+   GE LE  H T V++ P A+  FQGR+L+G+   L +YD+GKKKLLRK  NK+    I  IQ    R++V+D+Q+S  WV+Y +R ENQL+IFADDT  RWV    +LD DT A ADKFGNI VVRLP +  D+V+EDP+G+KAL +RG L GASQK EV+ +++VGE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ +E H+R+E+  L GRDHL +RSYYFP KNVIDGDLCE F+++E +KQ+++S EL + P ++ K LE IR ++AF
Sbjct:    1 MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSETAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGSGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRY-KRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALRDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVTKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. TrEMBL
Match: A0A074Z1M4 (CPSF A subunit region OS=Opisthorchis viverrini OX=6198 GN=T265_11823 PE=4 SV=1)

HSP 1 Score: 1775.76 bits (4598), Expect = 0.000e+0
Identity = 845/1228 (68.81%), Postives = 1005/1228 (81.84%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGI-KDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGN-------TGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPAD---EEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ+++ I  AVHG+FSGTK QEI VA+GK++ELLRPD  SGK+ TLL+ E FGIIR+   F LTG  KDYL+V SDSGR+V+LEY+P KN F K+QQET+GKSGCRRIVPGQYLA++P GRA M GA+EKQK+VY++NRDS+  LTISSPLEAH+SNTL  HM+GVDVGFENP FA IE+DY DAD D+TG A     + LTYYELDLGLNHVVRKYSE LEE+ANFLI+VPGG EGPSGI+IC+ENYITYKNFGDQPDIRCPIP+RRN+L+DP+RG+LFVCSA+H TK  LFFFLAQTEQGDIFKI LE D +MV E++LKYFDT+PVA++MCVLKTGFLFVA+EFGNH LYQI +L D DDEPEFSSAMPLEEGDTFYFAPR LKNL+++D + +L+PI+  HIAD ANEDTPQLAVLCGRGP S+ RLL HGLEVS MAKSDLPG+PNAVWTVKR ++E YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+QLGDDALVQVYP+GIRHIR D+RV+VWRAP KK IV+CA+NRRQVVIALTG ELVYFEMD  +GQLNE+  RKE PAD+ICMALG +P  EQRSRFLAVGL+D TVR+  LDPS+CL+ LTMQGLP  PESLCI E+G  + S     N       TG LYLNIGL NG LLR ++DP+ GELSDTRTRYLG++PVKLFRIM+QG EAVL++S+R WLSY YQNRFHL P+SYEALEYASGFSSEQCPEGIVAI  NSLRI+ALEKLG +FNQ S+PL YTPRR V HP S  A IIETDHNAYT + KE RK+Q++ KM  + A    EE +LAKE AAAFL+E LPE++FGA KAG G WAS+++ + PL+G     I  PQNEAA ++ + +F  RP E +++V  V    LSP S +GG +R+Y++   G+ LE  H T VDD P A+C+FQGRLLVG+  RL IYDMG+KKLL+K  NK+ P  I  I A  SRI+V D+Q+S FW++Y  R ENQLVIFADD   RW+ H+ VLD  T A +DKFGN+ ++RLP  V DD+EEDPSG++ALW+RG LGGASQK EVLCHFYVGEVVT+LQ+ATL P G E +VY T++GG+G+LVPF S D Y+FFQ LE H+R+E +SLVGR+H+HYRS ++PC+NVIDGDLCEIF++L+ +KQRSI+ E+ K PSDIAK LE IR +FAF
Sbjct:    1 MYLYNITLQRASGITHAVHGNFSGTKQQEIAVARGKIIELLRPDPNSGKVYTLLTCEAFGIIRSFMPFRLTGSSKDYLIVGSDSGRVVVLEYVPSKNAFEKLQQETFGKSGCRRIVPGQYLAVNPKGRAFMIGAVEKQKLVYIMNRDSQARLTISSPLEAHKSNTLVYHMVGVDVGFENPLFACIEMDYEDADQDSTGEAARGANQLLTYYELDLGLNHVVRKYSEPLEEHANFLIAVPGGNEGPSGILICSENYITYKNFGDQPDIRCPIPQRRNNLDDPDRGILFVCSASHKTKN-LFFFLAQTEQGDIFKINLEVDDDMVTEIKLKYFDTLPVASAMCVLKTGFLFVASEFGNHSLYQIAHLGDDDDEPEFSSAMPLEEGDTFYFAPRALKNLIEVDVLENLSPIMHYHIADFANEDTPQLAVLCGRGPGSTFRLLRHGLEVSEMAKSDLPGNPNAVWTVKRNSEEEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLTCSQLGDDALVQVYPEGIRHIRADKRVNVWRAPGKKMIVRCAVNRRQVVIALTGGELVYFEMDM-TGQLNEYTERKEMPADVICMALGRIPTSEQRSRFLAVGLADNTVRILSLDPSDCLAPLTMQGLPSTPESLCIVEMGVGEPSGPTDENENETLPATGILYLNIGLINGVLLRVILDPVTGELSDTRTRYLGTRPVKLFRIMMQGGEAVLSVSSRSWLSYAYQNRFHLIPLSYEALEYASGFSSEQCPEGIVAICNNSLRIMALEKLGAVFNQTSYPLQYTPRRMVFHPDSNIAYIIETDHNAYTDEVKELRKRQMSEKMIASAAGGAPEEIQLAKESAAAFLEENLPENVFGAPKAGPGMWASLLRCLNPLDGTTSHLIRFPQNEAAHALSLVRFLNRPGELFLVVALVKGLNLSPRSCSGGCLRTYRVWNNGDHLEFIHETLVDDFPAAVCAFQGRLLVGVGKRLRIYDMGRKKLLKKCENKHIPNLITGIYAIGSRIIVTDVQESAFWLRYRPRSENQLVIFADDANPRWITHLAVLDPSTVAISDKFGNVIILRLPNGVIDDIEEDPSGNRALWDRGFLGGASQKAEVLCHFYVGEVVTTLQRATLIPGGSEGIVYATLSGGLGMLVPFSSRDAYDFFQHLELHMRSEGMSLVGREHVHYRSQHYPCRNVIDGDLCEIFNSLDPAKQRSIAEEMDKVPSDIAKRLEDIRTRFAF 1226          
BLAST of Splicing factor 3B subunit 3 vs. TrEMBL
Match: A0A4S2LKN7 (CPSF_A domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006508 PE=4 SV=1)

HSP 1 Score: 1774.22 bits (4594), Expect = 0.000e+0
Identity = 846/1228 (68.89%), Postives = 1006/1228 (81.92%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGI-KDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGA------SDQSEQQK-GNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPA---DEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ+++ I  AVHG+FSGTK QEI VA+GK++ELLRPD  SGK+ TLL+ E FGIIR+   F LTG  KDYL+V SDSGR+V+LEYIP KN F K+QQET+GKSGCRRIVPGQYLA++P GRA M GA+EKQK+VY++NRDS+  LTISSPLEAH+SNTL  HM+GVDVGFENP FA IE+DY DAD D+TG A     + LTYYELDLGLNHVVRKYSE LEE+ANFLI+VPGG EGPSGI+IC+ENYITYKNFGDQPDIRCPIP+RRN+L+DP+RG+LFVCSA+H TK  LFFFLAQTEQGDIFKI LE D +MV E++LKYFDT+PVA++MCVLKTGFLFVA+EFGNH LYQI +L D DDEPEFSSAMPLEEGDTFYFAPR LKNL+++D + +L+PI+  HIAD ANEDTPQLAVLCGRGP S+ RLL HGLEVS MAKSDLPG+PNAVWTVKR ++E YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+QLGDDALVQVYPDGIRHIR D+RV+VWRAP KK IV+CA+NRRQVVIALTG ELVYFEMD  +GQLNE+  RKE PAD+ICMALG +P  EQRSRFLAVGL+D TVR+  LDPS+CL+ LTMQGLP  PESLCI E+G       +D+ E +    TG LYLNIGL NG LLR ++DP+ GELSDTRTRYLG++PVKLFRIM+QG EAVL++S+R WLSY YQNRFHL P+SYEALEYASGFSSEQCPEGIVAI  NSLRI+ALEKLG +FNQ S+PL YTPR+ V HP S  A IIETDHNAYT + KE RK+Q++ KM  + +    EE  LAKE AAAFL+E LPE+IFGA KAG G WAS+++ + PL+G     I  PQNEAA ++ + +F  RP E +++V  V    LSP S +GG +R+Y++   G+ LE  H T VDD P A+C+FQGRLLVG+  RL IYDMG+KKLL+K  NK+ P  I  I A  SRI+V D+Q+S FW++Y  R ENQLVIFADD   RW+ H+ VLD  T A +DKFGN+ ++RLP  V DD+EEDPSG++ALW+RG LGGASQK EVLCHFYVGEVVT+LQ+ATL P G E +VY T++GG+G+LVPF S D Y+FFQ LE H+R+E +SLVGR+H+HYRS ++PC+NVIDGDLCEIF++L+ +KQRSI+ E+ K PSDIAK LE IR +FAF
Sbjct:    1 MYLYNITLQRASGITHAVHGNFSGTKQQEIAVARGKIIELLRPDPNSGKVYTLLTCEAFGIIRSFMPFRLTGSSKDYLIVGSDSGRVVVLEYIPSKNAFEKLQQETFGKSGCRRIVPGQYLAVNPKGRAFMIGAVEKQKLVYIMNRDSQARLTISSPLEAHKSNTLVYHMVGVDVGFENPLFACIEMDYEDADQDSTGEAARGANQLLTYYELDLGLNHVVRKYSEPLEEHANFLIAVPGGNEGPSGILICSENYITYKNFGDQPDIRCPIPQRRNNLDDPDRGILFVCSASHKTKN-LFFFLAQTEQGDIFKINLEVDDDMVTEIKLKYFDTLPVASAMCVLKTGFLFVASEFGNHSLYQIAHLGDDDDEPEFSSAMPLEEGDTFYFAPRALKNLIEVDVLENLSPIMHYHIADFANEDTPQLAVLCGRGPGSTFRLLRHGLEVSEMAKSDLPGNPNAVWTVKRNSEEEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLTCSQLGDDALVQVYPDGIRHIRADKRVNVWRAPGKKMIVRCAVNRRQVVIALTGGELVYFEMDM-TGQLNEYTERKEMPADVICMALGRIPTSEQRSRFLAVGLADNTVRILSLDPSDCLAPLTMQGLPSTPESLCIVEMGVGEPSGPTDEDENETLPATGILYLNIGLINGVLLRVILDPVTGELSDTRTRYLGTRPVKLFRIMMQGGEAVLSVSSRSWLSYAYQNRFHLIPLSYEALEYASGFSSEQCPEGIVAICNNSLRIMALEKLGAVFNQTSYPLQYTPRKMVFHPDSNIAYIIETDHNAYTDEVKELRKRQMSEKMIASASGGPSEEIHLAKESAAAFLEENLPENIFGAPKAGPGMWASLLRCLNPLDGTTSHLIRFPQNEAAHALSLVRFLNRPGELFLVVALVKGLNLSPRSCSGGCLRTYRVWNNGDHLEFIHETLVDDFPAAVCAFQGRLLVGVGKRLRIYDMGRKKLLKKCENKHIPNLITGIYAIGSRIIVTDVQESAFWLRYRPRSENQLVIFADDANPRWITHLAVLDPSTVAISDKFGNVIILRLPNGVIDDIEEDPSGNRALWDRGFLGGASQKAEVLCHFYVGEVVTTLQRATLIPGGSEGIVYATLSGGLGMLVPFSSRDAYDFFQHLELHMRSEGMSLVGREHVHYRSQHYPCRNVIDGDLCEIFNSLDPAKQRSIAEEMDKVPSDIAKRLEDIRTRFAF 1226          
BLAST of Splicing factor 3B subunit 3 vs. TrEMBL
Match: A0A0L8HYX4 (CPSF_A domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001692mg PE=4 SV=1)

HSP 1 Score: 1761.12 bits (4560), Expect = 0.000e+0
Identity = 828/1220 (67.87%), Postives = 1020/1220 (83.61%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQK--GNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ++T I +AVHG+FSGTK QE++V++GK+LELLRPD  +GK+ T+L+ E+FG+IRA+  F LTG  KDY++V SDSGRIVILEY+P KN F K+ QET+GKSGCRRIVPGQ+LA+DP GRA+MTGA+EKQK+VY+LNRD++  LTISSPLEAH+S+TL  HM+GVDVGFENPTFA +E+DY +AD D TG A     + LTYYELDLGLNHVVRKYSE+LEE+AN LI+VPGG +GPSG +IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSA+H TK  +FFFLAQTEQGDIFKITLE D +MV E+RLKYFDTVPVATSMCVLKTGFLFVA+EFGNH+LYQI +L D DDEPEFSSAMPLEEGDTF+F+PR LKNLV +DEM+SL+PI+ C IADLANEDTPQL  LCGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTVK+  ++ YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+QLGDDALVQ+YPDGIRHIR D+RV+ W+ P KKTIVKCA+N+RQVVIALTG ELVYFEMD  +GQLNE+  +KE  AD++CM LG VP+ EQRSRFLAVGL+D TVR+  LDPS+CLS L+MQ LP  PE+LCI E+G ++  E+ +  G+ G L+LNIGLQNG LLR ++D + G+LSDTRTRYLGS+PVKLFRI +QGSEAVLA+S+R WLSYTYQNRFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ+S PL YTPR+F++H  S N IIIETDHNAYT  +K++RKQQ+A +M EA  ++E++LA +MA AFL+E+LPE+ FGAAKAGTG WAS++++I P++GE + K+ L QNEAA S+ + +FS   D+ +++VGT  + +L+P S +GG I  YK+  +GE LE  H T VD+ P A+ +FQGR L+G    L IYD+GKKKLLRK  NK  P  I++I     RIVV+D+Q+SI +V+Y +RPENQL++FADDTT RWV   C+LD DT ATADKFGNI V+RLP DV D+VEEDP+G+KALW+RG L GASQK +V+ +F+VGEVVTSLQKATL P G ESLVYTT++G IG+LVPF S++ ++FFQ LE ++R+E+  L GRDHL +RSYYFP KNVIDGDLCE+F+++++ KQ+ +  +L + PS+++K LE  R ++AF
Sbjct:    1 MFLYNLTLQRATGITQAVHGNFSGTKQQEVIVSRGKILELLRPDPNTGKVYTILTVEIFGVIRALLPFRLTGGTKDYIIVGSDSGRIVILEYLPSKNAFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMTGAVEKQKLVYILNRDAQARLTISSPLEAHKSSTLVYHMVGVDVGFENPTFACLEIDYEEADYDPTGEAALQTHQMLTYYELDLGLNHVVRKYSEQLEEHANSLIAVPGGSDGPSGCLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSASHKTKS-MFFFLAQTEQGDIFKITLEIDEDMVTEIRLKYFDTVPVATSMCVLKTGFLFVASEFGNHFLYQIAHLGDDDDEPEFSSAMPLEEGDTFFFSPRLLKNLVMVDEMDSLSPIMSCQIADLANEDTPQLYTLCGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVKKNIEDEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSQLGDDALVQIYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDP-TGQLNEYTEKKEMSADVVCMGLGRVPSGEQRSRFLAVGLADNTVRIISLDPSDCLSPLSMQALPAPPEALCIVEMGNAETIEETREGGSQGGLFLNIGLQNGVLLRTVLDTVTGDLSDTRTRYLGSRPVKLFRITMQGSEAVLAMSSRSWLSYTYQNRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVSWPLQYTPRKFIIHQDSNNLIIIETDHNAYTESTKQQRKQQMAEEMIEAAQEDERQLAAKMADAFLEEDLPENTFGAAKAGTGMWASVVRIINPISGETLDKVSLDQNEAAHSIALVRFSCASDDMHVLVGTAKELVLNPRSLSGGFIYCYKLLNSGEKLEFVHKTVVDELPGAIAAFQGRALIGTGRYLRIYDLGKKKLLRKCENKRIPNFIMSILTLGHRIVVSDIQESINFVRY-KRPENQLIVFADDTTPRWVTSSCLLDYDTVATADKFGNITVIRLPPDVCDEVEEDPTGNKALWDRGLLNGASQKADVIANFHVGEVVTSLQKATLIPGGSESLVYTTLSGSIGMLVPFTSHEDHDFFQHLEMYMRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEMFNSMDVGKQKGVCDDLDRTPSEVSKKLEDTRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. TrEMBL
Match: A0A4E0QVA0 (Splicing factor 3B subunit OS=Fasciola hepatica OX=6192 GN=D915_010122 PE=4 SV=1)

HSP 1 Score: 1757.65 bits (4551), Expect = 0.000e+0
Identity = 840/1228 (68.40%), Postives = 1000/1228 (81.43%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGI-KDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNT-------GTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKM---QEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ+++ I  AVHG+FSGTK QEI VA+GK++ELLRPD  SGK+ TLL+ E FGIIR+   F LTG  KDYL+V SDSGR+VILEYIP KNIF KVQQET+GKSGCRRIVPGQYLA++P GRA M GA+EKQK+VY++NRDS+  LTISSPLEAH+SNTL  HM+GVDVGF+NP FA IE+DY DAD D TG A     + LTYYELDLGLNHVVRKYSE LEE+ANFLI+VPGG EGPSGI+IC+ENYITYKNFGDQPDIRCPIP+RRNDL+DP+RG+LFVCSA+H TK         TEQGDIFKI LE D +MV E++LKYFDTVPVA++MCVLKTGFLFVA+EFGNH LYQI +L D DDEPEFSSAMPLEEGDTFYFAPR LKNL+++D ++SL+PI+  HIAD ANEDTPQLAVLCGRG  S+ RLL HGLEVS MAKSDLPG+PNAVWTVKR ++E YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+QLGDDALVQVYPDGIRHIR D+RV+VWRAP KKTIV+CA+NRRQVVIALTG ELVYFEMD  +GQLNE+  RKE PAD+ICMALG +PA EQRSRFLAVGL+D TVR+  LDPS+CL+ LTMQGLP  PESLCI E+G  + S     N        G LYLNIGL NG LLR ++DP+ GELSDTRTRYLG++PVKLFRIM+QG EAVL++S+R WLSY YQNRFHL P+SY+ALEYASGFSSEQCPEGIVAI  NSLRI+ALEKLG +FNQ ++PL YTPR+ V HP+S  A IIETDHN+YT + K  RK+Q++ +M       + EE  +A+E AAAFL E LPE IFGA KAG G WAS+++ + PL+G  +  I  PQNEAA ++ + +F+ RP E +++V  V   +LSP S  GG +R+Y++   G+ LE  H T VDD P A+C+FQGRLLVG+ NRL IYD+G+KKLL+K  NK+ P  I  I +  SRIVV D+Q+S+ WV+Y  R ++QLVIFADDT  RWV H+ VLD  T A +DKFGN++V+RLP  V DDVE+DPSG++ALW+RG LGGASQKVEVLCHFYVGEVV+SLQKATL P G E +VY T++G +G+LVPF S D Y+FFQ LE H+R+E +SLVGR+H+HYRS ++PC+NVIDGDLCEIF++L+ SKQRSI+ E+ K PSDIAK LE IR +FAF
Sbjct:    1 MYLYNITLQRASGITHAVHGNFSGTKQQEIAVARGKIIELLRPDPNSGKVYTLLTCEAFGIIRSFMPFRLTGSSKDYLIVGSDSGRVVILEYIPSKNIFEKVQQETFGKSGCRRIVPGQYLAVNPKGRAFMIGAVEKQKLVYIMNRDSQARLTISSPLEAHKSNTLVYHMVGVDVGFDNPLFACIEMDYEDADQDPTGEAARGANQLLTYYELDLGLNHVVRKYSEPLEEHANFLIAVPGGNEGPSGILICSENYITYKNFGDQPDIRCPIPQRRNDLDDPDRGILFVCSASHKTK---------TEQGDIFKINLEVDDDMVTEIKLKYFDTVPVASAMCVLKTGFLFVASEFGNHCLYQIAHLGDDDDEPEFSSAMPLEEGDTFYFAPRPLKNLIEVDVLDSLSPIMNFHIADFANEDTPQLAVLCGRGAGSTFRLLRHGLEVSEMAKSDLPGNPNAVWTVKRNSEEEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLTCSQLGDDALVQVYPDGIRHIRADKRVNVWRAPGKKTIVRCAVNRRQVVIALTGGELVYFEMDM-TGQLNEYTERKEMPADVICMALGRIPANEQRSRFLAVGLADNTVRILSLDPSDCLAPLTMQGLPSTPESLCIVEMGVGELSSGTDANDNEVAHAGGILYLNIGLVNGVLLRVILDPVTGELSDTRTRYLGTRPVKLFRIMMQGGEAVLSVSSRSWLSYAYQNRFHLIPLSYDALEYASGFSSEQCPEGIVAICDNSLRIMALEKLGAVFNQTNYPLQYTPRKMVFHPESNLAYIIETDHNSYTDEVKLSRKRQMSERMIASASGGSPEEIAMARESAAAFLDENLPEAIFGAPKAGPGMWASLLRCLNPLDGTTLNVIRFPQNEAAHALALVRFANRPLELFLVVALVKSLVLSPRSCAGGCLRTYRVWNNGDRLEFIHETPVDDFPAAVCAFQGRLLVGVGNRLRIYDLGRKKLLKKCENKHLPTLINGIYSIGSRIVVTDVQESLHWVRYRPRSDSQLVIFADDTNPRWVTHLVVLDPSTVAISDKFGNVSVLRLPSGVVDDVEDDPSGNRALWDRGLLGGASQKVEVLCHFYVGEVVSSLQKATLIPGGSEGIVYATLSGAVGMLVPFSSRDAYDFFQHLELHMRSEGLSLVGREHVHYRSQHYPCRNVIDGDLCEIFNSLDPSKQRSIAEEMDKIPSDIAKRLEDIRTRFAF 1218          
BLAST of Splicing factor 3B subunit 3 vs. TrEMBL
Match: A0A0X3P2R4 (Splicing factor 3B subunit 3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=SF3B3 PE=4 SV=1)

HSP 1 Score: 1757.27 bits (4550), Expect = 0.000e+0
Identity = 831/1222 (68.00%), Postives = 1004/1222 (82.16%), Query Frame = 2
Query:   53 IIMKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTG-TLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADE-EQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            + M LYNL+LQ++T I  AVHG FSG+K QEI +++GK+LEL+R D +SGK+ TL++TEVFGIIR++  F LTG  KDY+V+ SDSGRIVILEYI  KN+F +VQQET+GKSGCRRIVPGQYLA+DP GRAIM GA+EKQK+VYV+NRDS+  LTISSPLEAH+SNTL  HM+GVDVGF+NPTFA IE+DY +AD D TG A     + LTYYELDLGLNHVVRKYSE LEE+ANFLI+VPGG E  SG++IC+ENYITYKNFGD+PDIRCPIP+RRNDL+DP+RG+LFVCSATH TK  LFFFLAQTEQGDIFKI LE D E + E+++KYFDTVPVAT+MCVLKTGFLF A+EFGNHYLYQI +L D DDEPEFSSAMPLEEGDTFYFAPR LKNL+++D +  L+PI   HIADLANEDTPQLAV+CGRGPRS+ RLL HGLEV+ MAKSDLPG PNAVWTVKR ++E YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+QLGDDALVQVYP+GIRHIR DRR++VWR P KK I KCA+N RQVVIALTG ELVYFEMD  +GQLNE+  RKE PAD+ICMALG + A EQRSRFLAVGL+D TVR+  LDPS+CLS LTMQGLP + ESLCIAE+GAS+   ++   TG  LYLNIGL NG LLR ++DP+ GELSDTRTRYLG+ PVKLFRI +QG EAVLA+S+R WLSYTYQ+RFHL P+SYEALEYASGFSSEQCPEG+VAI +NSLRILALEKLG +FNQ S  L YTPR+FV HP+S NA IIETDHNAYT   K ER++++A ++  +  +E E+E AKE AA+ +   L E IFGA KAG G WAS+++ + PL GE +Q     QNEAA ++ +A F  RPDE YI+V    D +L+P S + G +++Y++S TG+ +E  H T VDD P A+C+F+GRLL  + +RL +YDMGKKKLL+K  NK+FP  I  I +  +R++V D+Q+ +FWV+Y  R +NQLVIFADD + RW+ H+ VLD  T A +DKFGNI ++RLP +  D++EEDPSG+++LW+R  LGG+SQK+EVL HFYVGEVV+ LQKATL P G E LVY+T++GG+GILVPF S D Y+FFQ LE H+RAE++SLVGRDHLHYRS Y+PCKNVIDGDLCE+FS+L++SKQRSI+ E+ K P+DIAK LE +R + AF
Sbjct:   27 LFMYLYNLSLQRATGITHAVHGSFSGSKQQEIAISRGKILELMRVDPSSGKLYTLITTEVFGIIRSMMPFRLTGGNKDYIVIGSDSGRIVILEYIASKNVFERVQQETFGKSGCRRIVPGQYLAVDPKGRAIMIGAVEKQKLVYVMNRDSQARLTISSPLEAHKSNTLVYHMVGVDVGFDNPTFACIEMDYEEADQDPTGEAARSAHQLLTYYELDLGLNHVVRKYSEPLEEHANFLITVPGGSEVHSGLLICSENYITYKNFGDEPDIRCPIPQRRNDLDDPDRGLLFVCSATHRTKN-LFFFLAQTEQGDIFKINLEKDKETITEIKVKYFDTVPVATAMCVLKTGFLFTASEFGNHYLYQIAHLGDNDDEPEFSSAMPLEEGDTFYFAPRGLKNLIEVDVLEGLSPITSLHIADLANEDTPQLAVVCGRGPRSTFRLLRHGLEVTEMAKSDLPGSPNAVWTVKRNSEEEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLTCSQLGDDALVQVYPEGIRHIRADRRINVWRTPGKKAIQKCAVNSRQVVIALTGGELVYFEMDV-TGQLNEYTERKEMPADVICMALGRINANEQRSRFLAVGLADNTVRILSLDPSDCLSPLTMQGLPTSAESLCIAEMGASETDGEKTVQTGGILYLNIGLNNGVLLRVVLDPVTGELSDTRTRYLGTSPVKLFRIAMQGGEAVLAVSSRSWLSYTYQSRFHLIPLSYEALEYASGFSSEQCPEGVVAICENSLRILALEKLGAVFNQTSATLQYTPRKFVFHPESNNAFIIETDHNAYTDDLKTERRKEMAERILASATNEYEREQAKEAAASLMNSNLSEAIFGAPKAGPGMWASLLRCLNPLTGETLQICRFAQNEAAHAIALATFFNRPDEYYIVVALAKDLVLNPRSCSAGLLKTYRVSPTGDQMEFVHDTLVDDFPTALCAFKGRLLAAVGHRLRLYDMGKKKLLKKCENKHFPNLINGIYSVGNRVIVTDVQEGVFWVRYRPRSDNQLVIFADDASPRWIIHLAVLDQCTVAVSDKFGNIVLLRLPANANDEIEEDPSGNRSLWDRTALGGSSQKLEVLAHFYVGEVVSCLQKATLIPGGSEGLVYSTLSGGLGILVPFTSRDAYDFFQHLELHLRAESLSLVGRDHLHYRSLYYPCKNVIDGDLCEMFSSLDMSKQRSIATEMDKVPNDIAKRLEDMRTRCAF 1246          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Cavefish
Match: sf3b3 (splicing factor 3b subunit 3 [Source:NCBI gene;Acc:103034462])

HSP 1 Score: 1738.78 bits (4502), Expect = 0.000e+0
Identity = 817/1220 (66.97%), Postives = 1006/1220 (82.46%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ++T I  A+HG+FSGTK+QEIVV++GK+LELLRPD  +GK+ TLL+ EVFGI+R++ AF LTG  KDY+VV SDSGRIVILEY P KN+F KV QET+GKSGCRRIVPGQ+LA+DP GRA+M GAIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFK+TLETD EMV E+R+KYFDT+PVAT+MCVLKTGFLFVA+EFGNHYLYQI +L D DDEPEFSSAMPLEEGDTF+F PR LKNLV +DE  +L+PI+ C IADLANEDTPQL V CGRGPRS+LR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KKTIV+CA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G  ++ ++  +KG  G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+ P++ N I+IETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG+G WAS+++++ P+ G  +  ++L QNEAA S+ + +F+   D+ Y++VG   D IL+P S  GG I +Y++   GE LE  H T V+D P A+  FQGR+LVG+   L IYD+GKKKLLRK  NK+ P  +  I     R++V+D+Q+S+FWV+Y +R ENQL+IFADDT  RWV   C+LD DT ATADKFGNI++VRLP + +DDV+EDP+G+KALW+RG L GASQK EV+ ++++GE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ LE H+R+E   L GRDHL +RSYYFP KNVIDGDLCE F++++  KQ+S++ EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNLTLQRATGITHAIHGNFSGTKLQEIVVSRGKILELLRPDANTGKVHTLLTMEVFGIVRSLMAFRLTGGTKDYIVVGSDSGRIVILEYHPSKNMFEKVHQETFGKSGCRRIVPGQFLAVDPKGRAVMIGAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEALEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKVTLETDEEMVTEIRMKYFDTIPVATAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDDEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQENLSPIMSCQIADLANEDTPQLYVACGRGPRSTLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHVEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVRCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGVEKQDELGEKGTIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIQPETNNLILIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPEAIFGAPKAGSGQWASLVRLVNPIQGNTLDLVQLEQNEAAFSVAVCRFANGGDDWYVLVGVARDMILNPRSVGGGYIYTYRLVGGGEKLEFMHKTPVEDVPLAIAPFQGRVLVGVGKLLRIYDLGKKKLLRKCENKHVPNLVTGIHTIGQRVIVSDIQESLFWVRY-KRSENQLIIFADDTHPRWVTSACLLDYDTMATADKFGNISIVRLPPNTSDDVDEDPTGNKALWDRGLLNGASQKAEVIMNYHIGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHLEMHMRSEFPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMDPHKQKSVAEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Cavefish
Match: cpsf1 (cleavage and polyadenylation specific factor 1 [Source:ZFIN;Acc:ZDB-GENE-040709-2])

HSP 1 Score: 63.929 bits (154), Expect = 1.063e-9
Identity = 87/391 (22.25%), Postives = 162/391 (41.43%), Query Frame = 2
Query:  794 GIIICAENYITYKN-----FG----DQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVA---TSMCVLKTGFLFVATEFGNHYLYQITNLADG---DDEP--------------EFSSAMPLEEGDTFYFAPRTLKNLVQI-----DEMNSLAPIIGCHIADLA---------NEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTV---------KRTADELYD-----------AYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDA-LVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNS 1774
            G+++ A N + Y N     FG     Q +     P R   +++  R  L    A   +  K+   L   + G+I+ +TL TD   +R +R  +FD    +   T M  ++ G++F+ +  GN  L + T        ++EP              + S A  L+E + +    ++   L        D + ++ P +   + + A          E   ++ V  G G   +L +L   +   V+   +LPG  + +WTV           TA+E               ++++S  ++T++L  G+ + E+  SGF    PT+    +G++  ++QV P GIR +    +VH     L   IV+C++    VVI      +  F + S++
Sbjct:  225 GVVVFAVNSLLYLNQSVPPFGVSLNSQTNGTTAFPLR---VQEGVRLSLDCSQAAFISSDKMVISL---KGGEIYVLTLITDG--MRSVRAFHFDKAAASVLTTCMVTMEPGYMFLGSRLGNSLLLKYTEKLQETPMEEEPPNKKKRVDSNWTAGKVSLADELDEIEVYGSEAQSGTQLATYSFEVCDSILNIGPCVNASMGEPAFLSEEFQSNPEPDLEVVVCSGYGKNGALSVLQRSIRPQVVTTFELPG-CHDMWTVISSEEKAEKSETAEEEKQELTVEDEKNKHGFLILSREDSTMILQTGQEIMELDTSGFATQGPTVYAGNIGENKYIIQVSPMGIRLLEGVTQVHFIPVDLGSPIVQCSVADPYVVIMTAEGVVTMFVLKSDT 606          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Cavefish
Match: ddb1 (damage-specific DNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1272])

HSP 1 Score: 60.4622 bits (145), Expect = 3.607e-9
Identity = 66/251 (26.29%), Postives = 115/251 (45.82%), Query Frame = 2
Query: 2906 AMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERG--HLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCK-----NVIDGDLCEIFSTLEISKQRSI 3637
            +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E      + L E G  HLG   + V V CH  +  V+ +L +++    G  S+++ T+NG IG LV   S  +Y     L++ +  + +  VG+    +RS+    K       IDGDL E F  L  +K + +
Sbjct:   38 SMVEFNGKLLASINSTVRLYEWTAEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEER-----QHLQEVGVFHLG---EFVNVFCHGSL--VLQNLGESSTPTQG--SVLFGTVNGMIG-LVTSLSEGWYSLLMDLQNRLN-KVIKSVGKIDT-WRSFNTERKTEQATGFIDGDLIESFLDLGRAKMQEV 272          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Sea Lamprey
Match: sf3b3 (splicing factor 3b, subunit 3 [Source:NCBI gene;Acc:406824])

HSP 1 Score: 1723.75 bits (4463), Expect = 0.000e+0
Identity = 811/1220 (66.48%), Postives = 1001/1220 (82.05%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYNLTLQ+++ I  A+HG+FSGTK QEIV++ GK+LELLRPD  +GK+ TLL+ E+FG+IR++ AF LTG  KDY+VV +DSGRIVILEY P KN F KV QET+GKSGCRRIVPGQ+LA+DP GRA+M GAIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D +G A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVC+ATH TK  +FFFL QTEQGDIFK+TLETD +MV E+R+KYFDTVPVAT+MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F  R LKNLV +DE++SL+PI+ C IADLANEDTPQ+ V CGRGPRSSLR+L HGLEVS MA S+LPG+PNAVWTV++  +E YDAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KK IVKCA+N+RQVVIAL+G ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP+ EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PE+LCI E+G +++ ++  +KG+ G LYLNIGLQNG LLR ++D + G+LSDTRTRYLGS+PVKLFR+++QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYAS F+SEQCPEGIVAI  N+LRILALEKLG +FNQ+S PL YTPR+FV+HP S N IIIETDHNAYT  +K +RKQQ+A +M EA  +EE+ELA EMAAAFL E LPE  FGA KAG+G WAS+++ + P+ G  ++ ++L QNEAA S+ + KFS   D+ Y++VG   D IL+P S  GG I +YK+ + GE  +  H T V+D P A+  FQGR+L+G+   L +YD+GKKKLLRK  NK+    IV I     R++V+D+Q+S FWV+Y +R ENQL+IFADDT  RW+     LD DT A ADKFGNIAVVRLP ++ DDV+EDP+G+KALW+RG L GASQK E++ +++VGE   SLQKATL P G ESLVYTT++GG+GILVPF S++ ++FFQ LE H+RAE+  L GRDHL YRSYYFP KNVIDGDLCE F++++ +KQRS++ EL + P++++K LE IR ++AF
Sbjct:    1 MFLYNLTLQRASGITHAIHGNFSGTKQQEIVISHGKILELLRPDPNTGKVHTLLTVEIFGVIRSLMAFRLTGGTKDYVVVGTDSGRIVILEYQPSKNAFDKVHQETFGKSGCRRIVPGQFLAVDPKGRAVMIGAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADVDPSGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLIPVPGGADGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCAATHKTKS-MFFFLVQTEQGDIFKVTLETDEDMVTEIRMKYFDTVPVATAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQVRLLKNLVLVDELDSLSPIMACQIADLANEDTPQMYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRKHIEEEYDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKAIVKCAVNQRQVVIALSGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPSGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPEALCIVEMGGAEKQDESGEKGSLGGLYLNIGLQNGVLLRTVLDTVTGDLSDTRTRYLGSRPVKLFRVLMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASCFASEQCPEGIVAISTNTLRILALEKLGAVFNQVSTPLQYTPRKFVIHPDSNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEEERELAAEMAAAFLNENLPETTFGAPKAGSGQWASVVRALNPIQGNTLELVQLEQNEAAFSVAVLKFSNGGDDWYVLVGVAKDLILAPRSVAGGFIYTYKLVEDGEKFQFVHKTPVEDVPAAIAPFQGRVLIGVGKLLRLYDLGKKKLLRKCENKHVANFIVGIHTVGQRVIVSDIQESFFWVRY-KRNENQLIIFADDTMPRWITTAWQLDYDTMAAADKFGNIAVVRLPPNINDDVDEDPTGNKALWDRGILNGASQKAEIIMNYHVGETCLSLQKATLIPGGSESLVYTTLSGGVGILVPFTSHEDHDFFQHLEMHMRAEHPPLCGRDHLSYRSYYFPVKNVIDGDLCEQFNSMDPAKQRSVAEELDRTPAEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Sea Lamprey
Match: ddb1 (damage-specific DNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1272])

HSP 1 Score: 167.933 bits (424), Expect = 2.124e-42
Identity = 257/1136 (22.62%), Postives = 452/1136 (39.79%), Query Frame = 2
Query:  116 GHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIP-GKNIFVKVQ-----QETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGF----ENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEM-----VREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHV--WRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGL-SDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKA------GTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERG--HLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIG 3439
            GHF+  +   +++AK   LE+     T   ++ +    ++G I  +  F   G  KD L + +      ILEY   G N+ +  +     Q+  G+     I+      +DP  R I     +    V  L+RD++     +  LE          ++ +DV F      PT   +  D       T   ++ D   N   ++ D             ++  A  +I+VP   +   G +I  +  ITY N GDQ     P   +++ +         VC           + L   E G +F + LE D  M     VR++R++      +A  +  L  G +++ +  G+  L ++    D +++  + + M     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG    +W ++       D  +V+SF+  T VL + GE VEE    GF     T  C  + ++ L+Q+    +R +    +  V  W+ P  K I   + N  QVV A+ G  L Y  +D ++GQL +     E   ++ C+ +  +      S   AVGL +D + R+  L   + L +  M G  + P S+ +                G  YL   L +G L    +    G LSD +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + Y    +S+  P+ +     ++L I  ++++  +  + + PL  +P+R      S    I+          S+ E   Q        P+   Q L+  ++ + L        F +  A      G       + VI     E +   +   +E A+S+V  +    P   Y +VGT    ++ P        R      T   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ I VLD+D    A+   N+ V +     T D E      + L E G  HLG   + V V CH  +  V+ +L +++    G  S+++ T+NG IG
Sbjct:    1 GHFTSAEDLNLLIAKNTRLEIYV--VTPEGLRAVKEVGMYGKISVMELFRPQGEKKDLLFILTAKYNACILEYKQDGDNVDIITRAHGNVQDRIGRPSETGIIG----IVDPESRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE---------ELMVIDVKFLFGCAVPTICFVYQDPQGRHVKTYEVSLRDKEFNKGPWKQD------------NVDAEAGIVIAVP---QPMGGALIIGQEAITYHN-GDQYLPIAPPAIKQSTI---------VCQ-NRVDANGSRYLLGDME-GRLFMLLLERDELMDGTATVRDLRVEMLGETSIAECLTYLDNGVVYIGSRLGDSQLVKLN--VDSNEQGSYVTTM-----ETF----------------TNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG-IKGLWPLRSDPTRDLDDMLVLSFVGQTRVLMLNGEEVEETELPGFCDEQQTFYCGNVANEQLIQITCGSVRLVDHKSKALVSEWKEPSGKNISVASCNAAQVVCAV-GRMLFY--LDISAGQLKQVSS-TEMEHEVACLDISPLGDGAGNSTLCAVGLWTDISARILRLPSFDTLHK-EMLGGEIIPRSILMTTF------------EGAHYLLCALGDGALFYFNLSVDSGYLSDKKKVTLGTQPTVLRTFKSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSQGYPDSLALANNSTLTIGTIDEIQKLHIR-TVPLNESPKRICYQESSQCFGIL---------SSRVELLDQNGGTSLVRPSASTQALSNSVSNSKL--------FSSNSAQHESSYGEETEVHSLLVIDQHTFEVLHAHQFLPSEYALSIVSCRLGKDP-TTYFVVGTA---MVYPEEAEPKQGRIAIFHYTDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSMLLLAY-KPMEGSFEEIARDFNPNWMSAIEVLDDDNFLGAENSYNLFVCQKDSAATSDEER-----QHLQEVGQLHLG---EFVNVFCHGSL--VMQNLGESSTPTQG--SVLFGTVNGMIG 1018          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Yeast
Match: RSE1 (Protein involved in pre-mRNA splicing; component of the pre-spliceosome; associates with U2 snRNA; involved in ER to Golgi transport [Source:SGD;Acc:S000004513])

HSP 1 Score: 233.802 bits (595), Expect = 6.862e-63
Identity = 211/850 (24.82%), Postives = 390/850 (45.88%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHF----SGTKVQE--IVVAKGKVLELLRPDTTSGKIQTLLSTE-VFGIIRAIFAFHL---------TGIKDYLVVASDSGRIVILEYI--PGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKE--------------------GPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVRE--MRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEE-GDTFYFAPR-TLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTV---KRTADELYDAYIVVSFINATLVLSI-GETVEEV-----TDSGF-LGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVH-----VWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKE---APADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLL--DPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKL----------------------------FRIMVQGSE---AVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGF-SSEQCPEGIVAI 2326
            + LY+LTL+K T+ + +  GHF    +G+K ++  + VA    LEL   DT  G+++ +   + +F  I ++ +  L         +    +L + SDSG + I++ I   G      +  +   ++  RR+ P  Y+ +DPNGR I+  ++E+ K+ +++  D    L ISSPLE  R + +TL M  VDV F NP F  +E+D           A   +  +L +Y L+LGLNH+V+K    +  +ANF++S+P                         P  ++I  EN+I  K+      ++  IP+R   + +     + + S      K  FF L Q+  GD+FK+T+  D        ++L YFDT+  +  + + K G+LF  +E  N++L+Q   L  G ++ +FS+ +  ++   +  F P   L+NL  + +  +L P I   I      D+P L++       + +  L++ +  S +  + LP +   +W +     T D   +  + ++F   T++L I  E++EE+     T S F L    T+    +G  +++QV    +RHI P  +        W  P    IV    ++ Q++I+L+  ELVYF++D +S  L E     E    P+ +      ++  + Q +  LA+  ++  +++  L     + L+ +++Q          +     SD    +  + G L L++GL+NG  ++  I  + G  +D + R+LG +PV L                              I   G++    V+  S+  W+SYT++N + +  +  + +   S F +++    G+ +I
Sbjct:   58 LYLYHLTLKKQTNFVHSCIGHFVDLEAGSKREQSQLCVATETHLELY--DTADGELKLIAKFQNLFATITSMKSLDLPHSGSRAKASNWPTFLALTSDSGNLSIVQIIMHAGALRLKTLVNQPLTRTTLRRVSPISYMEIDPNGRCIILSSVEQNKLCFLV--DYAQKLRISSPLEIIRPHMVTLDMAVVDVNFNNPCFVTLEID----------NAATQLSVHLIFYVLELGLNHIVKKADYLVNPSANFVLSLPDLSRYNITTSLSDNNYDADYDTLFNP-FVVIGFENHILVKDMNGFFSLKVEIPKR--SITNSRHKNVTIISGIVQKLKNDFFVLLQSNHGDLFKLTVSPDTNDRNRPLVQLSYFDTIQNSHQLHIFKNGYLFALSEMNNNFLFQFEKL--GVEKNDFSNVLTSKDPNKSLVFEPSIKLQNLSILSQQLNLNPSIKSQIV----SDSP-LSIATKHFTNNKIITLTNAVNYSNLISTSLPPNATKLWLIPDPATTGDN--NTLLFITFPKKTMILQIDNESMEELTPDEATRSAFKLSQDTTIHTCLMGSHSIIQVCTAELRHIVPTGKSRYSNKLTWVPPAGIRIVCATSSKTQLIISLSNYELVYFKIDVSSDSLIELTTHPELDTMPSKV------AIVQDTQHADLLAIADNEGMIKIMSLKDQKEDFLTVISLQ----------LVSEKISDMIMVRDSSIGQLNLHVGLENGVYMKFHIGDVDGSFTDIKRRFLGLKPVSLSYLREISVSLNNEEEEEEEEDDDDEKEEEEINSSGAKWMSCVVCHSSSTWVSYTWKNVWTIRQLKDQNMLSCSKFVNADVAINGVCSI 865          

HSP 2 Score: 102.064 bits (253), Expect = 3.750e-22
Identity = 89/344 (25.87%), Postives = 150/344 (43.60%), Query Frame = 2
Query: 2864 LELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTI----QAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDV-EEDPS--GSKALWERGHLGGASQKV----------EVLCHFYVGEVVTSLQKA-TLNPSGLESLVYTTINGGIGILVPFQS--NDFY-------------EFFQTLESHIRAENV------------------------------SLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGK-EPSDIAKNLEKIRAKF 3703
            +EL H T +     AM  F+  LL  + + +++Y +GKK+LLR++V +  P  I  I    Q +  R+ V D+ +S+    +     N  + + DD+  R V  +  LD  T   AD++GN   +R P +    +   DPS   + A+     +    QK+          ++L HF+V +++T      +L+ S     +Y  + G +G  +P  S  N F               F+   ES  +  N+                              S++GRDH  YRSYY P + VIDGDLCE F  L +++Q  ++  L   +  DI + + ++R  +
Sbjct: 1019 IELLHQTEIISPIHAMLKFKNFLLTAMGSTIVLYGLGKKQLLRRSVTQT-PVSITKIVSMHQWNYERLAVGDIHESVTLFIWD-PAGNVFIPYVDDSVKRHVTVLKFLDEATVIGADRYGNAWTLRSPPECEKIMSNHDPSELSNGAIKYPLDVITLQQKLPNTYDCKFKFQLLNHFFVNDIITDFHILDSLSNSDRPGCIYMGLQGTVGCFIPLLSKGNVFMMGNIENIMAEADDTFYLDYESRKKNNNMRKEDDEEESGSVVLQGRHGIEDEIICEGSCSILGRDHQEYRSYYAPVRKVIDGDLCENFLRLSLNEQEFLAKNLKSVQVEDIIQTINEVRTNY 1360          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Nematostella
Match: EDO49217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHF3])

HSP 1 Score: 1537.7 bits (3980), Expect = 0.000e+0
Identity = 754/1221 (61.75%), Postives = 928/1221 (76.00%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKT---GEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LY LTLQ++++I   +HG+FSGTK QEIVV++GK +ELLR D  +GK+  +L+ E+FGI+R + AF LTG  KD++VV SDSGRIVILEYIP KN+F KV QET+GKSGCRRIVPGQYLA DP GRAIM GAIEKQK+VY++NRDS   LTISSPLEAH+S+TL  HM+GVD GFENP FA +E+DY +AD D TG A +  ++ LT+YELDLGLNHVVRKYSE LEE+ N LI+VPGG +GPSG+++C+ENY+TYKNFGDQPDIR PIPRR+ DL+DPERGMLF+CSATH TK  +FFFL QTEQGDIFKITLETD +MV E+R+KYFDTVP A SMCVLKTGFLF A+EFGNHYLYQI +L D DDE EFSS M LEEG TF+F PR LKNLV +DE+ SLAPI+ C IADLANEDTPQL   CGRG RSSLR+L HGLEVS MA S+LPG+PNAVWTVK T  + +DAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTL C+QLG++ALVQ+YPDGIRHIR D+RV+ W+AP KKTIVK A+N RQVVIALTG E+VYFEMDS SGQLNE+  RKE  AD+ CMALG++   E RSRFLA+GLSD TVR+  LDP +CL+ L+MQ LP  PESLCI E+G  + +E + G+ G L+LNIGL    L    ++P  GE                          VLA+S+R WLSYT+Q+R HLTP+SYE LEYASGFSSEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+H  +   ++IETDHN YT  ++EERKQQ+A +M E  ++EE+ELA + AA FL EEL E  FG+ KAGTG WAS+I+V+ P+ GE    ++L QNEAA S+ +  FS RPD+ ++IVGT  D  LSP S + G + +Y++ +    G  LE  H T VDD P A+  FQGRLL G+   L +YD+GKKK+LRK  NK  P  I  I +  +RIVV+D+Q+S  +VKY  R +NQLV+FADD   RW+   C LD DT A ADKFGNI  VRLP   +DDV+EDP+G+KA W+RG L GA QK+E +C+++VGE V SLQKATL P G ESLV+TT++GG+G+LVPF S +  +FFQ LE H+R+E  SL                +V+DGDLCE +++L+ SK+R+I+ EL + P++++K LE IR ++AF
Sbjct:    1 MHLYALTLQRASAINNTIHGNFSGTKQQEIVVSRGKFVELLRTDPNTGKVFPVLAIEMFGIVRDLIAFRLTGGSKDFIVVGSDSGRIVILEYIPSKNVFEKVHQETFGKSGCRRIVPGQYLAADPKGRAIMIGAIEKQKLVYIMNRDSAARLTISSPLEAHKSHTLVYHMVGVDAGFENPMFACLEMDYEEADTDHTGEAAQTTQQTLTFYELDLGLNHVVRKYSEPLEEHGNLLIAVPGGSDGPSGVLVCSENYLTYKNFGDQPDIRMPIPRRKYDLDDPERGMLFICSATHKTKS-MFFFLVQTEQGDIFKITLETDEDMVTEIRMKYFDTVPPAVSMCVLKTGFLFTASEFGNHYLYQIAHLGDDDDELEFSSTMELEEGTTFFFQPRGLKNLVLVDELESLAPIMNCQIADLANEDTPQLFAACGRGSRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVKHTTADEFDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLSCSQLGEEALVQIYPDGIRHIRADKRVNEWKAPGKKTIVKSAVNERQVVIALTGGEVVYFEMDS-SGQLNEYTERKEMSADVQCMALGTILHGELRSRFLAIGLSDNTVRIISLDPQDCLTPLSMQALPAMPESLCIVEMGGKEGAESEGGSMGGLFLNIGLSEICL---TLEP--GE--------------------------VLAMSSRSWLSYTHQSRVHLTPLSYETLEYASGFSSEQCPEGIVAIAGNTLRILALEKLGAVFNQVATPLKYTPRKFVIHSPTNTLVVIETDHNTYTDAAREERKQQMAEEMVEMASEEEKELAAQAAAEFLSEELSEQQFGSPKAGTGMWASVIRVLDPIKGETHDVVQLDQNEAAFSVCVCSFSARPDDTFVIVGTAKDMALSPRSCSTGYLYAYRLVQQPSGGIKLEFQHKTEVDDVPAALEPFQGRLLAGIGRLLRVYDIGKKKMLRKCENKKLPNFICNINSMGTRIVVSDIQESFHFVKYKPR-DNQLVVFADDVNPRWLTCCCYLDYDTLAGADKFGNIFTVRLPSGSSDDVDEDPTGTKAFWDRGLLNGAQQKLETMCNYFVGETVLSLQKATLIPGGSESLVFTTLSGGVGMLVPFTSREDIDFFQHLEMHLRSEQPSL----------------SVVDGDLCEHYNSLDYSKRRTIAEELDRTPAEVSKKLEDIRTRYAF 1171          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Nematostella
Match: EDO42742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0J1])

HSP 1 Score: 166.392 bits (420), Expect = 1.161e-41
Identity = 278/1237 (22.47%), Postives = 486/1237 (39.29%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLE--LLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEY-IPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDV--GFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETD-----CEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDE-MNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVK-RTADELYDAYIVVSFINATL---------VLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRR--VHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGL-SDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATL---NPSGLES-----LVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFP-CKNV------------IDGDLCEIFSTLEISKQRSI 3637
            Y +T QK T++  AV G+F+G     +V+AK   LE  L+ P+     ++ +L   ++G +  +  F      +D L + +   R+ IL Y     +I  +   +   + G R    GQ   +DP+ R I     +    V  L  DS+  L      +A       LH++ +    G  NPT   I   Y D      G  V+    NL  +E   G         + +E  A  +I+VP       G +I  +  ITY    +   I  P  ++ +            C     T    +  L     G ++ + LE          V++++L+      +A  +  L  G +F+ +  G+  L +++   D D                         + VQ+ E   +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DL G    +W +K R   + YD  +V+SF+  +          VLS+ GE VEE    GF     T     +    L+QV    +R +  + R  V  W+ P  K I   + N  QVV A+ G+EL Y E+    G+L +   +     ++ C+ +      + R+  +AVGL +D +VRV  L   N L  + M G  + P S+             +    G  YL   L +G L    +DP  G L++ +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + +    +S+  P+ +      SL I  ++++  +  + + PL  +PRR      +    +I        R    E      + +  + +     ++  +              G          S++ +I     E     +L  NE A S++    S  P   Y  VGT       P     G +  + +S+ G+ +++A    V  +  ++  F G++L G+++ + I++    K  R   +       + ++     I+V D+  S+  + Y    E      A D + +W+  I +LD+DT   A+   N+      KD         SG+    ER HL  A Q       +++GE V   +  +L   +P    +     +++ T+NG IGI+    + D + F   ++  +     S+   DH     Y FP C N+            IDGDL E F  L  ++   +
Sbjct:    5 YVVTAQKPTAVNAAVVGNFTGPDDLNLVIAKNTRLEIHLVTPE----GLRPMLDVGLYGSVGVMELFRPPNEPQDLLFILTAKYRVCILGYRKETGDIVTRACGDVQDRIG-RPSDTGQIGIIDPSCRVIGLRLYDGLFKVIPLELDSDKEL------KAFNIRLEELHVVDIQFLYGCANPTIVFI---YQDPH----GRHVKTYEINLRDHEFAKG-----PWKQDNVEVEACRVIAVPNPL---GGALIIGQESITYHKGSNYHAIAPPALKQSS----------LTCHGKIDTNGSRY--LLGDMNGRLYMLLLERQELIDGTYEVKDLKLEMLGETSIAHCLVYLDNGVVFIGSMLGDSQLAKLSTEPDAD------------------------GSYVQVMETFTNLGPIVDMVVVDLERQGQGQLVTCSGAKKEGSLRIIRNGIGIHEHATIDLAG-IMGIWALKLRKTQQEYDDTLVLSFVGQSRRVLCTIHSRVLSLSGEEVEETEIPGFSDDQQTYYSGNVTGAQLIQVTAASVRLVNCETRQLVSEWKHPSAKNISVASCNTEQVVAAV-GSELYYIEI--MPGELRQIS-QVTLEYEVACLDITPTVEGKSRADMVAVGLWTDISVRVLQLPKLNQL-HVQMLGGEIIPRSIL------------KTAFEGIHYLLCALGDGTLFYFTMDPSTGALAECKKVTLGTQPTMLRTFKSLSTVNVFACSDRPTVIYSSNHKLVFSNVNLKEVNFMCPLNSQGYPDSLALANDGSLTIGTIDEIQKLHIR-TVPLGESPRRIAYQEATQTFGVIS------VRIEISEPGTSGTVPLHPSASTTAHNVSSSVGTGVSGSASSSAPDGITFGDEMEIGSLL-IIDQHTFEVTHAHQLHDNEQATSLMSCTLSDDP-HTYYCVGTAYVFPEEP-EPKAGRLLLFHLSE-GKLVQVAE-KEVKGAVYSLVEFNGKVLAGINSTVSIFEWTADKEFRYECSYYDNILALYLKTKGDFILVGDLMRSMTLLVY-LPLEGSFQEIAHDFSPKWMTAIEILDDDTFLGAENSYNLFTCT--KD---------SGATTDEERYHLQDAGQ-------YHLGEFVNVFRHGSLVMEHPGDASTPFQGCVLFGTVNGRIGIVAQI-AQDLFNFLIQVQKKLNKVIKSVGKIDH---SLYPFPHCSNLSHSRKMEPAHGFIDGDLIESFLDLPRARMEEV 1126          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Medaka
Match: sf3b3 (splicing factor 3b subunit 3 [Source:NCBI gene;Acc:101166716])

HSP 1 Score: 1735.31 bits (4493), Expect = 0.000e+0
Identity = 812/1220 (66.56%), Postives = 1007/1220 (82.54%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            M LYN+TLQ++T I  A+HG+FSGTK+QEIVV++GK+LELLRPD  +GK+ TLL+ EVFGI+R++ AF LTG  KDY+VV SDSGRIVILEY P KN+F K+ QET+GKSGCRRIVPGQYLA+DP GRA+M GAIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFK+TLETD EMV E+RLKYFDT+PVAT+MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE  +++PI+ C IADLANEDTPQL V CGRGP+S+LR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KKTIV+CA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G  ++ ++  +KG  G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP++ N ++IETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+++++ P+ G  + +++L QNEAA S+ + +F    D+ Y++VG   D IL+P S +GG I +Y+++  GE LE  H T V+D P A+  FQGR+L+G+   L IYD+GKKKLLRK  NK+ P  +  I     R++++D+Q+S+FWV+Y RR ENQL+IFADDT  RWV   C+LD DT A ADKFGNI++VRLP + +DDV+EDP+G+KALW+RG L GASQK EV+ +++VGE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ LE H+R+E   + GRDHL +RSYYFP KNVIDGDLCE F++++  KQ+S++ EL + P +++K LE IR ++AF
Sbjct:    1 MFLYNITLQRATGISHAIHGNFSGTKMQEIVVSRGKILELLRPDANTGKVHTLLTMEVFGIVRSLMAFRLTGGTKDYIVVGSDSGRIVILEYHPSKNMFEKIHQETFGKSGCRRIVPGQYLAVDPKGRAVMIGAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEALEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKVTLETDEEMVTEIRLKYFDTIPVATAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQENMSPIMSCQIADLANEDTPQLYVACGRGPKSTLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHVEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVRCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGVEKQDELGEKGTMGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPETNNLVLIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGAGQWASLVRLVNPIQGTTLDQVQLEQNEAAFSVAVCRFLNTGDDWYVLVGVARDMILNPRSVSGGFIYTYRLTGGGEKLEFVHKTPVEDVPLAIAPFQGRVLIGVGKLLRIYDLGKKKLLRKCENKHIPNIVTGIYTIGQRVIISDVQESLFWVRY-RRNENQLIIFADDTYPRWVTTACLLDYDTMAAADKFGNISIVRLPPNTSDDVDEDPTGNKALWDRGLLNGASQKAEVVVNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHLEMHMRSEFPPICGRDHLSFRSYYFPVKNVIDGDLCEQFNSMDTHKQKSVAEELDRTPPEVSKKLEDIRTRYAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Medaka
Match: sf3b3 (splicing factor 3b subunit 3 [Source:NCBI gene;Acc:101166716])

HSP 1 Score: 1531.92 bits (3965), Expect = 0.000e+0
Identity = 723/1123 (64.38%), Postives = 896/1123 (79.79%), Query Frame = 2
Query:  347 IFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQ--QKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            +F K+ QET+GKSGCRRIVPGQYLA+DP GRA+M GAIEKQK+VY+LNRD+   LTISSPLEAH++NTL  H++GVDVGFENP FA +E+DY +AD D TG A  + ++ LT+YELDLGLNHVVRKYSE LEE+ NFLI+VPGG +GPSG++IC+ENYITYKNFGDQPDIRCPIPRRRNDL+DPERGM+FVCSATH TK  +FFFLAQTEQGDIFK+TLETD EMV E+RLKYFDT+PVAT+MCVLKTGFLFVA+EFGNHYLYQI +L D D+EPEFSSAMPLEEGDTF+F PR LKNLV +DE  +++PI+ C IADLANEDTPQL V CGRGP+S+LR+L HGLEVS MA S+LPG+PNAVWTV+R  ++ +DAYI+VSF+NATLVLSIGETVEEVTDSGFLGTTPTL C+ LG+DALVQVYPDGIRHIR D+RV+ W+ P KKTIV+CA+N+RQVVIALTG ELVYFEMD  SGQLNE+  RKE  AD++CM+L +VP  EQRSRFLAVGL D TVR+  LDPS+CL  L+MQ LP  PESLCI E+G  ++ ++  +KG  G LYLNIGLQNG LLR ++DP+ G+LSDTRTRYLGS+PVKLFR+ +QG EAVLA+S+R WLSY+YQ+RFHLTP+SYE LEYASGF+SEQCPEGIVAI  N+LRILALEKLG +FNQ++ PL YTPR+FV+HP++ N ++IETDHNAYT  +K +RKQQ+A +M EA  ++E+ELA EMAAAFL E LPE IFGA KAG G WAS+++++ P+ G  + +++L QNEAA S+ + +F    D+ Y++VG   D IL+P S +GG I +Y+++  GE LE  H T V+D P A+  FQGR+L+G+   L IYD+GKKKLLRK  NK+ P  +  I     R++++D+Q+S+FWV+Y RR ENQL+IFADDT  RWV   C+LD DT A ADKFGNI++                                  EV+ +++VGE V SLQK TL P G ESLVYTT++GGIGILVPF S++ ++FFQ LE H+R+E   + GRDHL +RSYYFP KNVIDGDLCE F++++  KQ+S++ EL + P +++K LE IR ++AF
Sbjct:    1 MFEKIHQETFGKSGCRRIVPGQYLAVDPKGRAVMIGAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEALEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKS-MFFFLAQTEQGDIFKVTLETDEEMVTEIRLKYFDTIPVATAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDEQENMSPIMSCQIADLANEDTPQLYVACGRGPKSTLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHVEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGEDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVRCAVNQRQVVIALTGGELVYFEMDP-SGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGVEKQDELGEKGTMGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEYASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPETNNLVLIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGAGQWASLVRLVNPIQGTTLDQVQLEQNEAAFSVAVCRFLNTGDDWYVLVGVARDMILNPRSVSGGFIYTYRLTGGGEKLEFVHKTPVEDVPLAIAPFQGRVLIGVGKLLRIYDLGKKKLLRKCENKHIPNIVTGIYTIGQRVIISDVQESLFWVRY-RRNENQLIIFADDTYPRWVTTACLLDYDTMAAADKFGNISIA---------------------------------EVVVNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHLEMHMRSEFPPICGRDHLSFRSYYFPVKNVIDGDLCEQFNSMDTHKQKSVAEELDRTPPEVSKKLEDIRTRYAF 1087          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Medaka
Match: ddb1 (damage specific DNA binding protein 1 [Source:NCBI gene;Acc:101162350])

HSP 1 Score: 178.718 bits (452), Expect = 5.499e-45
Identity = 261/1145 (22.79%), Postives = 459/1145 (40.09%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKN---IFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEM-----VREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHV--WRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGL-SDQTVRVYLLDPSNCLSQL--TMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAA--FLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERG--HLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGIL 3445
            Y +T QK T++   + GHF+  +   +++AK   LE+     T+  ++ +    ++G I  +  F   G  KD L + +      ILEY    +   I  +       + G R    G    +DP  R  M G      +  V+  D EN    +  +       + +H +    G + PT   I   Y D      G  V+    +L   E + G         E +E  A+ +I VP   E   G II  +  ITY N GD+     P   +++ +         VC           + L   E G +F + LE +  M     ++++ ++      +A  +  L  G +FV +  G+  L ++    D +++  + + M     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG    +W ++  A    D  +V+SF+  T VL + GE VEE    GF+    T  C  +    L+Q+    +R +  D +  V  W+ P  + I   A N  QVV+A+ G  L Y ++   +G+L +     E   ++ C+ +  +      S   AVGL +D + R+  L    C + L   M G  + P S+ +                G+ YL   L +G L    +D   G LS+ +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + Y    +SE  P+ +     ++L I  ++++  +  + + PL  +PRR             E         S+ E +          P+   Q L+  ++++  F     P +       G       + V+     E +   +   +E  +S+V  +    P   Y IVGT +     P    G   R      T   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E      + L E G  HLG   + V V CH  +  V+ +L +++    G  S+++ T+NG IG++
Sbjct:    5 YVVTAQKPTAVNACITGHFTSAEDLNLLIAKNTRLEIYV--VTAEGLRPVKEVGMYGRISVMELFRPKGESKDLLFILTSKYNACILEYKQNGDSIDIITRAHGNVQDRIG-RPSETGIIGIVDPECR--MIGLRLYDGLFKVIPLDRENRELKAFNIRLEELQVIDVHFL---YGCQAPTVCFI---YQDPQ----GRHVKTYEVSLREKEFNKG-----PWKQENVEAEASMVIPVP---EPFGGAIIIGQESITYHN-GDKYLAIAPPTIKQSTI---------VCH-NRVDPNGSRYLLGDME-GRLFMLLLEKEELMDGTVALKDLHVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLN--VDSNEQGSYVTVM-----ETF----------------TNLGPILDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG-IKGLWPLRSEAGRESDDMLVLSFVGQTRVLMLSGEEVEETELPGFVDNQQTFYCGNVAHQQLIQITSGSVRLVLQDSKALVSEWKEPQGRNISVAACNHTQVVLAV-GRALYYLQI--LAGELKQIS-TTEMEHEVACLDITPLGESSSESPLCAVGLWTDISARMLKLP---CFTPLHKEMLGGEIIPRSILMTTF------------EGSYYLLCALGDGALFYFGLDLQTGALSERKKVTLGTQPTVLRTFRSLSTSNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSEGYPDSLALANNSTLTIGTIDEIQKLHIR-TVPLYESPRRICYQ---------EVSQCFGVLSSRVEIQDASGAISAVRPSASTQALSSSVSSSKLFPSSTSPHE----TSFGEEVEVHSLLVVDQHTFEVLHAHQFLPSEYGLSLVSCRLGKDPS-VYFIVGTAMVYPEEPEPKQG---RIIVFHYTDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEER-----QHLQEVGVFHLG---EFVNVFCHGSL--VLQNLGESSTPTQG--SVLFGTVNGMIGLV 1040          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Medaka
Match: ddb1 (damage specific DNA binding protein 1 [Source:NCBI gene;Acc:101162350])

HSP 1 Score: 177.948 bits (450), Expect = 6.792e-45
Identity = 262/1145 (22.88%), Postives = 458/1145 (40.00%), Query Frame = 2
Query:   68 YNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTG-IKDYLVVASDSGRIVILEYIPGKN---IFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEM-----VREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHV--WRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGL-SDQTVRVYLLDPSNCLSQL--TMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAA--FLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERG--HLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGIL 3445
            Y +T QK T++   + GHF+  +   +++AK   LE+     T+  ++ +    ++G I  +  F   G  KD L + +      ILEY    +   I  +       + G R    G    +DP  R  M G      +  V+  D EN    +  +       + +H +    G + PT   I   Y D      G  V+    +L   E + G         E +E  A+ +I VP   E   G II  +  ITY N GD+     P   +++ +         VC           + L   E G +F + LE +  M     ++++ ++      +A  +  L  G +FV +  G+  L ++    D +++  + + M     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG    +W ++  A    D  +V+SF+  T VL + GE VEE    GF+    T  C  +    L+Q+    +R +  D +  V  W+ P  + I   A N  QVV+A+ G  L Y ++   +G+L +     E   ++ C+ +  +      S   AVGL +D + R+  L    C + L   M G  + P S+ +                G+ YL   L +G L    +D   G LS+ +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + Y    +SE  P+ +     ++L I  ++++  +  + + PL  +PRR             E         S+ E +          P+   Q L+  ++++  F     P +       G       + V+     E +   +   +E  +S+V  +    P   Y IVGT +     P    G   R      T   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E      + L E G  HLG   + V V CH  +  V+ +L +++    G  S+++ T+NG IG L
Sbjct:    5 YVVTAQKPTAVNACITGHFTSAEDLNLLIAKNTRLEIYV--VTAEGLRPVKEVGMYGRISVMELFRPKGESKDLLFILTSKYNACILEYKQNGDSIDIITRAHGNVQDRIG-RPSETGIIGIVDPECR--MIGLRLYDGLFKVIPLDRENRELKAFNIRLEELQVIDVHFL---YGCQAPTVCFI---YQDPQ----GRHVKTYEVSLREKEFNKG-----PWKQENVEAEASMVIPVP---EPFGGAIIIGQESITYHN-GDKYLAIAPPTIKQSTI---------VCH-NRVDPNGSRYLLGDME-GRLFMLLLEKEELMDGTVALKDLHVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLN--VDSNEQGSYVTVM-----ETF----------------TNLGPILDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG-IKGLWPLRSEAGRESDDMLVLSFVGQTRVLMLSGEEVEETELPGFVDNQQTFYCGNVAHQQLIQITSGSVRLVLQDSKALVSEWKEPQGRNISVAACNHTQVVLAV-GRALYYLQI--LAGELKQIS-TTEMEHEVACLDITPLGESSSESPLCAVGLWTDISARMLKLP---CFTPLHKEMLGGEIIPRSILMTTF------------EGSYYLLCALGDGALFYFGLDLQTGALSERKKVTLGTQPTVLRTFRSLSTSNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSEGYPDSLALANNSTLTIGTIDEIQKLHIR-TVPLYESPRRICYQ---------EVSQCFGVLSSRVEIQDASGAISAVRPSASTQALSSSVSSSKLFPSSTSPHE----TSFGEEVEVHSLLVVDQHTFEVLHAHQFLPSEYGLSLVSCRLGKDPS-VYFIVGTAMVYPEEPEPKQG---RIIVFHYTDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEER-----QHLQEVGVFHLG---EFVNVFCHGSL--VLQNLGESSTPTQG--SVLFGTVNGMIGRL 1040          
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Medaka
Match: ddb1 (damage specific DNA binding protein 1 [Source:NCBI gene;Acc:101162350])

HSP 1 Score: 164.466 bits (415), Expect = 1.171e-40
Identity = 212/920 (23.04%), Postives = 376/920 (40.87%), Query Frame = 2
Query:  731 ERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEM-----VREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHV--WRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGL-SDQTVRVYLLDPSNCLSQL--TMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAA--FLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERG--HLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGIL 3445
            E +E  A+ +I VP   E   G II  +  ITY N GD+     P   +++ +         VC           + L   E G +F + LE +  M     ++++ ++      +A  +  L  G +FV +  G+  L ++    D +++  + + M     +TF                 +L PI+   + DL  +   QL    G     SLR++ +G+ +   A  DLPG    +W ++  A    D  +V+SF+  T VL + GE VEE    GF+    T  C  +    L+Q+    +R +  D +  V  W+ P  + I   A N  QVV+A+ G  L Y ++   +G+L +     E   ++ C+ +  +      S   AVGL +D + R+  L    C + L   M G  + P S+ +                G+ YL   L +G L    +D   G LS+ +   LG+QP  L       +  V A S RP + Y+  ++   + ++ + + Y    +SE  P+ +     ++L I  ++++  +  + + PL  +PRR             E         S+ E +          P+   Q L+  ++++  F     P +       G       + V+     E +   +   +E  +S+V  +    P   Y IVGT +     P    G   R      T   L+      V  +  +M  F G+LL  +++ + +Y+   +K LR   N       + ++     I+V D+  S+  + Y +  E      A D    W++ + +LD+D    A+   N+ V +     T D E      + L E G  HLG   + V V CH  +  V+ +L +++    G  S+++ T+NG IG++
Sbjct:  171 ENVEAEASMVIPVP---EPFGGAIIIGQESITYHN-GDKYLAIAPPTIKQSTI---------VCH-NRVDPNGSRYLLGDME-GRLFMLLLEKEELMDGTVALKDLHVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLN--VDSNEQGSYVTVM-----ETF----------------TNLGPILDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPG-IKGLWPLRSEAGRESDDMLVLSFVGQTRVLMLSGEEVEETELPGFVDNQQTFYCGNVAHQQLIQITSGSVRLVLQDSKALVSEWKEPQGRNISVAACNHTQVVLAV-GRALYYLQI--LAGELKQIS-TTEMEHEVACLDITPLGESSSESPLCAVGLWTDISARMLKLP---CFTPLHKEMLGGEIIPRSILMTTF------------EGSYYLLCALGDGALFYFGLDLQTGALSERKKVTLGTQPTVLRTFRSLSTSNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSEGYPDSLALANNSTLTIGTIDEIQKLHIR-TVPLYESPRRICYQ---------EVSQCFGVLSSRVEIQDASGAISAVRPSASTQALSSSVSSSKLFPSSTSPHE----TSFGEEVEVHSLLVVDQHTFEVLHAHQFLPSEYGLSLVSCRLGKDPS-VYFIVGTAMVYPEEPEPKQG---RIIVFHYTDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAY-KPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEER-----QHLQEVGVFHLG---EFVNVFCHGSL--VLQNLGESSTPTQG--SVLFGTVNGMIGLV 1001          
BLAST of Splicing factor 3B subunit 3 vs. Planmine SMEST
Match: SMESG000000828.1 (SMESG000000828.1)

HSP 1 Score: 2528.44 bits (6552), Expect = 0.000e+0
Identity = 1216/1217 (99.92%), Postives = 1217/1217 (100.00%), Query Frame = 2
Query:   59 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGIKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 3709
            MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGIKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALE+ASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF
Sbjct:    1 MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGIKDYLVVASDSGRIVILEYIPGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIICAENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDEMNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFLGTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKLFRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEFASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIETDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDIFGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIVVADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRAENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKEPSDIAKNLEKIRAKFAF 1217          
BLAST of Splicing factor 3B subunit 3 vs. Planmine SMEST
Match: SMESG000026995.1 (SMESG000026995.1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.124e-16
Identity = 268/1290 (20.78%), Postives = 483/1290 (37.44%), Query Frame = 2
Query:   65 LYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKIQTLLSTEVFGIIRAIFAFHLTGIK-DYLVVASDSGRIVILEYI--PGKNIFVKVQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENNLTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAVEDIRKNLTYYELDLGLNHVVRKYSE----RLEENANFLISVPGGKEGP-SGIIICAENYITYKN-FGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKK--------KLFFFLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVATEFGNHYLYQIT-NLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDE--MNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKSDLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSI-GETVEEVTDSGFLGTTPTLMCAQLG-DDALVQVYPDGIRHIR------PDRRVHVWRAPLKKTIVKCALNRRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEEQRSRFLAVGLSDQTVRVYLLDPSNCLSQL-TMQGLPVNPESLCIAELGASDQSEQQKGNTGTLYLNIGLQNGGLLRALID-------PIKGELSDTRTRYLGSQP---VKLFRIMVQGSE-AVLAISTRPWLSYTYQNR--FHLTPMSYEALEYASGFSSEQCPEGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIII----ETDHNAYTRQSKEERKQQIALKMQEAPADE--EQELAKEMA------AAFLQEELPEDI----FGAAKAGTGFWASIIKVIKP---LNGEFVQKIELPQNEAAVSMVMAKFSTRPDEQ------------------YIIVGT--VIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDAMCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSR--IVVADMQDSIFWVKYHRRPE-NQLVIFADDTTTRWVNHICVLDNDTCATADKFGNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEVVTSLQKATLNPSGL---------ESLVYTTINGGIGILVPFQSND-FYEFFQTLESHIRAENVSLVGRDHLHYRSYY--FPCK---NVIDGDLCEIFSTLEISKQRSI 3637
             Y++T QK+T +  +   +F+G     ++V K    E+     TS  ++ +    + G I A   F   G   D +VV ++     I++ I    +  FV       G +          + +DP  + I+    +      V       +L    P +   S  L +    V+ G     F++    +   D  T G  VED  K L      +  N V     E     L  +  F+I V    E P  GI+I     + Y N  G Q     PI           +    VC       K        +L+  +   E       T+  +C     +++ Y   V +  +M  L  G +F+ +  G+  L ++T N AD     E ++  P+                +Q+ E  MN + PII   + ++  ++  QL +  G      ++++ +G+ +  +   D P H   VW++K       D  +  S+   +   ++ G+ + +    GF     T+  + +G DD ++QV    +R I        +  ++VWR P    I +   N +Q+V+  +G +L Y  +  +S  L       +   +I C+ +   P +          LS+     + +  S CL  L TM+ +   P  L    +        Q       YL IG+ NG L+   ID        + G L++ R   +G+ P   + L+  + Q  E  V   S  P + +    R  F    +  E L      +S      +V + ++++   +++K+  +  + S PL  +PRR  +   + +  +I    +T H+   R  +        L    + A E  ++ L ++M          + +   E +    F  ++       SI  +  P   +N E V  I    N          FS +P+ Q                    IVGT  V+D    P    G     +   +TGEF  +        + D M  F G+LL   ++ + + D+ K  L    +   +   I+ +   +    I++ D+  S+  ++Y  +P      + A      W   I ++D+D    A+   NI +V    D+T      PSG     +  ++     ++      +VG+V+       +    L          S++Y +  G IG +  F+ N   Y F +++ES ++   V +    H  +RSY     C+     IDGDL E F  L+I  +  I
Sbjct:    4 FYHVTSQKATGVSHSFTCNFTGPNDLNLIVGKFFYFEIYL--VTSEGLRLMRELPINGRISAAVNFKRNGRNLDSIVVVTEKADAAIIDCIREDERLDFVTYASGNIGDNSSILSDLRHEIIIDPTNQIILFKFFDG-----VFKAILMKDLRTLDPKDCETSQALNVVAFRVEDGNILGIFSL----HGSEDYATIGLFVED-NKMLNMKSFKMSFNQVDVTPDEWKIDALPPDTQFIIPV----EPPYCGILIVGNKSVIYHNRIGTQIPAEIPI----------HKSSTVVCYEKIDVHKYLLGDMMGRLYMVILFHEGPGTSSTTVIPNC-----LKVSYLGEVCIPENMTYLDNGVVFIGSTLGDSQLIRLTCNPADN----EATTGAPVS---------------IQVLERYMN-VGPIIDIDLQEVNGQN--QLLMCSGAYREGCVKIVRNGIGIQELLIIDQP-HIKNVWSLKFRNGCAVDNLLGFSWPGRSETFTLEGDDLRQKICLGFELYASTVHLSVVGTDDHMLQVTDKELRLIPMVHDNGDNENINVWRPPSSLGISRATTNGKQIVVG-SGCDLFYLVVVGHSLSL---VNTCKLTNEIACLDMS--PFQWNCPGHDDPALSEIVAVTFWIKKSVCLVDLNTMEVVATAP--LTTPGILPRSVLIVQFNRNAAPYLMIGMDNGNLIYFQIDISALVQNNLSGILTEQRRVTIGTGPFMNLSLWNSLGQSHERCVFVCSNHPSIIHYSDGRLLFSSINLKNEVLSMCP-LNSSTYKNCLVLVSESNIIFGSIDKIQKLHVR-SVPLNESPRRMTIQKDTDSIGLITMRCDTYHDNGFRPMRASVSTNARLTKSSSGAPELMKKTLIRKMRDIESSHLIIMNQTFMEPVHCHSFYCSEDVVEQAISITTMKLPISIINHEIVPDIRNATN----------FSLKPEPQDDPMCGGSSNAGEVKLTPVFIVGTAYVVDEEQEP--TQGCLYVFHYNERTGEFTVVRTFKTTGVAYD-MQEFDGKLLSTFNSSVQLLDLTKDDL---HIICRYDDNIIALYLKRKDDFILIGDLMRSVTLLRY--KPNVAHFEVIAQHRAPHWTTAIEIIDDDKFLVAENEMNIFIVSRDFDLT------PSGEGVRNDLSNMKEERFRMSEYASIHVGQVINKFMAGNILMQPLLDEYRIKLKNSILYGSTTGTIGQV--FEINQTLYTFLKSVESQMQNILVPIGNFQHETWRSYVKIRQCRVAERFIDGDLVENFQNLDIKDKMKI 1203          
The following BLAST results are available for this feature:
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF3B30.000e+067.05splicing factor 3b subunit 3 [Source:HGNC Symbol;A... [more]
DDB17.221e-5223.43damage specific DNA binding protein 1 [Source:HGNC... [more]
DDB11.999e-4723.11damage specific DNA binding protein 1 [Source:HGNC... [more]
SF3B31.215e-3876.47splicing factor 3b subunit 3 [Source:HGNC Symbol;A... [more]
SF3B37.928e-2666.67splicing factor 3b subunit 3 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
teg-40.000e+053.95Tumorous Enhancer of Glp-1(Gf) [Source:UniProtKB/... [more]
ddb-12.749e-1721.01DNA damage-binding protein 1 [Source:UniProtKB/Sw... [more]
ddb-12.749e-1721.01DNA damage-binding protein 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Sf3b30.000e+065.04gene:FBgn0035162 transcript:FBtr0072597[more]
Sf3b30.000e+072.65gene:FBgn0035162 transcript:FBtr0331404[more]
pic1.221e-5122.35gene:FBgn0260962 transcript:FBtr0082709[more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b30.000e+066.64splicing factor 3b, subunit 3 [Source:NCBI gene;Ac... [more]
sf3b30.000e+066.64splicing factor 3b, subunit 3 [Source:NCBI gene;Ac... [more]
ddb11.006e-4222.62damage-specific DNA binding protein 1 [Source:ZFIN... [more]
cpsf11.472e-722.47cleavage and polyadenylation specific factor 1 [So... [more]
cpsf11.381e-624.16cleavage and polyadenylation specific factor 1 [So... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b30.000e+066.64splicing factor 3b subunit 3 [Source:NCBI gene;Acc... [more]
sf3b30.000e+065.90splicing factor 3b subunit 3 [Source:NCBI gene;Acc... [more]
sf3b30.000e+067.40splicing factor 3b subunit 3 [Source:NCBI gene;Acc... [more]
sf3b30.000e+063.70splicing factor 3b subunit 3 [Source:NCBI gene;Acc... [more]
sf3b30.000e+067.95splicing factor 3b subunit 3 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sf3b30.000e+067.13splicing factor 3b, subunit 3 [Source:MGI Symbol;A... [more]
Ddb13.688e-5223.43damage specific DNA binding protein 1 [Source:MGI ... [more]
Ddb11.527e-1425.70damage specific DNA binding protein 1 [Source:MGI ... [more]
Ddb11.530e-1223.23damage specific DNA binding protein 1 [Source:MGI ... [more]
Cpsf19.620e-1223.95cleavage and polyadenylation specific factor 1 [So... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1LVE8|SF3B3_DANRE0.000e+066.64Splicing factor 3B subunit 3 OS=Danio rerio OX=795... [more]
sp|Q921M3|SF3B3_MOUSE0.000e+067.13Splicing factor 3B subunit 3 OS=Mus musculus OX=10... [more]
sp|Q15393|SF3B3_HUMAN0.000e+067.05Splicing factor 3B subunit 3 OS=Homo sapiens OX=96... [more]
sp|A0JN52|SF3B3_BOVIN0.000e+067.05Splicing factor 3B subunit 3 OS=Bos taurus OX=9913... [more]
sp|Q5RBI5|SF3B3_PONAB0.000e+066.89Splicing factor 3B subunit 3 OS=Pongo abelii OX=96... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074Z1M40.000e+068.81CPSF A subunit region OS=Opisthorchis viverrini OX... [more]
A0A4S2LKN70.000e+068.89CPSF_A domain-containing protein OS=Opisthorchis f... [more]
A0A0L8HYX40.000e+067.87CPSF_A domain-containing protein OS=Octopus bimacu... [more]
A0A4E0QVA00.000e+068.40Splicing factor 3B subunit OS=Fasciola hepatica OX... [more]
A0A0X3P2R40.000e+068.00Splicing factor 3B subunit 3 (Fragment) OS=Schisto... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sf3b30.000e+066.97splicing factor 3b subunit 3 [Source:NCBI gene;Acc... [more]
cpsf11.063e-922.25cleavage and polyadenylation specific factor 1 [So... [more]
ddb13.607e-926.29damage-specific DNA binding protein 1 [Source:ZFIN... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sf3b30.000e+066.48splicing factor 3b, subunit 3 [Source:NCBI gene;Ac... [more]
ddb12.124e-4222.62damage-specific DNA binding protein 1 [Source:ZFIN... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RSE16.862e-6324.82Protein involved in pre-mRNA splicing; component o... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO492170.000e+061.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427421.161e-4122.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3b30.000e+066.56splicing factor 3b subunit 3 [Source:NCBI gene;Acc... [more]
sf3b30.000e+064.38splicing factor 3b subunit 3 [Source:NCBI gene;Acc... [more]
ddb15.499e-4522.79damage specific DNA binding protein 1 [Source:NCBI... [more]
ddb16.792e-4522.88damage specific DNA binding protein 1 [Source:NCBI... [more]
ddb11.171e-4023.04damage specific DNA binding protein 1 [Source:NCBI... [more]
back to top
BLAST of Splicing factor 3B subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000000828.10.000e+099.92SMESG000000828.1[more]
SMESG000026995.18.124e-1620.78SMESG000026995.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029523 ID=SMED30029523|Name=Splicing factor 3B subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=3763bp
CAAACATTTTTAAATTATATAGTGTGCCATTTTGAATTATTCTTCTTACT
AAATTATCATGAAACTGTATAATTTAACATTGCAAAAAAGCACTTCCATT
ATTGAAGCTGTACACGGTCACTTTTCGGGTACAAAAGTTCAAGAAATAGT
TGTAGCTAAAGGGAAAGTTTTAGAATTACTCCGCCCGGACACAACATCTG
GAAAAATCCAAACATTACTATCCACAGAAGTCTTTGGTATAATTCGTGCA
ATATTTGCTTTTCATTTGACTGGAATTAAAGACTATCTTGTTGTTGCCAG
TGACTCAGGGCGAATTGTTATATTAGAATATATACCTGGTAAAAATATTT
TCGTAAAAGTTCAACAAGAAACATATGGTAAAAGTGGTTGTCGAAGAATT
GTTCCAGGTCAATATTTAGCTATGGATCCCAATGGTAGAGCTATAATGAC
TGGGGCTATTGAAAAGCAAAAAATGGTATATGTGCTTAATCGAGATTCTG
AAAATAATCTGACGATTTCATCACCACTAGAAGCCCACCGTTCTAATACA
TTGACTTTACATATGATTGGAGTCGACGTTGGTTTCGAAAATCCAACTTT
TGCAGTCATAGAAGTTGATTATTCCGACGCAGATGCTGATACTACTGGTG
GTGCAGTTGAAGATATACGCAAAAATTTAACTTACTACGAATTGGATTTG
GGATTAAATCACGTTGTAAGAAAATACAGTGAAAGACTTGAGGAAAATGC
TAATTTTTTGATATCCGTACCAGGAGGAAAAGAAGGACCATCTGGAATTA
TAATATGTGCAGAAAATTATATAACTTATAAAAACTTCGGTGATCAACCT
GATATTCGTTGTCCAATCCCTAGACGCCGTAATGATTTAGAGGACCCGGA
AAGAGGAATGCTTTTTGTCTGTAGTGCAACCCATACAACAAAGAAAAAAT
TATTTTTCTTTTTAGCCCAAACTGAACAAGGAGATATATTTAAAATAACT
CTTGAAACTGACTGTGAAATGGTAAGGGAAATGAGATTAAAATATTTTGA
CACAGTTCCTGTTGCAACATCCATGTGTGTTTTAAAAACGGGATTTCTAT
TCGTCGCCACAGAATTTGGAAATCACTATTTATATCAAATAACAAATTTG
GCTGATGGTGATGATGAACCTGAATTTTCATCTGCCATGCCACTTGAAGA
GGGGGATACATTTTATTTTGCCCCTAGAACTTTGAAAAATCTTGTACAAA
TTGATGAAATGAACAGCTTGGCCCCTATAATTGGTTGTCATATAGCCGAT
TTAGCGAACGAAGACACACCACAATTGGCTGTATTATGTGGACGAGGTCC
AAGGTCATCATTGAGATTGTTGTCTCACGGATTAGAGGTTTCAGTAATGG
CCAAGTCTGACCTTCCTGGTCACCCAAATGCAGTTTGGACAGTCAAACGT
ACCGCAGATGAATTGTATGACGCATATATTGTAGTTTCATTTATAAACGC
TACTCTGGTTTTATCCATTGGTGAAACGGTAGAAGAAGTAACAGATAGTG
GATTTCTCGGCACAACCCCGACTCTAATGTGCGCTCAACTTGGTGATGAC
GCATTGGTGCAAGTTTATCCAGACGGTATTCGTCATATTCGTCCAGATCG
CCGGGTTCACGTGTGGCGCGCACCTTTAAAGAAAACCATTGTCAAGTGCG
CTCTTAATCGCCGGCAGGTTGTTATAGCTCTTACTGGAAATGAATTGGTT
TATTTTGAAATGGATTCAAATTCTGGCCAATTGAATGAATTCCAAGGTCG
CAAAGAAGCCCCAGCCGATATTATATGCATGGCTCTCGGTTCGGTACCGG
CTGAAGAACAAAGATCTCGATTTTTAGCAGTTGGACTTAGTGATCAAACT
GTTCGTGTTTATCTACTCGATCCTTCTAATTGCCTTTCACAATTAACAAT
GCAAGGTTTACCAGTAAACCCCGAATCACTTTGTATCGCAGAATTAGGCG
CAAGTGATCAAAGTGAACAACAGAAAGGAAATACAGGAACTTTATATTTG
AATATTGGTTTACAAAATGGTGGTTTATTGAGAGCGCTTATTGATCCAAT
CAAAGGAGAATTATCGGATACTCGCACTCGATATTTGGGATCACAGCCAG
TAAAGTTGTTTCGTATAATGGTACAAGGAAGTGAAGCAGTTTTAGCCATA
TCAACTCGACCATGGTTGAGTTATACCTATCAAAATCGATTCCATTTAAC
TCCAATGAGTTATGAAGCTCTCGAATATGCCAGTGGATTCTCATCCGAAC
AATGTCCAGAAGGTATTGTAGCTATTTATCAAAATTCTTTAAGAATTTTG
GCACTCGAGAAACTTGGAACTATTTTTAATCAACTCTCTCATCCGCTCAC
CTACACGCCAAGGAGATTTGTGTTACATCCCCAATCCGGCAATGCTATCA
TTATTGAAACCGATCATAATGCATATACCAGGCAATCAAAGGAGGAGCGT
AAACAACAAATTGCACTGAAAATGCAGGAGGCTCCCGCGGACGAGGAACA
AGAACTTGCGAAAGAAATGGCAGCTGCATTTTTGCAGGAAGAGCTGCCGG
AAGATATATTTGGCGCAGCAAAAGCTGGAACTGGATTTTGGGCCAGTATT
ATCAAAGTAATAAAACCTCTGAATGGGGAATTCGTTCAAAAAATAGAGCT
CCCACAAAATGAAGCAGCAGTTTCTATGGTGATGGCTAAATTTTCGACCA
GACCGGATGAGCAATACATTATTGTAGGTACTGTGATCGATTGCATTTTG
TCACCATATAGTAACAATGGTGGTAATATCCGATCATATAAAATATCAAA
AACTGGGGAATTTCTTGAATTAGCCCATGTTACTAATGTTGATGACTCTC
CTGATGCAATGTGCAGTTTCCAAGGTCGTCTTTTAGTTGGTCTTTCGAAC
CGTTTGATTATCTATGATATGGGAAAGAAGAAATTGTTGAGAAAAGCTGT
AAATAAGAATTTTCCTTATCGAATCGTGACAATACAAGCCCATAAAAGTA
GGATTGTAGTTGCCGATATGCAAGACAGTATATTCTGGGTGAAATATCAC
CGACGTCCTGAGAATCAATTGGTGATATTTGCTGATGATACAACTACTAG
ATGGGTGAATCACATTTGCGTTCTTGATAATGATACCTGTGCTACCGCGG
ACAAATTTGGTAACATTGCCGTAGTCAGATTACCAAAAGATGTTACAGAT
GATGTCGAGGAAGATCCTAGTGGAAGTAAAGCTCTATGGGAACGAGGTCA
TTTAGGAGGCGCGAGTCAAAAAGTTGAGGTTCTATGCCATTTCTATGTCG
GTGAAGTGGTGACCAGTTTACAGAAAGCCACTTTAAATCCAAGTGGTTTA
GAATCGTTGGTTTATACAACTATTAACGGCGGAATAGGAATTCTCGTTCC
TTTTCAAAGCAATGATTTTTACGAATTTTTCCAAACTTTAGAATCACATA
TTCGAGCTGAAAATGTTTCTCTAGTAGGAAGAGATCATTTACATTACAGA
TCTTATTATTTTCCATGCAAGAATGTTATTGATGGAGATTTGTGTGAAAT
TTTCTCCACTTTAGAAATATCCAAACAAAGATCAATCAGTTTCGAACTCG
GAAAAGAACCAAGTGATATTGCAAAAAATTTGGAAAAGATCAGAGCGAAA
TTTGCATTTTAAATTAATTAATCTGTATTATGTTTTACTAATAAAAATTA
AATGAAAAAAAAG
back to top

protein sequence of SMED30029523-orf-1

>SMED30029523-orf-1 ID=SMED30029523-orf-1|Name=SMED30029523-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1218bp
MKLYNLTLQKSTSIIEAVHGHFSGTKVQEIVVAKGKVLELLRPDTTSGKI
QTLLSTEVFGIIRAIFAFHLTGIKDYLVVASDSGRIVILEYIPGKNIFVK
VQQETYGKSGCRRIVPGQYLAMDPNGRAIMTGAIEKQKMVYVLNRDSENN
LTISSPLEAHRSNTLTLHMIGVDVGFENPTFAVIEVDYSDADADTTGGAV
EDIRKNLTYYELDLGLNHVVRKYSERLEENANFLISVPGGKEGPSGIIIC
AENYITYKNFGDQPDIRCPIPRRRNDLEDPERGMLFVCSATHTTKKKLFF
FLAQTEQGDIFKITLETDCEMVREMRLKYFDTVPVATSMCVLKTGFLFVA
TEFGNHYLYQITNLADGDDEPEFSSAMPLEEGDTFYFAPRTLKNLVQIDE
MNSLAPIIGCHIADLANEDTPQLAVLCGRGPRSSLRLLSHGLEVSVMAKS
DLPGHPNAVWTVKRTADELYDAYIVVSFINATLVLSIGETVEEVTDSGFL
GTTPTLMCAQLGDDALVQVYPDGIRHIRPDRRVHVWRAPLKKTIVKCALN
RRQVVIALTGNELVYFEMDSNSGQLNEFQGRKEAPADIICMALGSVPAEE
QRSRFLAVGLSDQTVRVYLLDPSNCLSQLTMQGLPVNPESLCIAELGASD
QSEQQKGNTGTLYLNIGLQNGGLLRALIDPIKGELSDTRTRYLGSQPVKL
FRIMVQGSEAVLAISTRPWLSYTYQNRFHLTPMSYEALEYASGFSSEQCP
EGIVAIYQNSLRILALEKLGTIFNQLSHPLTYTPRRFVLHPQSGNAIIIE
TDHNAYTRQSKEERKQQIALKMQEAPADEEQELAKEMAAAFLQEELPEDI
FGAAKAGTGFWASIIKVIKPLNGEFVQKIELPQNEAAVSMVMAKFSTRPD
EQYIIVGTVIDCILSPYSNNGGNIRSYKISKTGEFLELAHVTNVDDSPDA
MCSFQGRLLVGLSNRLIIYDMGKKKLLRKAVNKNFPYRIVTIQAHKSRIV
VADMQDSIFWVKYHRRPENQLVIFADDTTTRWVNHICVLDNDTCATADKF
GNIAVVRLPKDVTDDVEEDPSGSKALWERGHLGGASQKVEVLCHFYVGEV
VTSLQKATLNPSGLESLVYTTINGGIGILVPFQSNDFYEFFQTLESHIRA
ENVSLVGRDHLHYRSYYFPCKNVIDGDLCEIFSTLEISKQRSISFELGKE
PSDIAKNLEKIRAKFAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0071005U2-type precatalytic spliceosome
GO:0005634nucleus
GO:0005681spliceosomal complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR004871Cleavage/polyA-sp_fac_asu_C
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0008380RNA splicing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 2..19