ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30029509
Length (bp)4486
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30029509) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30029509) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30029509) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30029509) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029509

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal cellSMED30029509SMESG000016741.1 dd_Smed_v4_6855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029509SMESG000016741.1 dd_Smed_v4_6855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029509SMESG000016741.1 dd_Smed_v4_6855_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029509SMESG000016741.1 dd_Smed_v4_6855_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 188.734 bits (478), Expect = 2.271e-47
Identity = 104/395 (26.33%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK  + +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H +    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  365 LHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 751          

HSP 2 Score: 182.956 bits (463), Expect = 1.599e-45
Identity = 105/455 (23.08%), Postives = 211/455 (46.37%), Query Frame = 3
Query:   60 NINLIFYDKFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            N+  +  ++        ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  N  AK  N + P+H AC+ N+ ++  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H ++R GH  +   L++    +   T     P+H A K+          +E+A LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  243 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNK 689          

HSP 3 Score: 167.162 bits (422), Expect = 1.044e-40
Identity = 86/393 (21.88%), Postives = 173/393 (44.02%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H + R    ++A  L+     +   TK+ + P+H A +YG  E+ N+L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L+    ++       + P+H A +        ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+   P+H A  +GH  I+ +LL+NN 
Sbjct:  427 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQ--------EDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNA 781          

HSP 4 Score: 164.081 bits (414), Expect = 7.393e-40
Identity = 100/428 (23.36%), Postives = 201/428 (46.96%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK--------------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK  +  +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS               A     E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  +++EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  167 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGK 590          

HSP 5 Score: 163.696 bits (413), Expect = 1.261e-39
Identity = 104/460 (22.61%), Postives = 212/460 (46.09%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ ++  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K  + NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV NL+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L +L  N N N
Sbjct:  229 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSL-LLGRNANVN 685          

HSP 6 Score: 152.525 bits (384), Expect = 2.878e-36
Identity = 100/418 (23.92%), Postives = 193/418 (46.17%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNA-------------QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            A+R G LE     +    DI+  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                A+  D  A             ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  NPN    NG   L  A ++  IK  E++++    I    +  + PIH A   GH+ IV  L+ +  
Sbjct:   42 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGA 451          

HSP 7 Score: 148.673 bits (374), Expect = 4.546e-35
Identity = 83/356 (23.31%), Postives = 164/356 (46.07%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGR---RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +   +Y  ++  + E   +    P+H ++R G+ +I++ LL +    +A ++  +  +H + RE H DVA  L+    ++         P+H A++YG L +   L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +   P+H A +          +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  464 LHMAARSGQAE-VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQ--------GHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 810          

HSP 8 Score: 145.206 bits (365), Expect = 4.739e-34
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE--KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H ++R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+ +  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  + P+H A++ GH  ++ +L+
Sbjct:  491 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 777          

HSP 9 Score: 112.464 bits (280), Expect = 4.589e-24
Identity = 86/409 (21.03%), Postives = 171/409 (41.81%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGN----NNWQKLNLVCKAMHIKL 1550
            A+R G L      I    +I   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                              E+++ R   I    K+ + P+H A    H+  V+LLL++N  +D +     +   V +     ++ K+ L+  + N N    N +  L++ CK   IK+
Sbjct:   42 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVV------------------------------EMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD-KKANPNAKALNGFTPLHIACKKNRIKV 409          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 188.734 bits (478), Expect = 2.317e-47
Identity = 104/395 (26.33%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK  + +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H +    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 740          

HSP 2 Score: 182.956 bits (463), Expect = 1.424e-45
Identity = 105/455 (23.08%), Postives = 211/455 (46.37%), Query Frame = 3
Query:   60 NINLIFYDKFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            N+  +  ++        ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  N  AK  N + P+H AC+ N+ ++  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H ++R GH  +   L++    +   T     P+H A K+          +E+A LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNK 678          

HSP 3 Score: 167.162 bits (422), Expect = 1.101e-40
Identity = 86/393 (21.88%), Postives = 173/393 (44.02%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H + R    ++A  L+     +   TK+ + P+H A +YG  E+ N+L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L+    ++       + P+H A +        ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+   P+H A  +GH  I+ +LL+NN 
Sbjct:  416 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQ--------EDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNA 770          

HSP 4 Score: 164.466 bits (415), Expect = 6.925e-40
Identity = 100/428 (23.36%), Postives = 201/428 (46.96%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK--------------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK  +  +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS               A     E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  +++EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  156 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGK 579          

HSP 5 Score: 163.696 bits (413), Expect = 1.142e-39
Identity = 104/460 (22.61%), Postives = 212/460 (46.09%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ ++  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K  + NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV NL+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L +L  N N N
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSL-LLGRNANVN 674          

HSP 6 Score: 152.525 bits (384), Expect = 2.718e-36
Identity = 100/418 (23.92%), Postives = 193/418 (46.17%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNA-------------QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            A+R G LE     +    DI+  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                A+  D  A             ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  NPN    NG   L  A ++  IK  E++++    I    +  + PIH A   GH+ IV  L+ +  
Sbjct:   31 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGA 440          

HSP 7 Score: 148.673 bits (374), Expect = 4.517e-35
Identity = 83/356 (23.31%), Postives = 164/356 (46.07%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGR---RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +   +Y  ++  + E   +    P+H ++R G+ +I++ LL +    +A ++  +  +H + RE H DVA  L+    ++         P+H A++YG L +   L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +   P+H A +          +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  453 LHMAARSGQAE-VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQ--------GHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 799          

HSP 8 Score: 145.206 bits (365), Expect = 4.630e-34
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE--KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H ++R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+ +  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  + P+H A++ GH  ++ +L+
Sbjct:  480 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 766          

HSP 9 Score: 113.62 bits (283), Expect = 1.958e-24
Identity = 86/411 (20.92%), Postives = 175/411 (42.58%), Query Frame = 3
Query:  372 KKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLE----------NP------------------------NMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            K+K    + +   LR    A+R G L      I    +I   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+ ++ ++            +P                        ++TN +   L  A+  G+ K A+V++ +K + N    +   P+H AC K  I++++LLLK+   +  +
Sbjct:   16 KRKGKKSDANASYLR----AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAV 412          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 186.422 bits (472), Expect = 1.272e-46
Identity = 108/404 (26.73%), Postives = 197/404 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS 1421
            P+H A+  G   + K+LLDK    ++R+ + +  +H AC+++H  V ELL+K   +I+      L P+H AS  G L IV +L+ +  +    +     P+H A R    E+A  L++    + A  K++  P+H A R GH  ++ +L+    + N  T+   +P+H A    +      LLEK  +    T     P+H A   G  ++A+LL+++     +  +    P+H A  + +  +V++L+       +P  +   P+H A K N         VE+A  L++     N ++    +PL LA + G+ E++ L+  K  N N+ N   L      +QEG++  A+V+I+    ++   +    P+H A   G+I++VK LL++  +++   K   S
Sbjct:  374 PLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ--------VEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYS 769          

HSP 2 Score: 180.259 bits (456), Expect = 8.491e-45
Identity = 116/456 (25.44%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q+ L   H A + G+V    +   +E +     + G   +H A+  GQ E+++ L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +   +N       +P+H A       +   LL++G  +E+ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH A++  H   V +L+    +++  TLD + P+H A  C H+  +K                          N+V +  LL++    I+   ES  +PL +A   G+  ++  + ++  +PN++N      L  A++ G+ + A+ +++ K  +N   KDD  P+H A   GH  +VKLLL+NN 
Sbjct:   76 QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNA 527          

HSP 3 Score: 176.407 bits (446), Expect = 1.444e-43
Identity = 104/392 (26.53%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGN-EEVINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++   ++    +    +H A R  +  +  LL+ +   IE    D L P+H A+R G + I   L+     I+AK KN   PIH A + +  +   +L++ + +I+  T ++  P+H A   GH  +  +L+ K    N++    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ +G      N +   P+H A+R GH  + + L+  K  + A   D   P+H A +          +  +  LL+E N   N+   +  +PL +A   G+ E V+ L++++     MT      L  A++ G ++ AE+++ R    N   K+ + P+H A    +++IVKLLL
Sbjct:  239 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAAR--------IGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 622          

HSP 4 Score: 174.866 bits (442), Expect = 4.063e-43
Identity = 103/392 (26.28%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  ++     + + P+H ASR G + +V  L+ +   IE K K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+    +++  T  + +P+H A +  +  +A  LL+KG    S   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+          +    P+H       A++AG  + E+A  L++   ++N + +  Q+PL  A   G+  ++ L+ E   NPN+  T GH  L  A++EG+++    ++ ++       K    P+H A   G + + +LLL+ + 
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHM------AARAG--HTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA 593          

HSP 5 Score: 171.4 bits (433), Expect = 4.365e-42
Identity = 113/483 (23.40%), Postives = 211/483 (43.69%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDD----FNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS 1439
            Q+ +   H A R GNV       ++  + E   K++    P+H A+R+G + I ++LLD    I A++ +    IH A +  H D   LL++    I++   D L P+H A+  G   +   L+ K     ++  N + P+H AC+ N   +  +L+K    I+A T+    P+H A   GH  I+  L+ +    N    +  +P+H A    +  +A  LL+    V +   D   P+H A   G+  + +LL++   +          P+H A+R GH   V  L+  +      T     P+H A K+          V +A LL+ER+   N   ++  +PL +A+ + N +++ L+  +  +P+    NG+  L                                   A+QEG+ +   +++ ++ + N+ +K  + P+H    +GH+ +  +L+K+   +D   +   +   V S
Sbjct:  270 QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGK--------VRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVAS 742          

HSP 6 Score: 156.377 bits (394), Expect = 2.145e-37
Identity = 96/393 (24.43%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL +    +  +      +H A R  H++VA+ L++ K  +     D   P+H A+R G  N+V  L+  + N          P+H A R    E    L++K       TK+ + P+H A +YG   +  +L+ +    NA      +P+H A ++   +I   LL +G +  S   +   P+H A      ++A+ L+  G    + + +   P+H A++ GH  +V +L++ + +        + P+H   +        + +V +A +LI+    ++       +PL +                              AS  GNIK  + +++ + D+N   K    P+H A  +GH +IV LLLKN  
Sbjct:  437 GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQ--------EGHVPVADVLIKHGVMVDATTRMGYTPLHV------------------------------ASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 791          

HSP 7 Score: 133.265 bits (334), Expect = 2.475e-30
Identity = 70/272 (25.74%), Postives = 132/272 (48.53%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA 1025
            G  P+H A+R G +E +  LL+K       +   +  +H A +     VAELL+++  +      + L P+H A  +  L+IV  L+ +  +  +   N + P+H A + NQ E+A  L++      A + +   P+H A + GHAE++ +L++K  + N       +P+H      +  +A  L++ GV V++ T     P+H A   GN ++ + L+    D+ +  +  + P+H A++ GH  +V +L+         + D   P+  A
Sbjct:  536 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 807          

HSP 8 Score: 128.257 bits (321), Expect = 7.852e-29
Identity = 86/390 (22.05%), Postives = 178/390 (45.64%), Query Frame = 3
Query:  330 ACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENI-----------------------------ASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE---KLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            A R  + D A   ++   +I  C+ + L  +H AS+ G + +V  L+ K   +E   K     +H A    Q E+   LV    ++ A +++ + P++ A +  H E++  L+    + N  T   ++P+  A    +EN+                             A+ LL+   N +  +     P+H A    N  +AQLL+++G  +    +    P+H ASR G+  +V +L++    +E  T D++ P+H A +        + +V I+ +L++    I  + ++  SP+ +A +  + + + L+ +   ++++  + +   L  A+  G+ + A+V++ +    N    +   P+H AC K H+ +++LLLK    +D +
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAAR--------NGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAV 433          

HSP 9 Score: 101.293 bits (251), Expect = 1.119e-20
Identity = 83/381 (21.78%), Postives = 167/381 (43.83%), Query Frame = 3
Query:  528 ACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLIN--AKCDMEAPTLDQMRPIHFACKHNDA----------------SKAGDNYVEIAA---------LLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEK---LENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIKLNPIFISS 1571
            A R+   + A   ++   DI  C +     +H A + GH +++  L+ K + L   T +  + +H A     + +   L+  G NV + +     P++ A    + ++ + L++ G +     E+ + P+  A + GH  +V  LIN   K  +  P L      H A +++D                 SK G   + IAA         LL+ R   +N   ++  +PL +A   GN  ++ L+ ++   +E         L  A++ G+++ +E+++     I    K+ + PIH A    H++ V+LLL+ + E+D I   + +   V +      + K+ L+   + N    N +  L++ CK  H+++  + + +
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPAL------HIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT 426          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 186.037 bits (471), Expect = 1.629e-46
Identity = 108/404 (26.73%), Postives = 197/404 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS 1421
            P+H A+  G   + K+LLDK    ++R+ + +  +H AC+++H  V ELL+K   +I+      L P+H AS  G L IV +L+ +  +    +     P+H A R    E+A  L++    + A  K++  P+H A R GH  ++ +L+    + N  T+   +P+H A    +      LLEK  +    T     P+H A   G  ++A+LL+++     +  +    P+H A  + +  +V++L+       +P  +   P+H A K N         VE+A  L++     N ++    +PL LA + G+ E++ L+  K  N N+ N   L      +QEG++  A+V+I+    ++   +    P+H A   G+I++VK LL++  +++   K   S
Sbjct:  341 PLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ--------VEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYS 736          

HSP 2 Score: 180.259 bits (456), Expect = 8.362e-45
Identity = 116/456 (25.44%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q+ L   H A + G+V    +   +E +     + G   +H A+  GQ E+++ L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +   +N       +P+H A       +   LL++G  +E+ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH A++  H   V +L+    +++  TLD + P+H A  C H+  +K                          N+V +  LL++    I+   ES  +PL +A   G+  ++  + ++  +PN++N      L  A++ G+ + A+ +++ K  +N   KDD  P+H A   GH  +VKLLL+NN 
Sbjct:   43 QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNA 494          

HSP 3 Score: 176.407 bits (446), Expect = 1.459e-43
Identity = 104/392 (26.53%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGN-EEVINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++   ++    +    +H A R  +  +  LL+ +   IE    D L P+H A+R G + I   L+     I+AK KN   PIH A + +  +   +L++ + +I+  T ++  P+H A   GH  +  +L+ K    N++    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ +G      N +   P+H A+R GH  + + L+  K  + A   D   P+H A +          +  +  LL+E N   N+   +  +PL +A   G+ E V+ L++++     MT      L  A++ G ++ AE+++ R    N   K+ + P+H A    +++IVKLLL
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAAR--------IGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 589          

HSP 4 Score: 174.866 bits (442), Expect = 3.740e-43
Identity = 103/392 (26.28%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  ++     + + P+H ASR G + +V  L+ +   IE K K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+    +++  T  + +P+H A +  +  +A  LL+KG    S   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+          +    P+H       A++AG  + E+A  L++   ++N + +  Q+PL  A   G+  ++ L+ E   NPN+  T GH  L  A++EG+++    ++ ++       K    P+H A   G + + +LLL+ + 
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHM------AARAG--HTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA 560          

HSP 5 Score: 171.4 bits (433), Expect = 5.010e-42
Identity = 113/483 (23.40%), Postives = 211/483 (43.69%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDD----FNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS 1439
            Q+ +   H A R GNV       ++  + E   K++    P+H A+R+G + I ++LLD    I A++ +    IH A +  H D   LL++    I++   D L P+H A+  G   +   L+ K     ++  N + P+H AC+ N   +  +L+K    I+A T+    P+H A   GH  I+  L+ +    N    +  +P+H A    +  +A  LL+    V +   D   P+H A   G+  + +LL++   +          P+H A+R GH   V  L+  +      T     P+H A K+          V +A LL+ER+   N   ++  +PL +A+ + N +++ L+  +  +P+    NG+  L                                   A+QEG+ +   +++ ++ + N+ +K  + P+H    +GH+ +  +L+K+   +D   +   +   V S
Sbjct:  237 QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGK--------VRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVAS 709          

HSP 6 Score: 155.606 bits (392), Expect = 3.150e-37
Identity = 96/393 (24.43%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL +    +  +      +H A R  H++VA+ L++ K  +     D   P+H A+R G  N+V  L+  + N          P+H A R    E    L++K       TK+ + P+H A +YG   +  +L+ +    NA      +P+H A ++   +I   LL +G +  S   +   P+H A      ++A+ L+  G    + + +   P+H A++ GH  +V +L++ + +        + P+H   +        + +V +A +LI+    ++       +PL +                              AS  GNIK  + +++ + D+N   K    P+H A  +GH +IV LLLKN  
Sbjct:  404 GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQ--------EGHVPVADVLIKHGVMVDATTRMGYTPLHV------------------------------ASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 758          

HSP 7 Score: 132.88 bits (333), Expect = 3.258e-30
Identity = 70/272 (25.74%), Postives = 132/272 (48.53%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA 1025
            G  P+H A+R G +E +  LL+K       +   +  +H A +     VAELL+++  +      + L P+H A  +  L+IV  L+ +  +  +   N + P+H A + NQ E+A  L++      A + +   P+H A + GHAE++ +L++K  + N       +P+H      +  +A  L++ GV V++ T     P+H A   GN ++ + L+    D+ +  +  + P+H A++ GH  +V +L+         + D   P+  A
Sbjct:  503 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 8 Score: 130.183 bits (326), Expect = 2.023e-29
Identity = 88/401 (21.95%), Postives = 182/401 (45.39%), Query Frame = 3
Query:  297 RSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENI-----------------------------ASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE---KLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            R +D   +   A R  + D A   ++   +I  C+ + L  +H AS+ G + +V  L+ K   +E   K     +H A    Q E+   LV    ++ A +++ + P++ A +  H E++  L+    + N  T   ++P+  A    +EN+                             A+ LL+   N +  +     P+H A    N  +AQLL+++G  +    +    P+H ASR G+  +V +L++    +E  T D++ P+H A +        + +V I+ +L++    I  + ++  SP+ +A +  + + + L+ +   ++++  + +   L  A+  G+ + A+V++ +    N    +   P+H AC K H+ +++LLLK    +D +
Sbjct:    8 READAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAAR--------NGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAV 400          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 185.652 bits (470), Expect = 1.964e-46
Identity = 108/404 (26.73%), Postives = 197/404 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS 1421
            P+H A+  G   + K+LLDK    ++R+ + +  +H AC+++H  V ELL+K   +I+      L P+H AS  G L IV +L+ +  +    +     P+H A R    E+A  L++    + A  K++  P+H A R GH  ++ +L+    + N  T+   +P+H A    +      LLEK  +    T     P+H A   G  ++A+LL+++     +  +    P+H A  + +  +V++L+       +P  +   P+H A K N         VE+A  L++     N ++    +PL LA + G+ E++ L+  K  N N+ N   L      +QEG++  A+V+I+    ++   +    P+H A   G+I++VK LL++  +++   K   S
Sbjct:  341 PLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ--------VEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYS 736          

HSP 2 Score: 180.259 bits (456), Expect = 1.070e-44
Identity = 116/456 (25.44%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q+ L   H A + G+V    +   +E +     + G   +H A+  GQ E+++ L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +   +N       +P+H A       +   LL++G  +E+ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH A++  H   V +L+    +++  TLD + P+H A  C H+  +K                          N+V +  LL++    I+   ES  +PL +A   G+  ++  + ++  +PN++N      L  A++ G+ + A+ +++ K  +N   KDD  P+H A   GH  +VKLLL+NN 
Sbjct:   43 QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNA 494          

HSP 3 Score: 176.022 bits (445), Expect = 1.686e-43
Identity = 104/392 (26.53%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGN-EEVINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++   ++    +    +H A R  +  +  LL+ +   IE    D L P+H A+R G + I   L+     I+AK KN   PIH A + +  +   +L++ + +I+  T ++  P+H A   GH  +  +L+ K    N++    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ +G      N +   P+H A+R GH  + + L+  K  + A   D   P+H A +          +  +  LL+E N   N+   +  +PL +A   G+ E V+ L++++     MT      L  A++ G ++ AE+++ R    N   K+ + P+H A    +++IVKLLL
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAAR--------IGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 589          

HSP 4 Score: 174.866 bits (442), Expect = 4.285e-43
Identity = 103/392 (26.28%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  ++     + + P+H ASR G + +V  L+ +   IE K K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+    +++  T  + +P+H A +  +  +A  LL+KG    S   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+          +    P+H       A++AG  + E+A  L++   ++N + +  Q+PL  A   G+  ++ L+ E   NPN+  T GH  L  A++EG+++    ++ ++       K    P+H A   G + + +LLL+ + 
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHM------AARAG--HTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA 560          

HSP 5 Score: 171.014 bits (432), Expect = 6.248e-42
Identity = 113/483 (23.40%), Postives = 211/483 (43.69%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDD----FNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS 1439
            Q+ +   H A R GNV       ++  + E   K++    P+H A+R+G + I ++LLD    I A++ +    IH A +  H D   LL++    I++   D L P+H A+  G   +   L+ K     ++  N + P+H AC+ N   +  +L+K    I+A T+    P+H A   GH  I+  L+ +    N    +  +P+H A    +  +A  LL+    V +   D   P+H A   G+  + +LL++   +          P+H A+R GH   V  L+  +      T     P+H A K+          V +A LL+ER+   N   ++  +PL +A+ + N +++ L+  +  +P+    NG+  L                                   A+QEG+ +   +++ ++ + N+ +K  + P+H    +GH+ +  +L+K+   +D   +   +   V S
Sbjct:  237 QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGK--------VRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVAS 709          

HSP 6 Score: 155.606 bits (392), Expect = 3.458e-37
Identity = 96/393 (24.43%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL +    +  +      +H A R  H++VA+ L++ K  +     D   P+H A+R G  N+V  L+  + N          P+H A R    E    L++K       TK+ + P+H A +YG   +  +L+ +    NA      +P+H A ++   +I   LL +G +  S   +   P+H A      ++A+ L+  G    + + +   P+H A++ GH  +V +L++ + +        + P+H   +        + +V +A +LI+    ++       +PL +                              AS  GNIK  + +++ + D+N   K    P+H A  +GH +IV LLLKN  
Sbjct:  404 GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQ--------EGHVPVADVLIKHGVMVDATTRMGYTPLHV------------------------------ASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 758          

HSP 7 Score: 132.494 bits (332), Expect = 3.731e-30
Identity = 70/272 (25.74%), Postives = 132/272 (48.53%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA 1025
            G  P+H A+R G +E +  LL+K       +   +  +H A +     VAELL+++  +      + L P+H A  +  L+IV  L+ +  +  +   N + P+H A + NQ E+A  L++      A + +   P+H A + GHAE++ +L++K  + N       +P+H      +  +A  L++ GV V++ T     P+H A   GN ++ + L+    D+ +  +  + P+H A++ GH  +V +L+         + D   P+  A
Sbjct:  503 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 8 Score: 129.798 bits (325), Expect = 2.585e-29
Identity = 88/401 (21.95%), Postives = 182/401 (45.39%), Query Frame = 3
Query:  297 RSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENI-----------------------------ASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE---KLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            R +D   +   A R  + D A   ++   +I  C+ + L  +H AS+ G + +V  L+ K   +E   K     +H A    Q E+   LV    ++ A +++ + P++ A +  H E++  L+    + N  T   ++P+  A    +EN+                             A+ LL+   N +  +     P+H A    N  +AQLL+++G  +    +    P+H ASR G+  +V +L++    +E  T D++ P+H A +        + +V I+ +L++    I  + ++  SP+ +A +  + + + L+ +   ++++  + +   L  A+  G+ + A+V++ +    N    +   P+H AC K H+ +++LLLK    +D +
Sbjct:    8 READAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAAR--------NGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAV 400          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 191.43 bits (485), Expect = 1.173e-48
Identity = 106/395 (26.84%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSA---SQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+  G + + KLLLD+  D ++R+ + +  +H AC+++   V ELL+K +  IE      L P+H A+  G +NIV  L+ +  N + +      P+H A R NQ ++  +L++    ++A  +E   P+H A R G+ +I+ +L+    + NA T  N+SP+H A     E +A  LL+   +    T     P+H A   GN ++ +LL+++G  ++   +    P+H A+ Y +  +  +L+      +A   +   P+H A K N         +EIA+ L++     N ++ +  +PL L+ + G++E+  L+ E   +      + L +    +QE ++  A+++     +IN        P+H AC  G + +VK L++N  ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQ--------MEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 2 Score: 179.874 bits (455), Expect = 4.252e-45
Identity = 111/445 (24.94%), Postives = 217/445 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHI 1544
            P+H A+R G  +++ LL+ +   I A++ +    +H A +  H D A  L+  +  +++   D L P+H A+  G + +   L+ +S +  ++  N + P+H AC+ N+ ++  +L+K    IEA T+    P+H A   G   I+  L+ +  + + +T +  +P+H A      ++   L+  G  V++   +   P+H A   GN  I  LL+  G +  +   +N+ P+H A++ G   +  +L++   D    T     P+H A K+ +        +E+  LL+ER   ++++ +++ +PL +A    N++V  L+ E   +      NG+  L  A+++  ++ A  +++ K D N   +    P+H +  +GH EI  LL++N    D+  K N  L ++   L  +E +    +IL  NG     K N     +H+
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGN--------LEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS--DVGAKANNGLTAM--HLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 3 Score: 168.703 bits (426), Expect = 1.299e-41
Identity = 108/428 (25.23%), Postives = 206/428 (48.13%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC---------------KHNDASK----------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT---NGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G   ++ +LL+     D++      A+H A ++  +  A LL++ + N +        P+H A+ YG  N+   L+ K  N+  + +++  P+H A +  +  +A +L+ +   I++ TK+   P+H A R GH +++++L+ +   ++A+T    +P+H A   ++ + A TLL     V+  T D + P+H A   G+ ++A+LL+D+  D  S     + P+H A +     +VE+L+  +  +EA T   + P+H A                 + D             A  N  ++  +LI    +++ Q    Q+PL +A   GN +++ L+ +   N N T   N   L  A++EG  + A +++    D  +  K    P+H A   G++E+V+LLL+    +DI  K
Sbjct:  165 GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 4 Score: 160.614 bits (405), Expect = 3.551e-39
Identity = 112/422 (26.54%), Postives = 195/422 (46.21%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNAQT-------------SQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G LE +  LL    DI+  +++   ++H A +E HS+V   LIK++  ++         +H AS  G   IVT L+    N+  +  N + P++ A + N  E+   L+K   +    T++ + P+  A + GH  ++ +L+                AK  D  A T                ++P+H A +Y +EN+   LLEKG NV       + P+H A   G   +A LL+ +G  I+S  ++   P+H A+R GH  +V++L+     + A T + + P+H A +       GD +V+ A  L+     ++       +PL +A   G+  V  L+ ++  +PN    NG   L  A ++  IK  E++++ +  I    +  + P+H A   G I IV  LL+     D+
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ-------GD-HVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV 453          

HSP 5 Score: 160.229 bits (404), Expect = 4.737e-39
Identity = 97/393 (24.68%), Postives = 179/393 (45.55%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  LL +  + D  +      +H A R + +DV  +LI+    ++    +L  P+H ASR G  +IV  L+    N  A  ++++ P+H A +  Q E+A IL+  N D    TK+ + P+H A +YG+ E++ +L+ +   ++ +     +P+H A +Y  + +A  LLE G + ++   +   P+H A      +IA  L+    D  + +   + P+H +++ GH  +  +LI    D+ A   + +  +H  C   D       +V +A +L     +IN +  +  +PL +A   G    +N++K  +EN                             D+    +    P+H A  +GH   V+ LL+N  
Sbjct:  425 GLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL-CAQED-------HVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVEN---------------------------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 6 Score: 144.436 bits (363), Expect = 3.591e-34
Identity = 114/515 (22.14%), Postives = 219/515 (42.52%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRP-----------------------------IHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK-----AGD------------------NYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKEN 1583
            G   +H AS+ G  E+++ L+ +   +DA +     A+H A     S +  +L++   N+     +   P++ A++     +V  L+    N     ++ + P                             +H A + +    AT+L++   + +  +K  + P+H A  YGH  +  +L+ K  ++N Q   N SP+H A  +   N+A+ LL +G  ++S T D + P+H A  +G+ Q+  LL+ +G  I +  +    P+H A++  H      L+  +  ++  T+D + P+H A  C H   +K     + D                  N +++  LL++    I    ES  +PL +A   G   ++  + ++  NP++    G   L  A++        V+IR    ++   ++   P+H A   G+ +IV LLL+     +   + N S   + +   +EE+  I L       ++N  K  L  K       P+ ++SK  N
Sbjct:   66 GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL-------DHNADKTLLTKKG----FTPLHLASKYGN 569          

HSP 7 Score: 72.7886 bits (177), Expect = 2.216e-12
Identity = 40/163 (24.54%), Postives = 73/163 (44.79%), Query Frame = 3
Query:  177 FKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNIL 665
            FK +   K + G  P+H +++ G  EI  LL++   D+ A++++   A+H   +E H  VA++L      I         P+H A  +G LN+V  L+    ++  K +  + P+H A +         L++        T     P+  A R G+  ++  L
Sbjct:  645 FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 58.151 bits (139), Expect = 6.761e-8
Identity = 63/266 (23.68%), Postives = 115/266 (43.23%), Query Frame = 3
Query:  786 ESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            E G ++       A   G+ +    L+  G DI + N      +H AS+ GH  +V  LI  +  ++A T      +H       AS AG +   I  +L+E    +NVQ+ +  +PL +A +  +EEV+  + +   N  ++  +G   L+ A Q+G+ +   V++          K  +  +H A  K       LLL+N    D+  K   +   + +    E + ++ LE      N N+Q       A H  ++P+ +++K
Sbjct:   27 EPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHI------ASLAGQSL--IVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLE---KGANVNYQ-------ARH-NISPLHVATK 269          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 191.43 bits (485), Expect = 1.173e-48
Identity = 106/395 (26.84%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSA---SQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+  G + + KLLLD+  D ++R+ + +  +H AC+++   V ELL+K +  IE      L P+H A+  G +NIV  L+ +  N + +      P+H A R NQ ++  +L++    ++A  +E   P+H A R G+ +I+ +L+    + NA T  N+SP+H A     E +A  LL+   +    T     P+H A   GN ++ +LL+++G  ++   +    P+H A+ Y +  +  +L+      +A   +   P+H A K N         +EIA+ L++     N ++ +  +PL L+ + G++E+  L+ E   +      + L +    +QE ++  A+++     +IN        P+H AC  G + +VK L++N  ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQ--------MEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 2 Score: 179.874 bits (455), Expect = 4.252e-45
Identity = 111/445 (24.94%), Postives = 217/445 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHI 1544
            P+H A+R G  +++ LL+ +   I A++ +    +H A +  H D A  L+  +  +++   D L P+H A+  G + +   L+ +S +  ++  N + P+H AC+ N+ ++  +L+K    IEA T+    P+H A   G   I+  L+ +  + + +T +  +P+H A      ++   L+  G  V++   +   P+H A   GN  I  LL+  G +  +   +N+ P+H A++ G   +  +L++   D    T     P+H A K+ +        +E+  LL+ER   ++++ +++ +PL +A    N++V  L+ E   +      NG+  L  A+++  ++ A  +++ K D N   +    P+H +  +GH EI  LL++N    D+  K N  L ++   L  +E +    +IL  NG     K N     +H+
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGN--------LEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS--DVGAKANNGLTAM--HLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 3 Score: 168.703 bits (426), Expect = 1.299e-41
Identity = 108/428 (25.23%), Postives = 206/428 (48.13%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC---------------KHNDASK----------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT---NGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G   ++ +LL+     D++      A+H A ++  +  A LL++ + N +        P+H A+ YG  N+   L+ K  N+  + +++  P+H A +  +  +A +L+ +   I++ TK+   P+H A R GH +++++L+ +   ++A+T    +P+H A   ++ + A TLL     V+  T D + P+H A   G+ ++A+LL+D+  D  S     + P+H A +     +VE+L+  +  +EA T   + P+H A                 + D             A  N  ++  +LI    +++ Q    Q+PL +A   GN +++ L+ +   N N T   N   L  A++EG  + A +++    D  +  K    P+H A   G++E+V+LLL+    +DI  K
Sbjct:  165 GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 4 Score: 160.614 bits (405), Expect = 3.551e-39
Identity = 112/422 (26.54%), Postives = 195/422 (46.21%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNAQT-------------SQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G LE +  LL    DI+  +++   ++H A +E HS+V   LIK++  ++         +H AS  G   IVT L+    N+  +  N + P++ A + N  E+   L+K   +    T++ + P+  A + GH  ++ +L+                AK  D  A T                ++P+H A +Y +EN+   LLEKG NV       + P+H A   G   +A LL+ +G  I+S  ++   P+H A+R GH  +V++L+     + A T + + P+H A +       GD +V+ A  L+     ++       +PL +A   G+  V  L+ ++  +PN    NG   L  A ++  IK  E++++ +  I    +  + P+H A   G I IV  LL+     D+
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ-------GD-HVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV 453          

HSP 5 Score: 160.229 bits (404), Expect = 4.737e-39
Identity = 97/393 (24.68%), Postives = 179/393 (45.55%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  LL +  + D  +      +H A R + +DV  +LI+    ++    +L  P+H ASR G  +IV  L+    N  A  ++++ P+H A +  Q E+A IL+  N D    TK+ + P+H A +YG+ E++ +L+ +   ++ +     +P+H A +Y  + +A  LLE G + ++   +   P+H A      +IA  L+    D  + +   + P+H +++ GH  +  +LI    D+ A   + +  +H  C   D       +V +A +L     +IN +  +  +PL +A   G    +N++K  +EN                             D+    +    P+H A  +GH   V+ LL+N  
Sbjct:  425 GLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL-CAQED-------HVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVEN---------------------------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 6 Score: 144.436 bits (363), Expect = 3.591e-34
Identity = 114/515 (22.14%), Postives = 219/515 (42.52%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRP-----------------------------IHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK-----AGD------------------NYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKEN 1583
            G   +H AS+ G  E+++ L+ +   +DA +     A+H A     S +  +L++   N+     +   P++ A++     +V  L+    N     ++ + P                             +H A + +    AT+L++   + +  +K  + P+H A  YGH  +  +L+ K  ++N Q   N SP+H A  +   N+A+ LL +G  ++S T D + P+H A  +G+ Q+  LL+ +G  I +  +    P+H A++  H      L+  +  ++  T+D + P+H A  C H   +K     + D                  N +++  LL++    I    ES  +PL +A   G   ++  + ++  NP++    G   L  A++        V+IR    ++   ++   P+H A   G+ +IV LLL+     +   + N S   + +   +EE+  I L       ++N  K  L  K       P+ ++SK  N
Sbjct:   66 GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL-------DHNADKTLLTKKG----FTPLHLASKYGN 569          

HSP 7 Score: 72.7886 bits (177), Expect = 2.216e-12
Identity = 40/163 (24.54%), Postives = 73/163 (44.79%), Query Frame = 3
Query:  177 FKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNIL 665
            FK +   K + G  P+H +++ G  EI  LL++   D+ A++++   A+H   +E H  VA++L      I         P+H A  +G LN+V  L+    ++  K +  + P+H A +         L++        T     P+  A R G+  ++  L
Sbjct:  645 FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 58.151 bits (139), Expect = 6.761e-8
Identity = 63/266 (23.68%), Postives = 115/266 (43.23%), Query Frame = 3
Query:  786 ESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            E G ++       A   G+ +    L+  G DI + N      +H AS+ GH  +V  LI  +  ++A T      +H       AS AG +   I  +L+E    +NVQ+ +  +PL +A +  +EEV+  + +   N  ++  +G   L+ A Q+G+ +   V++          K  +  +H A  K       LLL+N    D+  K   +   + +    E + ++ LE      N N+Q       A H  ++P+ +++K
Sbjct:   27 EPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHI------ASLAGQSL--IVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLE---KGANVNYQ-------ARH-NISPLHVATK 269          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 191.43 bits (485), Expect = 1.219e-48
Identity = 106/395 (26.84%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSA---SQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+  G + + KLLLD+  D ++R+ + +  +H AC+++   V ELL+K +  IE      L P+H A+  G +NIV  L+ +  N + +      P+H A R NQ ++  +L++    ++A  +E   P+H A R G+ +I+ +L+    + NA T  N+SP+H A     E +A  LL+   +    T     P+H A   GN ++ +LL+++G  ++   +    P+H A+ Y +  +  +L+      +A   +   P+H A K         N +EIA+ L++     N ++ +  +PL L+ + G++E+  L+ E   +      + L +    +QE ++  A+++     +IN        P+H AC  G + +VK L++N  ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAK--------KNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 2 Score: 179.874 bits (455), Expect = 4.349e-45
Identity = 111/445 (24.94%), Postives = 217/445 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHI 1544
            P+H A+R G  +++ LL+ +   I A++ +    +H A +  H D A  L+  +  +++   D L P+H A+  G + +   L+ +S +  ++  N + P+H AC+ N+ ++  +L+K    IEA T+    P+H A   G   I+  L+ +  + + +T +  +P+H A      ++   L+  G  V++   +   P+H A   GN  I  LL+  G +  +   +N+ P+H A++ G   +  +L++   D    T     P+H A K+ +        +E+  LL+ER   ++++ +++ +PL +A    N++V  L+ E   +      NG+  L  A+++  ++ A  +++ K D N   +    P+H +  +GH EI  LL++N    D+  K N  L ++   L  +E +    +IL  NG     K N     +H+
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGN--------LEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS--DVGAKANNGLTAM--HLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 3 Score: 168.703 bits (426), Expect = 1.222e-41
Identity = 108/428 (25.23%), Postives = 206/428 (48.13%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC---------------KHNDASK----------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT---NGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G   ++ +LL+     D++      A+H A ++  +  A LL++ + N +        P+H A+ YG  N+   L+ K  N+  + +++  P+H A +  +  +A +L+ +   I++ TK+   P+H A R GH +++++L+ +   ++A+T    +P+H A   ++ + A TLL     V+  T D + P+H A   G+ ++A+LL+D+  D  S     + P+H A +     +VE+L+  +  +EA T   + P+H A                 + D             A  N  ++  +LI    +++ Q    Q+PL +A   GN +++ L+ +   N N T   N   L  A++EG  + A +++    D  +  K    P+H A   G++E+V+LLL+    +DI  K
Sbjct:  165 GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 4 Score: 160.614 bits (405), Expect = 3.579e-39
Identity = 112/422 (26.54%), Postives = 195/422 (46.21%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNAQT-------------SQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G LE +  LL    DI+  +++   ++H A +E HS+V   LIK++  ++         +H AS  G   IVT L+    N+  +  N + P++ A + N  E+   L+K   +    T++ + P+  A + GH  ++ +L+                AK  D  A T                ++P+H A +Y +EN+   LLEKG NV       + P+H A   G   +A LL+ +G  I+S  ++   P+H A+R GH  +V++L+     + A T + + P+H A +       GD +V+ A  L+     ++       +PL +A   G+  V  L+ ++  +PN    NG   L  A ++  IK  E++++ +  I    +  + P+H A   G I IV  LL+     D+
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ-------GD-HVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV 453          

HSP 5 Score: 159.844 bits (403), Expect = 5.655e-39
Identity = 97/393 (24.68%), Postives = 179/393 (45.55%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  LL +  + D  +      +H A R + +DV  +LI+    ++    +L  P+H ASR G  +IV  L+    N  A  ++++ P+H A +  Q E+A IL+  N D    TK+ + P+H A +YG+ E++ +L+ +   ++ +     +P+H A +Y  + +A  LLE G + ++   +   P+H A      +IA  L+    D  + +   + P+H +++ GH  +  +LI    D+ A   + +  +H  C   D       +V +A +L     +IN +  +  +PL +A   G    +N++K  +EN                             D+    +    P+H A  +GH   V+ LL+N  
Sbjct:  425 GLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL-CAQED-------HVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVEN---------------------------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 6 Score: 144.436 bits (363), Expect = 3.444e-34
Identity = 114/515 (22.14%), Postives = 219/515 (42.52%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRP-----------------------------IHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK-----AGD------------------NYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKEN 1583
            G   +H AS+ G  E+++ L+ +   +DA +     A+H A     S +  +L++   N+     +   P++ A++     +V  L+    N     ++ + P                             +H A + +    AT+L++   + +  +K  + P+H A  YGH  +  +L+ K  ++N Q   N SP+H A  +   N+A+ LL +G  ++S T D + P+H A  +G+ Q+  LL+ +G  I +  +    P+H A++  H      L+  +  ++  T+D + P+H A  C H   +K     + D                  N +++  LL++    I    ES  +PL +A   G   ++  + ++  NP++    G   L  A++        V+IR    ++   ++   P+H A   G+ +IV LLL+     +   + N S   + +   +EE+  I L       ++N  K  L  K       P+ ++SK  N
Sbjct:   66 GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL-------DHNADKTLLTKKG----FTPLHLASKYGN 569          

HSP 7 Score: 72.4034 bits (176), Expect = 2.705e-12
Identity = 40/163 (24.54%), Postives = 73/163 (44.79%), Query Frame = 3
Query:  177 FKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNIL 665
            FK +   K + G  P+H +++ G  EI  LL++   D+ A++++   A+H   +E H  VA++L      I         P+H A  +G LN+V  L+    ++  K +  + P+H A +         L++        T     P+  A R G+  ++  L
Sbjct:  645 FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 58.151 bits (139), Expect = 6.150e-8
Identity = 63/266 (23.68%), Postives = 115/266 (43.23%), Query Frame = 3
Query:  786 ESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            E G ++       A   G+ +    L+  G DI + N      +H AS+ GH  +V  LI  +  ++A T      +H       AS AG +   I  +L+E    +NVQ+ +  +PL +A +  +EEV+  + +   N  ++  +G   L+ A Q+G+ +   V++          K  +  +H A  K       LLL+N    D+  K   +   + +    E + ++ LE      N N+Q       A H  ++P+ +++K
Sbjct:   27 EPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHI------ASLAGQSL--IVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLE---KGANVNYQ-------ARH-NISPLHVATK 269          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 191.43 bits (485), Expect = 1.219e-48
Identity = 106/395 (26.84%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSA---SQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+  G + + KLLLD+  D ++R+ + +  +H AC+++   V ELL+K +  IE      L P+H A+  G +NIV  L+ +  N + +      P+H A R NQ ++  +L++    ++A  +E   P+H A R G+ +I+ +L+    + NA T  N+SP+H A     E +A  LL+   +    T     P+H A   GN ++ +LL+++G  ++   +    P+H A+ Y +  +  +L+      +A   +   P+H A K         N +EIA+ L++     N ++ +  +PL L+ + G++E+  L+ E   +      + L +    +QE ++  A+++     +IN        P+H AC  G + +VK L++N  ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAK--------KNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 2 Score: 179.874 bits (455), Expect = 4.349e-45
Identity = 111/445 (24.94%), Postives = 217/445 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHI 1544
            P+H A+R G  +++ LL+ +   I A++ +    +H A +  H D A  L+  +  +++   D L P+H A+  G + +   L+ +S +  ++  N + P+H AC+ N+ ++  +L+K    IEA T+    P+H A   G   I+  L+ +  + + +T +  +P+H A      ++   L+  G  V++   +   P+H A   GN  I  LL+  G +  +   +N+ P+H A++ G   +  +L++   D    T     P+H A K+ +        +E+  LL+ER   ++++ +++ +PL +A    N++V  L+ E   +      NG+  L  A+++  ++ A  +++ K D N   +    P+H +  +GH EI  LL++N    D+  K N  L ++   L  +E +    +IL  NG     K N     +H+
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGN--------LEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS--DVGAKANNGLTAM--HLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 3 Score: 168.703 bits (426), Expect = 1.222e-41
Identity = 108/428 (25.23%), Postives = 206/428 (48.13%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC---------------KHNDASK----------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT---NGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G   ++ +LL+     D++      A+H A ++  +  A LL++ + N +        P+H A+ YG  N+   L+ K  N+  + +++  P+H A +  +  +A +L+ +   I++ TK+   P+H A R GH +++++L+ +   ++A+T    +P+H A   ++ + A TLL     V+  T D + P+H A   G+ ++A+LL+D+  D  S     + P+H A +     +VE+L+  +  +EA T   + P+H A                 + D             A  N  ++  +LI    +++ Q    Q+PL +A   GN +++ L+ +   N N T   N   L  A++EG  + A +++    D  +  K    P+H A   G++E+V+LLL+    +DI  K
Sbjct:  165 GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 4 Score: 160.614 bits (405), Expect = 3.579e-39
Identity = 112/422 (26.54%), Postives = 195/422 (46.21%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNAQT-------------SQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G LE +  LL    DI+  +++   ++H A +E HS+V   LIK++  ++         +H AS  G   IVT L+    N+  +  N + P++ A + N  E+   L+K   +    T++ + P+  A + GH  ++ +L+                AK  D  A T                ++P+H A +Y +EN+   LLEKG NV       + P+H A   G   +A LL+ +G  I+S  ++   P+H A+R GH  +V++L+     + A T + + P+H A +       GD +V+ A  L+     ++       +PL +A   G+  V  L+ ++  +PN    NG   L  A ++  IK  E++++ +  I    +  + P+H A   G I IV  LL+     D+
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ-------GD-HVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV 453          

HSP 5 Score: 159.844 bits (403), Expect = 5.655e-39
Identity = 97/393 (24.68%), Postives = 179/393 (45.55%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  LL +  + D  +      +H A R + +DV  +LI+    ++    +L  P+H ASR G  +IV  L+    N  A  ++++ P+H A +  Q E+A IL+  N D    TK+ + P+H A +YG+ E++ +L+ +   ++ +     +P+H A +Y  + +A  LLE G + ++   +   P+H A      +IA  L+    D  + +   + P+H +++ GH  +  +LI    D+ A   + +  +H  C   D       +V +A +L     +IN +  +  +PL +A   G    +N++K  +EN                             D+    +    P+H A  +GH   V+ LL+N  
Sbjct:  425 GLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL-CAQED-------HVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVEN---------------------------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 6 Score: 144.436 bits (363), Expect = 3.444e-34
Identity = 114/515 (22.14%), Postives = 219/515 (42.52%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRP-----------------------------IHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK-----AGD------------------NYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKEN 1583
            G   +H AS+ G  E+++ L+ +   +DA +     A+H A     S +  +L++   N+     +   P++ A++     +V  L+    N     ++ + P                             +H A + +    AT+L++   + +  +K  + P+H A  YGH  +  +L+ K  ++N Q   N SP+H A  +   N+A+ LL +G  ++S T D + P+H A  +G+ Q+  LL+ +G  I +  +    P+H A++  H      L+  +  ++  T+D + P+H A  C H   +K     + D                  N +++  LL++    I    ES  +PL +A   G   ++  + ++  NP++    G   L  A++        V+IR    ++   ++   P+H A   G+ +IV LLL+     +   + N S   + +   +EE+  I L       ++N  K  L  K       P+ ++SK  N
Sbjct:   66 GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL-------DHNADKTLLTKKG----FTPLHLASKYGN 569          

HSP 7 Score: 72.4034 bits (176), Expect = 2.705e-12
Identity = 40/163 (24.54%), Postives = 73/163 (44.79%), Query Frame = 3
Query:  177 FKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNIL 665
            FK +   K + G  P+H +++ G  EI  LL++   D+ A++++   A+H   +E H  VA++L      I         P+H A  +G LN+V  L+    ++  K +  + P+H A +         L++        T     P+  A R G+  ++  L
Sbjct:  645 FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 58.151 bits (139), Expect = 6.150e-8
Identity = 63/266 (23.68%), Postives = 115/266 (43.23%), Query Frame = 3
Query:  786 ESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            E G ++       A   G+ +    L+  G DI + N      +H AS+ GH  +V  LI  +  ++A T      +H       AS AG +   I  +L+E    +NVQ+ +  +PL +A +  +EEV+  + +   N  ++  +G   L+ A Q+G+ +   V++          K  +  +H A  K       LLL+N    D+  K   +   + +    E + ++ LE      N N+Q       A H  ++P+ +++K
Sbjct:   27 EPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHI------ASLAGQSL--IVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLE---KGANVNYQ-------ARH-NISPLHVATK 269          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 191.43 bits (485), Expect = 1.396e-48
Identity = 106/395 (26.84%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSA---SQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+  G + + KLLLD+  D ++R+ + +  +H AC+++   V ELL+K +  IE      L P+H A+  G +NIV  L+ +  N + +      P+H A R NQ ++  +L++    ++A  +E   P+H A R G+ +I+ +L+    + NA T  N+SP+H A     E +A  LL+   +    T     P+H A   GN ++ +LL+++G  ++   +    P+H A+ Y +  +  +L+      +A   +   P+H A K         N +EIA+ L++     N ++ +  +PL L+ + G++E+  L+ E   +      + L +    +QE ++  A+++     +IN        P+H AC  G + +VK L++N  ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAK--------KNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV 748          

HSP 2 Score: 179.874 bits (455), Expect = 5.094e-45
Identity = 111/445 (24.94%), Postives = 217/445 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHI 1544
            P+H A+R G  +++ LL+ +   I A++ +    +H A +  H D A  L+  +  +++   D L P+H A+  G + +   L+ +S +  ++  N + P+H AC+ N+ ++  +L+K    IEA T+    P+H A   G   I+  L+ +  + + +T +  +P+H A      ++   L+  G  V++   +   P+H A   GN  I  LL+  G +  +   +N+ P+H A++ G   +  +L++   D    T     P+H A K+ +        +E+  LL+ER   ++++ +++ +PL +A    N++V  L+ E   +      NG+  L  A+++  ++ A  +++ K D N   +    P+H +  +GH EI  LL++N    D+  K N  L ++   L  +E +    +IL  NG     K N     +H+
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGN--------LEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS--DVGAKANNGLTAM--HLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHV 728          

HSP 3 Score: 168.318 bits (425), Expect = 1.780e-41
Identity = 108/428 (25.23%), Postives = 206/428 (48.13%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC---------------KHNDASK----------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT---NGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G   ++ +LL+     D++      A+H A ++  +  A LL++ + N +        P+H A+ YG  N+   L+ K  N+  + +++  P+H A +  +  +A +L+ +   I++ TK+   P+H A R GH +++++L+ +   ++A+T    +P+H A   ++ + A TLL     V+  T D + P+H A   G+ ++A+LL+D+  D  S     + P+H A +     +VE+L+  +  +EA T   + P+H A                 + D             A  N  ++  +LI    +++ Q    Q+PL +A   GN +++ L+ +   N N T   N   L  A++EG  + A +++    D  +  K    P+H A   G++E+V+LLL+    +DI  K
Sbjct:  165 GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK 588          

HSP 4 Score: 160.229 bits (404), Expect = 4.620e-39
Identity = 112/422 (26.54%), Postives = 195/422 (46.21%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNAQT-------------SQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G LE +  LL    DI+  +++   ++H A +E HS+V   LIK++  ++         +H AS  G   IVT L+    N+  +  N + P++ A + N  E+   L+K   +    T++ + P+  A + GH  ++ +L+                AK  D  A T                ++P+H A +Y +EN+   LLEKG NV       + P+H A   G   +A LL+ +G  I+S  ++   P+H A+R GH  +V++L+     + A T + + P+H A +       GD +V+ A  L+     ++       +PL +A   G+  V  L+ ++  +PN    NG   L  A ++  IK  E++++ +  I    +  + P+H A   G I IV  LL+     D+
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQ-------GD-HVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV 453          

HSP 5 Score: 159.844 bits (403), Expect = 5.906e-39
Identity = 97/393 (24.68%), Postives = 179/393 (45.55%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  LL +  + D  +      +H A R + +DV  +LI+    ++    +L  P+H ASR G  +IV  L+    N  A  ++++ P+H A +  Q E+A IL+  N D    TK+ + P+H A +YG+ E++ +L+ +   ++ +     +P+H A +Y  + +A  LLE G + ++   +   P+H A      +IA  L+    D  + +   + P+H +++ GH  +  +LI    D+ A   + +  +H  C   D       +V +A +L     +IN +  +  +PL +A   G    +N++K  +EN                             D+    +    P+H A  +GH   V+ LL+N  
Sbjct:  425 GLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL-CAQED-------HVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQ---LNMVKFLVEN---------------------------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 6 Score: 144.05 bits (362), Expect = 4.321e-34
Identity = 115/518 (22.20%), Postives = 221/518 (42.66%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRP-----------------------------IHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK-----AGD------------------NYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM------TNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKEN 1583
            G   +H AS+ G  E+++ L+ +   +DA +     A+H A     S +  +L++   N+     +   P++ A++     +V  L+    N     ++ + P                             +H A + +    AT+L++   + +  +K  + P+H A  YGH  +  +L+ K  ++N Q   N SP+H A  +   N+A+ LL +G  ++S T D + P+H A  +G+ Q+  LL+ +G  I +  +    P+H A++  H      L+  +  ++  T+D + P+H A  C H   +K     + D                  N +++  LL++    I    ES  +PL +A   G   ++  + ++  NP++      T  H    A+Q   ++   V+IR    ++   ++   P+H A   G+ +IV LLL+     +   + N S   + +   +EE+  I L       ++N  K  L  K       P+ ++SK  N
Sbjct:   66 GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVR---VLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL-------DHNADKTLLTKKG----FTPLHLASKYGN 569          

HSP 7 Score: 72.4034 bits (176), Expect = 2.500e-12
Identity = 40/163 (24.54%), Postives = 73/163 (44.79%), Query Frame = 3
Query:  177 FKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNIL 665
            FK +   K + G  P+H +++ G  EI  LL++   D+ A++++   A+H   +E H  VA++L      I         P+H A  +G LN+V  L+    ++  K +  + P+H A +         L++        T     P+  A R G+  ++  L
Sbjct:  645 FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 8 Score: 57.7658 bits (138), Expect = 7.371e-8
Identity = 63/266 (23.68%), Postives = 115/266 (43.23%), Query Frame = 3
Query:  786 ESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            E G ++       A   G+ +    L+  G DI + N      +H AS+ GH  +V  LI  +  ++A T      +H       AS AG +   I  +L+E    +NVQ+ +  +PL +A +  +EEV+  + +   N  ++  +G   L+ A Q+G+ +   V++          K  +  +H A  K       LLL+N    D+  K   +   + +    E + ++ LE      N N+Q       A H  ++P+ +++K
Sbjct:   27 EPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHI------ASLAGQSL--IVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLE---KGANVNYQ-------ARH-NISPLHVATK 269          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 199.904 bits (507), Expect = 3.611e-51
Identity = 116/395 (29.37%), Postives = 208/395 (52.66%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            +H A+  G +++ KLLLD   + +AR+ + +  +H AC+++   + ELLIK   NI       L P+H AS  G +NIV  L+    + +        P+H A R NQ +I  IL++ +  ++A  +E   P+H A R G+  I+ +L+    ++NAQ++  +S +H A     ENI   LLE G    + T     P+H AC  G   + Q+L+  G  I+   + +  P+H A+ Y + ++VE+L+           +    IH ACK         NY+EIA  L++    +N+ ++S  SPL LA + GN +++ L+ E  + +    NG   L  A+QEG++  +++++    +I+   ++   P+H A   GH+++VK  ++N+ ++++
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACK--------KNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEM 755          

HSP 2 Score: 155.992 bits (393), Expect = 1.151e-37
Identity = 96/391 (24.55%), Postives = 190/391 (48.59%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLL-SASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            G  P+H AS  G + I+  LL      D  +      +H A R + +D+  +L++    ++    +   P+H ASR G +NI+  L+     I A+  + +  +H A +  Q  I  +L++   +  A TK+ + P+H AC+YG   ++ IL+     ++ Q   + +P+H A +Y   +I   LL+ G +      +    IH AC     +IA  L+  G D+   ++  + P+H A++ G+  +V++L+     + A   + + P+H A        A + +V ++ +L+E    I+ +  +  +PL +A   G+ +++    E   +  M++  G+  L  A+Q+G+I    +++R K + N   KD    +H A   G++ +++ L
Sbjct:  432 GLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVA--------AQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 3 Score: 154.066 bits (388), Expect = 4.076e-37
Identity = 107/436 (24.54%), Postives = 194/436 (44.50%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMR---------------------------------PIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +I+ +LL+     D R      A+H A +++  + A+LL++   N +        P+H A+ YG ++I T L+    ++    K++  P+H AC+  +  + T+L+ +   I+A T++   P+H A R GH E++  L+ +   +  +T    S +H A   E++  A  LL+    V+  T D +                                  P+H AC     ++ +LLI  G +I +  E    P+H AS  G   +V  L+  +   + PT+    P+H A + N A        +I  +L+ R+ +++      Q+PL +A   GN  +I L+ +     N  +  +   L  A++EG     +V++    + N   K    P+H AC  G   +V++LL+N   +D   K
Sbjct:  172 GFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQA--------DIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594          

HSP 4 Score: 152.14 bits (383), Expect = 1.769e-36
Identity = 107/398 (26.88%), Postives = 191/398 (47.99%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNG--NFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI-NAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMT-NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNN 1385
            G  P+H A+ +G ++I  LLL+   D++  +  N   +H AC+     +  LL+ +   I+    D L P+H ASR G + ++  L+ ++  I  K KN    +H A +    E A +L+     ++  T +    +H A   GH ++  +L+    + NA+    ++P+H AC      +   L++ G N+ + T   + P+H A   G  N  I  L  +   D+ +   E   P+H A+R     ++ +L+ +AK D  A   +   P+H       AS+ G+  + I  LL++   +IN Q+  K S L +A + G E ++  L++   EN  +T  G   L  A + G     +++++    I+   K+D+ P+H A    +  IV+LLLKN 
Sbjct:  234 GFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGET--PLHLAARANQADIIRILLRSAKVD--AIAREGQTPLHV------ASRLGN--INIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNG 619          

HSP 5 Score: 135.191 bits (339), Expect = 2.746e-31
Identity = 106/483 (21.95%), Postives = 205/483 (42.44%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQI---------------------------------AQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENG--NEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN-------WQKLNLVCK 1532
            G   +H AS  GQ +++  L+  + +++ +S + +  ++ A +E+H +    L+    N      D   P+  A + G   IV  L+      + + K     +H A + N    A +L++ + + +  +K  + P+H A  YG+ +I  +L+    D+N     N +P+H AC +   ++ + LL +G  +++ T D + P+H A  +G+ ++                                 A LL+D    ++    +    +H A+  GH  + ++L++ K +  A  L+   P+H ACK         N +++  LLI+    I    ES  +PL +A   G  N  +  L  E   +     G   L  +   N      ++ R   ++   ++   P+H A   G+I I+ LLL++  E++       S   + +   +E + ++ LE    NG  N       +  L+L CK
Sbjct:  106 GNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACK--------KNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLE----NGAENNAVTKKGFTPLHLACK 572          

HSP 6 Score: 100.523 bits (249), Expect = 9.418e-21
Identity = 81/351 (23.08%), Postives = 154/351 (43.87%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLI--GKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQI-----------------------------AQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS----ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            A+R G +  V   +  G+  +I + + N    +H A ++   +I   L+++   I+  TK+    +H A   G  +++N L+    ++N Q+   ++P++ A    ++N   TLL  G N    T D   P+  A   G+ +I                             A+LL+    + +  ++  + P+H A+ YG+  +  +L+N K D+       + P+H ACK    S        +  LL+ R  +I+       +PL  A  +G+ EVI  + ++   P +T     LS    A+Q  + + A +++  K  ++    D +  +H A   GH+++ KLLL
Sbjct:   45 AARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLS--------LCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQ-NAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLL 386          

HSP 7 Score: 52.7582 bits (125), Expect = 3.385e-6
Identity = 25/91 (27.47%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  195 EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSL 467
            E+ + G  P+H A+ +G L+++K  ++   DI+  S+  +  +H A ++ H  +  LL++ K N      D    +H AS  G + ++ SL
Sbjct:  722 ERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 199.904 bits (507), Expect = 3.611e-51
Identity = 116/395 (29.37%), Postives = 208/395 (52.66%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            +H A+  G +++ KLLLD   + +AR+ + +  +H AC+++   + ELLIK   NI       L P+H AS  G +NIV  L+    + +        P+H A R NQ +I  IL++ +  ++A  +E   P+H A R G+  I+ +L+    ++NAQ++  +S +H A     ENI   LLE G    + T     P+H AC  G   + Q+L+  G  I+   + +  P+H A+ Y + ++VE+L+           +    IH ACK         NY+EIA  L++    +N+ ++S  SPL LA + GN +++ L+ E  + +    NG   L  A+QEG++  +++++    +I+   ++   P+H A   GH+++VK  ++N+ ++++
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACK--------KNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEM 755          

HSP 2 Score: 155.992 bits (393), Expect = 1.151e-37
Identity = 96/391 (24.55%), Postives = 190/391 (48.59%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLL-SASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            G  P+H AS  G + I+  LL      D  +      +H A R + +D+  +L++    ++    +   P+H ASR G +NI+  L+     I A+  + +  +H A +  Q  I  +L++   +  A TK+ + P+H AC+YG   ++ IL+     ++ Q   + +P+H A +Y   +I   LL+ G +      +    IH AC     +IA  L+  G D+   ++  + P+H A++ G+  +V++L+     + A   + + P+H A        A + +V ++ +L+E    I+ +  +  +PL +A   G+ +++    E   +  M++  G+  L  A+Q+G+I    +++R K + N   KD    +H A   G++ +++ L
Sbjct:  432 GLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVA--------AQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 3 Score: 154.066 bits (388), Expect = 4.076e-37
Identity = 107/436 (24.54%), Postives = 194/436 (44.50%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMR---------------------------------PIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +I+ +LL+     D R      A+H A +++  + A+LL++   N +        P+H A+ YG ++I T L+    ++    K++  P+H AC+  +  + T+L+ +   I+A T++   P+H A R GH E++  L+ +   +  +T    S +H A   E++  A  LL+    V+  T D +                                  P+H AC     ++ +LLI  G +I +  E    P+H AS  G   +V  L+  +   + PT+    P+H A + N A        +I  +L+ R+ +++      Q+PL +A   GN  +I L+ +     N  +  +   L  A++EG     +V++    + N   K    P+H AC  G   +V++LL+N   +D   K
Sbjct:  172 GFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQA--------DIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594          

HSP 4 Score: 152.14 bits (383), Expect = 1.769e-36
Identity = 107/398 (26.88%), Postives = 191/398 (47.99%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNG--NFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI-NAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMT-NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNN 1385
            G  P+H A+ +G ++I  LLL+   D++  +  N   +H AC+     +  LL+ +   I+    D L P+H ASR G + ++  L+ ++  I  K KN    +H A +    E A +L+     ++  T +    +H A   GH ++  +L+    + NA+    ++P+H AC      +   L++ G N+ + T   + P+H A   G  N  I  L  +   D+ +   E   P+H A+R     ++ +L+ +AK D  A   +   P+H       AS+ G+  + I  LL++   +IN Q+  K S L +A + G E ++  L++   EN  +T  G   L  A + G     +++++    I+   K+D+ P+H A    +  IV+LLLKN 
Sbjct:  234 GFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGET--PLHLAARANQADIIRILLRSAKVD--AIAREGQTPLHV------ASRLGN--INIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNG 619          

HSP 5 Score: 135.191 bits (339), Expect = 2.746e-31
Identity = 106/483 (21.95%), Postives = 205/483 (42.44%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQI---------------------------------AQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENG--NEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN-------WQKLNLVCK 1532
            G   +H AS  GQ +++  L+  + +++ +S + +  ++ A +E+H +    L+    N      D   P+  A + G   IV  L+      + + K     +H A + N    A +L++ + + +  +K  + P+H A  YG+ +I  +L+    D+N     N +P+H AC +   ++ + LL +G  +++ T D + P+H A  +G+ ++                                 A LL+D    ++    +    +H A+  GH  + ++L++ K +  A  L+   P+H ACK         N +++  LLI+    I    ES  +PL +A   G  N  +  L  E   +     G   L  +   N      ++ R   ++   ++   P+H A   G+I I+ LLL++  E++       S   + +   +E + ++ LE    NG  N       +  L+L CK
Sbjct:  106 GNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACK--------KNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLE----NGAENNAVTKKGFTPLHLACK 572          

HSP 6 Score: 100.523 bits (249), Expect = 9.418e-21
Identity = 81/351 (23.08%), Postives = 154/351 (43.87%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLI--GKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQI-----------------------------AQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS----ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            A+R G +  V   +  G+  +I + + N    +H A ++   +I   L+++   I+  TK+    +H A   G  +++N L+    ++N Q+   ++P++ A    ++N   TLL  G N    T D   P+  A   G+ +I                             A+LL+    + +  ++  + P+H A+ YG+  +  +L+N K D+       + P+H ACK    S        +  LL+ R  +I+       +PL  A  +G+ EVI  + ++   P +T     LS    A+Q  + + A +++  K  ++    D +  +H A   GH+++ KLLL
Sbjct:   45 AARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLS--------LCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQ-NAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLL 386          

HSP 7 Score: 52.7582 bits (125), Expect = 3.385e-6
Identity = 25/91 (27.47%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  195 EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSL 467
            E+ + G  P+H A+ +G L+++K  ++   DI+  S+  +  +H A ++ H  +  LL++ K N      D    +H AS  G + ++ SL
Sbjct:  722 ERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 199.904 bits (507), Expect = 3.611e-51
Identity = 116/395 (29.37%), Postives = 208/395 (52.66%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            +H A+  G +++ KLLLD   + +AR+ + +  +H AC+++   + ELLIK   NI       L P+H AS  G +NIV  L+    + +        P+H A R NQ +I  IL++ +  ++A  +E   P+H A R G+  I+ +L+    ++NAQ++  +S +H A     ENI   LLE G    + T     P+H AC  G   + Q+L+  G  I+   + +  P+H A+ Y + ++VE+L+           +    IH ACK         NY+EIA  L++    +N+ ++S  SPL LA + GN +++ L+ E  + +    NG   L  A+QEG++  +++++    +I+   ++   P+H A   GH+++VK  ++N+ ++++
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACK--------KNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEM 755          

HSP 2 Score: 155.992 bits (393), Expect = 1.151e-37
Identity = 96/391 (24.55%), Postives = 190/391 (48.59%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLL-SASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            G  P+H AS  G + I+  LL      D  +      +H A R + +D+  +L++    ++    +   P+H ASR G +NI+  L+     I A+  + +  +H A +  Q  I  +L++   +  A TK+ + P+H AC+YG   ++ IL+     ++ Q   + +P+H A +Y   +I   LL+ G +      +    IH AC     +IA  L+  G D+   ++  + P+H A++ G+  +V++L+     + A   + + P+H A        A + +V ++ +L+E    I+ +  +  +PL +A   G+ +++    E   +  M++  G+  L  A+Q+G+I    +++R K + N   KD    +H A   G++ +++ L
Sbjct:  432 GLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVA--------AQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 3 Score: 154.066 bits (388), Expect = 4.076e-37
Identity = 107/436 (24.54%), Postives = 194/436 (44.50%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMR---------------------------------PIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +I+ +LL+     D R      A+H A +++  + A+LL++   N +        P+H A+ YG ++I T L+    ++    K++  P+H AC+  +  + T+L+ +   I+A T++   P+H A R GH E++  L+ +   +  +T    S +H A   E++  A  LL+    V+  T D +                                  P+H AC     ++ +LLI  G +I +  E    P+H AS  G   +V  L+  +   + PT+    P+H A + N A        +I  +L+ R+ +++      Q+PL +A   GN  +I L+ +     N  +  +   L  A++EG     +V++    + N   K    P+H AC  G   +V++LL+N   +D   K
Sbjct:  172 GFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQA--------DIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594          

HSP 4 Score: 152.14 bits (383), Expect = 1.769e-36
Identity = 107/398 (26.88%), Postives = 191/398 (47.99%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNG--NFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI-NAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMT-NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNN 1385
            G  P+H A+ +G ++I  LLL+   D++  +  N   +H AC+     +  LL+ +   I+    D L P+H ASR G + ++  L+ ++  I  K KN    +H A +    E A +L+     ++  T +    +H A   GH ++  +L+    + NA+    ++P+H AC      +   L++ G N+ + T   + P+H A   G  N  I  L  +   D+ +   E   P+H A+R     ++ +L+ +AK D  A   +   P+H       AS+ G+  + I  LL++   +IN Q+  K S L +A + G E ++  L++   EN  +T  G   L  A + G     +++++    I+   K+D+ P+H A    +  IV+LLLKN 
Sbjct:  234 GFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGET--PLHLAARANQADIIRILLRSAKVD--AIAREGQTPLHV------ASRLGN--INIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNG 619          

HSP 5 Score: 135.191 bits (339), Expect = 2.746e-31
Identity = 106/483 (21.95%), Postives = 205/483 (42.44%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQI---------------------------------AQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENG--NEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN-------WQKLNLVCK 1532
            G   +H AS  GQ +++  L+  + +++ +S + +  ++ A +E+H +    L+    N      D   P+  A + G   IV  L+      + + K     +H A + N    A +L++ + + +  +K  + P+H A  YG+ +I  +L+    D+N     N +P+H AC +   ++ + LL +G  +++ T D + P+H A  +G+ ++                                 A LL+D    ++    +    +H A+  GH  + ++L++ K +  A  L+   P+H ACK         N +++  LLI+    I    ES  +PL +A   G  N  +  L  E   +     G   L  +   N      ++ R   ++   ++   P+H A   G+I I+ LLL++  E++       S   + +   +E + ++ LE    NG  N       +  L+L CK
Sbjct:  106 GNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACK--------KNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLE----NGAENNAVTKKGFTPLHLACK 572          

HSP 6 Score: 100.523 bits (249), Expect = 9.418e-21
Identity = 81/351 (23.08%), Postives = 154/351 (43.87%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLI--GKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQI-----------------------------AQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS----ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            A+R G +  V   +  G+  +I + + N    +H A ++   +I   L+++   I+  TK+    +H A   G  +++N L+    ++N Q+   ++P++ A    ++N   TLL  G N    T D   P+  A   G+ +I                             A+LL+    + +  ++  + P+H A+ YG+  +  +L+N K D+       + P+H ACK    S        +  LL+ R  +I+       +PL  A  +G+ EVI  + ++   P +T     LS    A+Q  + + A +++  K  ++    D +  +H A   GH+++ KLLL
Sbjct:   45 AARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLS--------LCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQ-NAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLL 386          

HSP 7 Score: 52.7582 bits (125), Expect = 3.385e-6
Identity = 25/91 (27.47%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  195 EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSL 467
            E+ + G  P+H A+ +G L+++K  ++   DI+  S+  +  +H A ++ H  +  LL++ K N      D    +H AS  G + ++ SL
Sbjct:  722 ERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 199.904 bits (507), Expect = 3.611e-51
Identity = 116/395 (29.37%), Postives = 208/395 (52.66%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            +H A+  G +++ KLLLD   + +AR+ + +  +H AC+++   + ELLIK   NI       L P+H AS  G +NIV  L+    + +        P+H A R NQ +I  IL++ +  ++A  +E   P+H A R G+  I+ +L+    ++NAQ++  +S +H A     ENI   LLE G    + T     P+H AC  G   + Q+L+  G  I+   + +  P+H A+ Y + ++VE+L+           +    IH ACK         NY+EIA  L++    +N+ ++S  SPL LA + GN +++ L+ E  + +    NG   L  A+QEG++  +++++    +I+   ++   P+H A   GH+++VK  ++N+ ++++
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACK--------KNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEM 755          

HSP 2 Score: 155.992 bits (393), Expect = 1.151e-37
Identity = 96/391 (24.55%), Postives = 190/391 (48.59%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLL-SASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            G  P+H AS  G + I+  LL      D  +      +H A R + +D+  +L++    ++    +   P+H ASR G +NI+  L+     I A+  + +  +H A +  Q  I  +L++   +  A TK+ + P+H AC+YG   ++ IL+     ++ Q   + +P+H A +Y   +I   LL+ G +      +    IH AC     +IA  L+  G D+   ++  + P+H A++ G+  +V++L+     + A   + + P+H A        A + +V ++ +L+E    I+ +  +  +PL +A   G+ +++    E   +  M++  G+  L  A+Q+G+I    +++R K + N   KD    +H A   G++ +++ L
Sbjct:  432 GLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVA--------AQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 3 Score: 154.066 bits (388), Expect = 4.076e-37
Identity = 107/436 (24.54%), Postives = 194/436 (44.50%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMR---------------------------------PIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +I+ +LL+     D R      A+H A +++  + A+LL++   N +        P+H A+ YG ++I T L+    ++    K++  P+H AC+  +  + T+L+ +   I+A T++   P+H A R GH E++  L+ +   +  +T    S +H A   E++  A  LL+    V+  T D +                                  P+H AC     ++ +LLI  G +I +  E    P+H AS  G   +V  L+  +   + PT+    P+H A + N A        +I  +L+ R+ +++      Q+PL +A   GN  +I L+ +     N  +  +   L  A++EG     +V++    + N   K    P+H AC  G   +V++LL+N   +D   K
Sbjct:  172 GFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQA--------DIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594          

HSP 4 Score: 152.14 bits (383), Expect = 1.769e-36
Identity = 107/398 (26.88%), Postives = 191/398 (47.99%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNG--NFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI-NAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMT-NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNN 1385
            G  P+H A+ +G ++I  LLL+   D++  +  N   +H AC+     +  LL+ +   I+    D L P+H ASR G + ++  L+ ++  I  K KN    +H A +    E A +L+     ++  T +    +H A   GH ++  +L+    + NA+    ++P+H AC      +   L++ G N+ + T   + P+H A   G  N  I  L  +   D+ +   E   P+H A+R     ++ +L+ +AK D  A   +   P+H       AS+ G+  + I  LL++   +IN Q+  K S L +A + G E ++  L++   EN  +T  G   L  A + G     +++++    I+   K+D+ P+H A    +  IV+LLLKN 
Sbjct:  234 GFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGET--PLHLAARANQADIIRILLRSAKVD--AIAREGQTPLHV------ASRLGN--INIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNG 619          

HSP 5 Score: 135.191 bits (339), Expect = 2.746e-31
Identity = 106/483 (21.95%), Postives = 205/483 (42.44%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQI---------------------------------AQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENG--NEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN-------WQKLNLVCK 1532
            G   +H AS  GQ +++  L+  + +++ +S + +  ++ A +E+H +    L+    N      D   P+  A + G   IV  L+      + + K     +H A + N    A +L++ + + +  +K  + P+H A  YG+ +I  +L+    D+N     N +P+H AC +   ++ + LL +G  +++ T D + P+H A  +G+ ++                                 A LL+D    ++    +    +H A+  GH  + ++L++ K +  A  L+   P+H ACK         N +++  LLI+    I    ES  +PL +A   G  N  +  L  E   +     G   L  +   N      ++ R   ++   ++   P+H A   G+I I+ LLL++  E++       S   + +   +E + ++ LE    NG  N       +  L+L CK
Sbjct:  106 GNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACK--------KNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLE----NGAENNAVTKKGFTPLHLACK 572          

HSP 6 Score: 100.523 bits (249), Expect = 9.418e-21
Identity = 81/351 (23.08%), Postives = 154/351 (43.87%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLI--GKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQI-----------------------------AQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS----ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            A+R G +  V   +  G+  +I + + N    +H A ++   +I   L+++   I+  TK+    +H A   G  +++N L+    ++N Q+   ++P++ A    ++N   TLL  G N    T D   P+  A   G+ +I                             A+LL+    + +  ++  + P+H A+ YG+  +  +L+N K D+       + P+H ACK    S        +  LL+ R  +I+       +PL  A  +G+ EVI  + ++   P +T     LS    A+Q  + + A +++  K  ++    D +  +H A   GH+++ KLLL
Sbjct:   45 AARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLS--------LCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQ-NAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLL 386          

HSP 7 Score: 52.7582 bits (125), Expect = 3.385e-6
Identity = 25/91 (27.47%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  195 EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSL 467
            E+ + G  P+H A+ +G L+++K  ++   DI+  S+  +  +H A ++ H  +  LL++ K N      D    +H AS  G + ++ SL
Sbjct:  722 ERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 189.119 bits (479), Expect = 3.762e-48
Identity = 104/395 (26.33%), Postives = 198/395 (50.13%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLI---KEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G + + KLLLD++ D +AR+ + +  +H AC+++   V ELL++   +I       L P+H A+  G +NIV  L+    + +        P+H A R NQ +I  IL++    ++A  +E   P+H A R G+ +I+ +L+     ++A T   ++ +H A     + +A+ L+E G  +++ T     P+H     G+ ++AQLL+ K  D+++  +    P+H A  Y +  +  +L+       A   +   P+H A +         N ++IA  L+E     N ++++  +PL L+ + G+ E+ NL+   K  + +P       +   +QE N+  AE++ +   +I++  K    P+H A   G   +V+ LL+N   +D
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAAR--------KNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVD 727          

HSP 2 Score: 184.882 bits (468), Expect = 8.709e-47
Identity = 117/475 (24.63%), Postives = 228/475 (48.00%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISS--KKENKCRFYLNN 1607
            K + G  P+H A+R G  +++ +LL++   I A++ +    +H A +  H D A +L+  +  ++E   D L  +H A+  G + +   L+ ++ +  A+  N + P+H AC+ N+ ++  +L++    I A T+    P+H A   G   I+  L+      +  T +  +P+H A      +I   LL  G  V++   ++  P+H A   GN  I  LL+  G  +++  ++ +  +H A++ G   +  +LI     ++A T     P+H   K+         ++++A LL+++   ++ Q ++  +PL +A    N++V  L+ EK  +P+ T  NGH  L  A+++  +  A  ++      N   K    P+H +  +GH EI  LL+++   ++   K   +   + +    +E N    EIL  NG N    +++  KA +    P+ ++S   + N  RF L N
Sbjct:  267 KTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKY--------GHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCA----QEDNVNVAEILEKNGAN----IDMATKAGY---TPLHVASHFGQANMVRFLLQN 722          

HSP 3 Score: 175.252 bits (443), Expect = 7.518e-44
Identity = 137/610 (22.46%), Postives = 263/610 (43.11%), Query Frame = 3
Query:  114 DDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRY---------------------------------GHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM------TNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE---ILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKENKCRFYLNNFYFPNEGVGKTQSEANCNAVEKFLNTFVNISKISSTTDYILNNHDVRFEVVSKAETQKITNQNGNLPL 1811
            + L   H A + G++   ++  +   +     + G   +H AS  GQ E++KLLL+ +  ++ +S + +  ++ A +E+H  V  LL+    N      D   P+  A + G   +V  L+      + + K     +H A + +  + AT+L+  + + +  +K  + P+H A  YG+  I N+L+ K  D+N     N SP+H A  +   N+ S LLEKG N+E+ T D + P+H A  +G+ Q+  +L+++G  I +  +    P+H A++                                  GH  + ++L++   D  A  L+   P+H ACK         N +++  LL+     I+   ES  +PL +A   G   ++  + +   +P++      T  H    A+Q   I+   +++R    ++   ++   P+H A   G+++IV LLL++  ++D   K   +   + +   ++E+  + +E    L       +  L+L  K  HIK+  + +                         Q EA+ +A  K       ++ +     Y  NN  V   ++ K  +   T +NG+ PL
Sbjct:   43 NGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACK--------KNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIR---ILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL-------------------------QKEADVDAQGKN-----GVTPLHVACHY--NNQQVALLLLEKGASPHATAKNGHTPL 605          

HSP 4 Score: 167.933 bits (424), Expect = 1.427e-41
Identity = 96/391 (24.55%), Postives = 188/391 (48.08%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLL-SASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            G  P+H A+  G + I+  LL      D  +      +H A R + +D+  +L++    ++    +   P+H ASR G ++IV  L+     ++A  K+ +  +H A +  Q E+A +L++    ++A TK+ + P+H   +YGH ++  +L+ K  D++AQ     +P+H AC+Y  + +A  LLEKG +  +   +   P+H A       IA  L++ G    + ++  + P+H +S+ GH  +  +LI  K  +  P  + + P+H  C   D        V +A +L +    I++  ++  +PL +A   G   ++  + +   N +     G+  L   +Q+G+     +++  K + N    +   P+H A   G+I ++  L
Sbjct:  403 GLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHL-CAQED-------NVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 5 Score: 93.9745 bits (232), Expect = 8.368e-19
Identity = 68/294 (23.13%), Postives = 135/294 (45.92%), Query Frame = 3
Query:  528 ACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMR--PIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            A R    E     +K N DI          +H A + GH  +++ L+ +   +++ T +  + +H A     E +   LLE   +V   + +   P++ A    +  + +LL+  G +     E+ + P+  A + GH  +V +L      +E+ T  ++R   +H A K +D        V+ A LL++ +   +V ++S  +PL +A   GN+ + NL+ +K  + N +  H    L  A++ G      +++ +  +I    +D + P+H A   GH ++V +LL+    +
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL------LESDTRGKVRLPALHIAAKKDD--------VKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI 297          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 197.208 bits (500), Expect = 4.061e-50
Identity = 105/396 (26.52%), Postives = 202/396 (51.01%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G   ++K+LLDK    +AR+ + +  +H AC+++H    +LL+K   ++E      L P+H A+  G LNIV SL+ +  +  A +     P+H A R   CE+A  L++ N  ++A  K++  P+H A R GH E++ +LM    + ++ T+   +P+H A    +      LL++       T     P+H AC  G   +A+LL+++G +  +  +    P+H A  + +  +V++L++      +   +    +H A K N         +E+A+ L++     N ++    +PL LA + G  +++ L+  K  N N+ N + L      +QEG++  A++++++   +    +    P+H AC  G+I++VK LL+    ++
Sbjct:  309 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQ--------LEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN 696          

HSP 2 Score: 171.785 bits (434), Expect = 2.492e-42
Identity = 108/441 (24.49%), Postives = 196/441 (44.44%), Query Frame = 3
Query:  204 QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSS--------DNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            Q G  P+H A+ +  L + +LLL++  +++            +    IH A +  H D    L++    I++   D L P+H A+  G   +V  L+ K     A+  N + P+H AC+ N      +L+K +  +EA T+    P+H A   GH  I+  L+ +    NA   +  +P+H A    +  +A  LL+    V++   D   P+H A   G+ ++ +LL++   + +S       P+H A+R GH     +L++        T     P+H ACK+          V++A LL+ER    N   ++  +PL +A+ + N +V+ L+  K  +P+ T  NG+  L                                   ASQEG      ++I ++ ++N+ +K+ + P+H    +GH+ I  +L+K    +
Sbjct:  230 QTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGK--------VDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 662          

HSP 3 Score: 149.828 bits (377), Expect = 1.015e-35
Identity = 84/355 (23.66%), Postives = 164/355 (46.20%), Query Frame = 3
Query:  129 FHQAIRTGN--VDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R G+  V  F      +   K +  + P+H A+R G  E++KLL++   + D+ ++     +H A RE H+    +L+ +     +       P+H A +YG +++   L+ +  N  A  KN   P+H A  +N  ++  +LV K     +  +  +  +H A +    E+ + L+    + N+++ Q  +P+H A      ++ + L+ K  NV  G  + + P+H     G+  IA +L+ +G  + + +   + P+H A  YG+  +V+ L+  +  + + T     P+H A +          + +I  LL++     N    +  SPL +A   G   VI+++K
Sbjct:  409 LHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQ--------GHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 755          

HSP 4 Score: 133.65 bits (335), Expect = 9.498e-31
Identity = 102/412 (24.76%), Postives = 194/412 (47.09%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTK-----ENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVE-----SGT---SDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            G   +H A+  GQ +++  L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K     +++  V   C Y  +        K   L  QT   ++P+H A +YE  ++A  LL +G NV      S T    + + PIH A    +    + L+    +I+    ++  P+H A+  GH  +V++L++      A  L+   P+H ACK         N++    LL++ +  +    ES  +PL +A   G+  ++  + ++  +PN +N      L  A++ G+ + A+ +++    ++   KDD  P+H A   GH E+VKLL+++    D
Sbjct:   75 GNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTES-------MKCYTLFRQT--GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACK--------KNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD 465          

HSP 5 Score: 73.9442 bits (180), Expect = 1.557e-12
Identity = 77/357 (21.57%), Postives = 146/357 (40.90%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPT-----LDQMRPIHFACKHNDASK-------AGDNYVEIAA---------LLIERNCQINVQNESKQ--------SPLDLALENGNEE-VINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            A+R G L      I    +I   ++N    +H A +    ++   L+    D+E  TK+    +H A   G  +++  L+    ++NAQ+ + +SP++ A    +  +   LLE G N    T D   P+  A   G+  +  LLI+ G       +     +H A+R        +L+    + +  +     L     +   C + ++ K        G   + IAA         LL+ R   +N   +           SP+ +A +  + + V  L++   E  ++T  H   L  A+  G+ +  +V++ +    N    +   P+H AC K H+  + LLLK++  L+ +
Sbjct:   16 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV 368          

HSP 6 Score: 53.1434 bits (126), Expect = 3.759e-6
Identity = 57/221 (25.79%), Postives = 91/221 (41.18%), Query Frame = 3
Query:  792 GTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLEN---PNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMR--PIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS 1439
            G +D       A  +GN + A   I  G DI   N+     +H AS+ GH  +V  L++   D+E  T      +H       A+ AG    ++ A LI     +N Q++   SPL +A +  + EV+  + E   N   P       L  A Q+G+     ++      IN   K  +R   +H A          +LL+N+   D++ K    LQ  +S
Sbjct:    5 GHADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHI------AALAGQE--KVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALL------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLS 211          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 196.823 bits (499), Expect = 4.550e-50
Identity = 105/396 (26.52%), Postives = 202/396 (51.01%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G   ++K+LLDK    +AR+ + +  +H AC+++H    +LL+K   ++E      L P+H A+  G LNIV SL+ +  +  A +     P+H A R   CE+A  L++ N  ++A  K++  P+H A R GH E++ +LM    + ++ T+   +P+H A    +      LL++       T     P+H AC  G   +A+LL+++G +  +  +    P+H A  + +  +V++L++      +   +    +H A K N         +E+A+ L++     N ++    +PL LA + G  +++ L+  K  N N+ N + L      +QEG++  A++++++   +    +    P+H AC  G+I++VK LL+    ++
Sbjct:  314 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQ--------LEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN 701          

HSP 2 Score: 171.785 bits (434), Expect = 2.520e-42
Identity = 108/441 (24.49%), Postives = 196/441 (44.44%), Query Frame = 3
Query:  204 QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSS--------DNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            Q G  P+H A+ +  L + +LLL++  +++            +    IH A +  H D    L++    I++   D L P+H A+  G   +V  L+ K     A+  N + P+H AC+ N      +L+K +  +EA T+    P+H A   GH  I+  L+ +    NA   +  +P+H A    +  +A  LL+    V++   D   P+H A   G+ ++ +LL++   + +S       P+H A+R GH     +L++        T     P+H ACK+          V++A LL+ER    N   ++  +PL +A+ + N +V+ L+  K  +P+ T  NG+  L                                   ASQEG      ++I ++ ++N+ +K+ + P+H    +GH+ I  +L+K    +
Sbjct:  235 QTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGK--------VDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 667          

HSP 3 Score: 149.828 bits (377), Expect = 1.043e-35
Identity = 84/355 (23.66%), Postives = 164/355 (46.20%), Query Frame = 3
Query:  129 FHQAIRTGN--VDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R G+  V  F      +   K +  + P+H A+R G  E++KLL++   + D+ ++     +H A RE H+    +L+ +     +       P+H A +YG +++   L+ +  N  A  KN   P+H A  +N  ++  +LV K     +  +  +  +H A +    E+ + L+    + N+++ Q  +P+H A      ++ + L+ K  NV  G  + + P+H     G+  IA +L+ +G  + + +   + P+H A  YG+  +V+ L+  +  + + T     P+H A +          + +I  LL++     N    +  SPL +A   G   VI+++K
Sbjct:  414 LHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQ--------GHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 760          

HSP 4 Score: 133.65 bits (335), Expect = 1.080e-30
Identity = 102/412 (24.76%), Postives = 194/412 (47.09%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTK-----ENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVE-----SGT---SDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            G   +H A+  GQ +++  L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K     +++  V   C Y  +        K   L  QT   ++P+H A +YE  ++A  LL +G NV      S T    + + PIH A    +    + L+    +I+    ++  P+H A+  GH  +V++L++      A  L+   P+H ACK         N++    LL++ +  +    ES  +PL +A   G+  ++  + ++  +PN +N      L  A++ G+ + A+ +++    ++   KDD  P+H A   GH E+VKLL+++    D
Sbjct:   80 GNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTES-------MKCYTLFRQT--GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACK--------KNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD 470          

HSP 5 Score: 74.7146 bits (182), Expect = 8.706e-13
Identity = 80/376 (21.28%), Postives = 152/376 (40.43%), Query Frame = 3
Query:  372 KKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPT-----LDQMRPIHFACKHNDASK-------AGDNYVEIAA---------LLIERNCQINVQNESKQ--------SPLDLALENGNEE-VINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            K++    +     LR    A+R G L      I    +I   ++N    +H A +    ++   L+    D+E  TK+    +H A   G  +++  L+    ++NAQ+ + +SP++ A    +  +   LLE G N    T D   P+  A   G+  +  LLI+ G       +     +H A+R        +L+    + +  +     L     +   C + ++ K        G   + IAA         LL+ R   +N   +           SP+ +A +  + + V  L++   E  ++T  H   L  A+  G+ +  +V++ +    N    +   P+H AC K H+  + LLLK++  L+ +
Sbjct:    6 KRRLGTADATTSFLR----AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV 373          

HSP 6 Score: 55.8398 bits (133), Expect = 5.320e-7
Identity = 58/221 (26.24%), Postives = 92/221 (41.63%), Query Frame = 3
Query:  792 GTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLEN---PNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMR--PIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS 1439
            GT+D       A  +GN + A   I  G DI   N+     +H AS+ GH  +V  L++   D+E  T      +H       A+ AG    ++ A LI     +N Q++   SPL +A +  + EV+  + E   N   P       L  A Q+G+     ++      IN   K  +R   +H A          +LL+N+   D++ K    LQ  +S
Sbjct:   10 GTADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHI------AALAGQE--KVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALL------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLS 216          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 196.052 bits (497), Expect = 5.577e-50
Identity = 104/396 (26.26%), Postives = 201/396 (50.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G   ++K+LLDK    +AR+ + +  +H AC+++H    +LL+K   ++E      L P+H A+  G LNIV SL+ +  +  A +     P+H A R   CE+A  L++ N  ++A  K++  P+H A R GH E++ +LM    + ++ T+   +P+H A    +      LL++       T     P+H AC  G   + +LL+++G +  +  +    P+H A  + +  +V++L++      +   +    +H A K N         +E+A+ L++     N ++    +PL LA + G  +++ L+  K  N N+ N + L      +QEG++  A++++++   +    +    P+H AC  G+I++VK LL+    ++
Sbjct:  374 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQ--------LEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN 761          

HSP 2 Score: 183.341 bits (464), Expect = 4.151e-46
Identity = 107/428 (25.00%), Postives = 197/428 (46.03%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+R+G + ++++LLD+   + A++ +    IH A +  H D    L++    I++   D L P+H A+  G   +V  L+ K     A+  N + P+H AC+ N      +L+K +  +EA T+    P+H A   GH  I+  L+ +    NA   +  +P+H A    +  +A  LL+    V++   D   P+H A   G+ ++ +LL++   + +S       P+H A+R GH     +L++        T     P+H ACK+          V++  LL+ER    N   ++  +PL +A+ + N +V+ L+  K  +P+ T  NG+  L                                   ASQEG      ++I ++ ++N+ +K+ + P+H    +GH+ I  +L+K    +
Sbjct:  308 PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGK--------VDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 727          

HSP 3 Score: 175.252 bits (443), Expect = 1.510e-43
Identity = 102/392 (26.02%), Postives = 190/392 (48.47%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    +  VA+LL+ +  N+     + + P+H ASR G + +V  L+ +   I+AK K++  P+H A RN    +  IL+ +   ++A TK    P+H A +  H + +  L+    +++  T  + +P+H A +  +  +   LL+KG    +   +   P+H AC   + +   LL+     +E+  E    P+H A+  GH  +V+ L+       A  +    P+H       A++AG  + E+A  L++ N Q++ + +  Q+PL  A   G++E++ L+ E   NP+   T GH  L  A++EG+ +   +++          K    P+H AC  G +++V+LLL+   
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHM------AARAG--HCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGA 593          

HSP 4 Score: 167.548 bits (423), Expect = 3.323e-41
Identity = 98/392 (25.00%), Postives = 188/392 (47.96%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +    +H A R  +  +  LL+ +   I+    D L P+H A+R G + +V  L+ +   ++AK KN   PIH A + +  +    L++ N +I+  T ++  P+H A   GH  ++ +L+ K    NA+    ++P+H AC   +      LL+   ++E+ T   + P+H A   G+  I + L+ +G    + N +   P+H A+R GH  + + L+     ++A   D   P+H A +          + E+  LL+E     +    +  +PL +A   G+ +    L+ E  +   MT      L  A + G +   E+++ R  + N   K+ + P+H A    ++++VKLL+
Sbjct:  239 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARM--------GHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 622          

HSP 5 Score: 158.688 bits (400), Expect = 1.747e-38
Identity = 101/424 (23.82%), Postives = 205/424 (48.35%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKH--------NDASKAG---------------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            G   +H A+  GQ +++  L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       +P+H A       +   LL++G  +++ T D++ P+H A  NG+ ++ ++L+D+G  +++  +    PIH A++  H   V  L+    +++  TLD + P+H A  C H        +  +KA                 N++    LL++ +  +    ES  +PL +A   G+  ++  + ++  +PN +N      L  A++ G+ + A+ +++    ++   KDD  P+H A   GH E+VKLL+++    D
Sbjct:  111 GNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD 530          

HSP 6 Score: 139.428 bits (350), Expect = 1.449e-32
Identity = 89/384 (23.18%), Postives = 171/384 (44.53%), Query Frame = 3
Query:  129 FHQAIRTGN--VDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEML------INAKCDMEAPTLD------------QMRPIHFA-----------CKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R G+  V  F      +   K +  + P+H A+R G  E++KLL++   + D+ ++     +H A RE H+    +L+ +     +       P+H A +YG +++V  L+ +  N  A  KN   P+H A  +N  ++  +LV K     +  +  +  +H A +    E+ + L+    + N+++ Q  +P+H A      ++ + L+ K  NV  G  + + P+H     G+  IA +L+ +G  + + +   + P+H A  YG+  +V+ L      +N+K  +    LD             +R   F+              + A++ G  + +I  LL++     N    +  SPL +A   G   VI+++K
Sbjct:  474 LHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQG--HTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 855          

HSP 7 Score: 113.62 bits (283), Expect = 1.268e-24
Identity = 79/377 (20.95%), Postives = 171/377 (45.36%), Query Frame = 3
Query:  369 IKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGV-----------------------------NVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEE-VINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            IK   +I   + + L  +H AS+ G + +V  L+    ++E   K     +H A    Q ++   L+    ++ A +++ + P++ A +  H E++  L+    + +  T   ++P+  A    +EN+ + L+  G                              N +  +     P+H A    N  +AQLL+++G ++    +    P+H ASR G+  +V +L++    ++A T D++ P+H A +        + +V +  +L+++   +  + ++  SP+ +A +  + + V  L++   E  ++T  H   L  A+  G+ +  +V++ +    N    +   P+H AC K H+  + LLLK++  L+ +
Sbjct:   65 IKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAAR--------NGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV 433          

HSP 8 Score: 106.686 bits (265), Expect = 1.510e-22
Identity = 74/294 (25.17%), Postives = 136/294 (46.26%), Query Frame = 3
Query:  528 ACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLIN--AKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            A R+   E A   +K   DI    +     +H A + GH +++  L+   +DL   T +  + +H A     E + + L+  G NV + +     P++ A    + ++ + L++ G +     E+ + P+  A + GH  +V +LIN   K  +  P L      H A +++D           AA+L++ +   +V +++  +PL +A    N  V  L+  +  N N T  NG   L  AS+ GN+    +++ R   I+   KD++ P+H A   GH+ +V++LL     L
Sbjct:   52 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPAL------HIAARNDD--------TRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPL 331          

HSP 9 Score: 102.834 bits (255), Expect = 2.194e-21
Identity = 83/379 (21.90%), Postives = 165/379 (43.54%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIK 1547
            A+R G L      I    +I   ++N    +H A +    ++   L+    D+E  TK+    +H A   G  +++  L+    ++NAQ+ + +SP++ A    +  +   LLE G N    T D   P+  A   G+  +  LLI+ G       +     +H A+R        +L+    + +  +     P+H A  + + S        +A LL+ R   +N   ++  +PL +A   GN  ++ L+ ++    +      L     A++ G+++  E+++ +   +    K+ + PIH A    H++ V+ LL+ N E+D I   + +   V +      + K+ L+   + N    N +  L++ CK  H++
Sbjct:   52 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLS--------VAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 418          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 194.897 bits (494), Expect = 1.044e-49
Identity = 104/396 (26.26%), Postives = 201/396 (50.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G   ++K+LLDK    +AR+ + +  +H AC+++H    +LL+K   ++E      L P+H A+  G LNIV SL+ +  +  A +     P+H A R   CE+A  L++ N  ++A  K++  P+H A R GH E++ +LM    + ++ T+   +P+H A    +      LL++       T     P+H AC  G   + +LL+++G +  +  +    P+H A  + +  +V++L++      +   +    +H A K N         +E+A+ L++     N ++    +PL LA + G  +++ L+  K  N N+ N + L      +QEG++  A++++++   +    +    P+H AC  G+I++VK LL+    ++
Sbjct:  282 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQ--------LEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN 669          

HSP 2 Score: 182.185 bits (461), Expect = 7.214e-46
Identity = 107/428 (25.00%), Postives = 197/428 (46.03%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+R+G + ++++LLD+   + A++ +    IH A +  H D    L++    I++   D L P+H A+  G   +V  L+ K     A+  N + P+H AC+ N      +L+K +  +EA T+    P+H A   GH  I+  L+ +    NA   +  +P+H A    +  +A  LL+    V++   D   P+H A   G+ ++ +LL++   + +S       P+H A+R GH     +L++        T     P+H ACK+          V++  LL+ER    N   ++  +PL +A+ + N +V+ L+  K  +P+ T  NG+  L                                   ASQEG      ++I ++ ++N+ +K+ + P+H    +GH+ I  +L+K    +
Sbjct:  216 PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGK--------VDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 635          

HSP 3 Score: 174.096 bits (440), Expect = 2.958e-43
Identity = 102/392 (26.02%), Postives = 190/392 (48.47%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    +  VA+LL+ +  N+     + + P+H ASR G + +V  L+ +   I+AK K++  P+H A RN    +  IL+ +   ++A TK    P+H A +  H + +  L+    +++  T  + +P+H A +  +  +   LL+KG    +   +   P+H AC   + +   LL+     +E+  E    P+H A+  GH  +V+ L+       A  +    P+H       A++AG  + E+A  L++ N Q++ + +  Q+PL  A   G++E++ L+ E   NP+   T GH  L  A++EG+ +   +++          K    P+H AC  G +++V+LLL+   
Sbjct:  118 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHM------AARAG--HCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGA 501          

HSP 4 Score: 166.392 bits (420), Expect = 7.169e-41
Identity = 98/392 (25.00%), Postives = 188/392 (47.96%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +    +H A R  +  +  LL+ +   I+    D L P+H A+R G + +V  L+ +   ++AK KN   PIH A + +  +    L++ N +I+  T ++  P+H A   GH  ++ +L+ K    NA+    ++P+H AC   +      LL+   ++E+ T   + P+H A   G+  I + L+ +G    + N +   P+H A+R GH  + + L+     ++A   D   P+H A +          + E+  LL+E     +    +  +PL +A   G+ +    L+ E  +   MT      L  A + G +   E+++ R  + N   K+ + P+H A    ++++VKLL+
Sbjct:  147 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARM--------GHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 530          

HSP 5 Score: 157.532 bits (397), Expect = 3.381e-38
Identity = 108/454 (23.79%), Postives = 213/454 (46.92%), Query Frame = 3
Query:  120 LELFHQAIRTGNVDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKH--------NDASKAG---------------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            LEL H  I      D     K+        G   +H A+  GQ +++  L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       +P+H A       +   LL++G  +++ T D++ P+H A  NG+ ++ ++L+D+G  +++  +    PIH A++  H   V  L+    +++  TLD + P+H A  C H        +  +KA                 N++    LL++ +  +    ES  +PL +A   G+  ++  + ++  +PN +N      L  A++ G+ + A+ +++    ++   KDD  P+H A   GH E+VKLL+++    D
Sbjct:    3 LELLHNGI------DLETTTKK--------GNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD 438          

HSP 6 Score: 151.369 bits (381), Expect = 2.499e-36
Identity = 85/355 (23.94%), Postives = 165/355 (46.48%), Query Frame = 3
Query:  129 FHQAIRTGN--VDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R G+  V  F      +   K +  + P+H A+R G  E++KLL++   + D+ ++     +H A RE H+    +L+ +     +       P+H A +YG +++V  L+ +  N  A  KN   P+H A  +N  ++  +LV K     +  +  +  +H A +    E+ + L+    + N+++ Q  +P+H A      ++ + L+ K  NV  G  + + P+H     G+  IA +L+ +G  + + +   + P+H A  YG+  +V+ L+  +  + + T     P+H A +          + +I  LL++     N    +  SPL +A   G   VI+++K
Sbjct:  382 LHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQ--------QGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 728          

HSP 7 Score: 103.605 bits (257), Expect = 1.113e-21
Identity = 71/349 (20.34%), Postives = 157/349 (44.99%), Query Frame = 3
Query:  453 IVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGV-----------------------------NVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEE-VINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            +V  L+    ++E   K     +H A    Q ++   L+    ++ A +++ + P++ A +  H E++  L+    + +  T   ++P+  A    +EN+ + L+  G                              N +  +     P+H A    N  +AQLL+++G ++    +    P+H ASR G+  +V +L++    ++A T D++ P+H A +        + +V +  +L+++   +  + ++  SP+ +A +  + + V  L++   E  ++T  H   L  A+  G+ +  +V++ +    N    +   P+H AC K H+  + LLLK++  L+ +
Sbjct:    1 MVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAAR--------NGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV 341          

HSP 8 Score: 92.8189 bits (229), Expect = 2.537e-18
Identity = 74/334 (22.16%), Postives = 148/334 (44.31%), Query Frame = 3
Query:  564 LVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIK 1547
            L+    D+E  TK+    +H A   G  +++  L+    ++NAQ+ + +SP++ A    +  +   LLE G N    T D   P+  A   G+  +  LLI+ G       +     +H A+R        +L+    + +  +     P+H A  + + S        +A LL+ R   +N   ++  +PL +A   GN  ++ L+ ++    +      L     A++ G+++  E+++ +   +    K+ + PIH A    H++ V+ LL+ N E+D I   + +   V +      + K+ L+   + N    N +  L++ CK  H++
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLS--------VAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 326          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 195.667 bits (496), Expect = 1.156e-49
Identity = 104/396 (26.26%), Postives = 201/396 (50.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G   ++K+LLDK    +AR+ + +  +H AC+++H    +LL+K   ++E      L P+H A+  G LNIV SL+ +  +  A +     P+H A R   CE+A  L++ N  ++A  K++  P+H A R GH E++ +LM    + ++ T+   +P+H A    +      LL++       T     P+H AC  G   + +LL+++G +  +  +    P+H A  + +  +V++L++      +   +    +H A K N         +E+A+ L++     N ++    +PL LA + G  +++ L+  K  N N+ N + L      +QEG++  A++++++   +    +    P+H AC  G+I++VK LL+    ++
Sbjct:  344 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQ--------LEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN 731          

HSP 2 Score: 183.341 bits (464), Expect = 7.059e-46
Identity = 107/428 (25.00%), Postives = 197/428 (46.03%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+R+G + ++++LLD+   + A++ +    IH A +  H D    L++    I++   D L P+H A+  G   +V  L+ K     A+  N + P+H AC+ N      +L+K +  +EA T+    P+H A   GH  I+  L+ +    NA   +  +P+H A    +  +A  LL+    V++   D   P+H A   G+ ++ +LL++   + +S       P+H A+R GH     +L++        T     P+H ACK+          V++  LL+ER    N   ++  +PL +A+ + N +V+ L+  K  +P+ T  NG+  L                                   ASQEG      ++I ++ ++N+ +K+ + P+H    +GH+ I  +L+K    +
Sbjct:  278 PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGK--------VDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 697          

HSP 3 Score: 175.637 bits (444), Expect = 1.635e-43
Identity = 102/392 (26.02%), Postives = 190/392 (48.47%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    +  VA+LL+ +  N+     + + P+H ASR G + +V  L+ +   I+AK K++  P+H A RN    +  IL+ +   ++A TK    P+H A +  H + +  L+    +++  T  + +P+H A +  +  +   LL+KG    +   +   P+H AC   + +   LL+     +E+  E    P+H A+  GH  +V+ L+       A  +    P+H       A++AG  + E+A  L++ N Q++ + +  Q+PL  A   G++E++ L+ E   NP+   T GH  L  A++EG+ +   +++          K    P+H AC  G +++V+LLL+   
Sbjct:  180 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHM------AARAG--HCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGA 563          

HSP 4 Score: 167.933 bits (424), Expect = 3.677e-41
Identity = 98/392 (25.00%), Postives = 188/392 (47.96%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +    +H A R  +  +  LL+ +   I+    D L P+H A+R G + +V  L+ +   ++AK KN   PIH A + +  +    L++ N +I+  T ++  P+H A   GH  ++ +L+ K    NA+    ++P+H AC   +      LL+   ++E+ T   + P+H A   G+  I + L+ +G    + N +   P+H A+R GH  + + L+     ++A   D   P+H A +          + E+  LL+E     +    +  +PL +A   G+ +    L+ E  +   MT      L  A + G +   E+++ R  + N   K+ + P+H A    ++++VKLL+
Sbjct:  209 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARM--------GHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 592          

HSP 5 Score: 158.688 bits (400), Expect = 2.165e-38
Identity = 101/424 (23.82%), Postives = 205/424 (48.35%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKH--------NDASKAG---------------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            G   +H A+  GQ +++  L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       +P+H A       +   LL++G  +++ T D++ P+H A  NG+ ++ ++L+D+G  +++  +    PIH A++  H   V  L+    +++  TLD + P+H A  C H        +  +KA                 N++    LL++ +  +    ES  +PL +A   G+  ++  + ++  +PN +N      L  A++ G+ + A+ +++    ++   KDD  P+H A   GH E+VKLL+++    D
Sbjct:   81 GNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD 500          

HSP 6 Score: 151.754 bits (382), Expect = 2.669e-36
Identity = 85/355 (23.94%), Postives = 165/355 (46.48%), Query Frame = 3
Query:  129 FHQAIRTGN--VDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R G+  V  F      +   K +  + P+H A+R G  E++KLL++   + D+ ++     +H A RE H+    +L+ +     +       P+H A +YG +++V  L+ +  N  A  KN   P+H A  +N  ++  +LV K     +  +  +  +H A +    E+ + L+    + N+++ Q  +P+H A      ++ + L+ K  NV  G  + + P+H     G+  IA +L+ +G  + + +   + P+H A  YG+  +V+ L+  +  + + T     P+H A +          + +I  LL++     N    +  SPL +A   G   VI+++K
Sbjct:  444 LHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQ--------GHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLK 790          

HSP 7 Score: 113.62 bits (283), Expect = 1.399e-24
Identity = 83/406 (20.44%), Postives = 181/406 (44.58%), Query Frame = 3
Query:  282 CDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGV-----------------------------NVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEE-VINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
              + +  +D   +   A R  + + A   IK   +I   + + L  +H AS+ G + +V  L+    ++E   K     +H A    Q ++   L+    ++ A +++ + P++ A +  H E++  L+    + +  T   ++P+  A    +EN+ + L+  G                              N +  +     P+H A    N  +AQLL+++G ++    +    P+H ASR G+  +V +L++    ++A T D++ P+H A +        + +V +  +L+++   +  + ++  SP+ +A +  + + V  L++   E  ++T  H   L  A+  G+ +  +V++ +    N    +   P+H AC K H+  + LLLK++  L+ +
Sbjct:    6 SSLSSPQADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAAR--------NGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV 403          

HSP 8 Score: 103.605 bits (257), Expect = 1.404e-21
Identity = 83/379 (21.90%), Postives = 165/379 (43.54%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIK 1547
            A+R G L      I    +I   ++N    +H A +    ++   L+    D+E  TK+    +H A   G  +++  L+    ++NAQ+ + +SP++ A    +  +   LLE G N    T D   P+  A   G+  +  LLI+ G       +     +H A+R        +L+    + +  +     P+H A  + + S        +A LL+ R   +N   ++  +PL +A   GN  ++ L+ ++    +      L     A++ G+++  E+++ +   +    K+ + PIH A    H++ V+ LL+ N E+D I   + +   V +      + K+ L+   + N    N +  L++ CK  H++
Sbjct:   22 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLS--------VAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 388          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 191.43 bits (485), Expect = 2.917e-48
Identity = 113/402 (28.11%), Postives = 190/402 (47.26%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFN 1415
            P+H A+  G   + KLLLDK    +AR+ + +  +H AC++SH  V ELL+K   +I+      L P+H AS  G L IV +L+ K  +          P+H A R    ++A  L++    + A  K++  P+H A R GH E++ +L+      +  T+   +P+H      +   A  LL+      S T     P+H A   G  QIA+LL+++     S  +    P+H A  + H  +V +L+N          +   P+H A K           V+ A  L++     N Q+    +PL LA + G+ +++ L+  K  N ++ N   L     ASQEG++  AEV++     +    +    P+H AC  G+I++VK LL++   ++ + K  
Sbjct:  332 PLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRS--------VDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLG 725          

HSP 2 Score: 176.407 bits (446), Expect = 1.201e-43
Identity = 104/392 (26.53%), Postives = 187/392 (47.70%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +   A+H A R  +  +  LL+ +   I+ C  D L P+H A R G + I   L+     I+AK KN   PIH A + +  +   +L++    I+  T ++  P+H A   GH  +  +L+ K    NA+    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ KG      + +   P+H A+R  H  + + LI  K  + A   D   P+H A +          + E+  LL+E     +    +  +PL L    G+ +   L+ + +  + +MT      L  A++ G I+ AE+++ R+   N   K  + P+H A    H+ IV+LLL
Sbjct:  197 GFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAAR--------SGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLL 580          

HSP 3 Score: 166.777 bits (421), Expect = 9.187e-41
Identity = 111/459 (24.18%), Postives = 218/459 (47.49%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK------AGDN-----------------YVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            Q+ L   H + + G+V    +   ++ +     + G   +H A+  GQ ++++ L++   +++++S   +  ++ A +E+H  V + L++   N      D   P+  A + G  N+V  LI        K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       S +H A       +   LL++G  +++ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH AS+  H   V +L+  +  ++  TLD + P+H A  C H+  +K      A  N                 ++ +  LL++    I+   ES  +PL +A   G+  ++  + +K  +PN+ +      L  A++  +   A+ +I+ K  +N   KDD  P+H A   GH E+V+LLL+N    D
Sbjct:   34 QNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM----KGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD 488          

HSP 4 Score: 166.392 bits (420), Expect = 1.185e-40
Identity = 100/389 (25.71%), Postives = 188/389 (48.33%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLK 1379
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  N+     + +  +H ASR G + +V  L+ +   I+A  K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+     ++  T  + +P+H A +  +  +A  LL+KG    +   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+         ++    P+H A +          + ++A  LI+   ++N + +  Q+PL  A  +G+ E++ L+ E   +P+   T GH  L   ++ G+ + AE+++  +       K    P+H A   G I+I +LLL+
Sbjct:  168 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAAR--------AAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLE 548          

HSP 5 Score: 155.606 bits (392), Expect = 2.472e-37
Identity = 95/393 (24.17%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL K    +  S      +H A R +H+DVA+ LI+ K  +     D   P+H A+R G   +V  L+    + +        P+H   R    + A +L+       + TK+ + P+H A +YG  +I  +L+ +    N+      +P+H A  + + NI   LL KG +      +   P+H A    +   A+ L+  G    + + +   P+H A++ GH  +V +L++ + ++       + P+H A +        + ++ IA +L+  +  +  +     +PL +                              A   GNIK  + +++ + ++N   K    P+H A  +GH +IV LLLKN  
Sbjct:  395 GLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQ--------EGHLNIAEVLVSHDASVAAETRMGFAPLHV------------------------------ACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 749          

HSP 6 Score: 142.51 bits (358), Expect = 2.673e-33
Identity = 99/422 (23.46%), Postives = 192/422 (45.50%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPL---------------------------DLNAQ--TSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKL--ENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G L+     L    DI+  + +   A+H + +E H  +   L+ K   +E         +H A+  G  ++V  L+    N+ ++ +  + P++ A + N   +   L++   +    T++ + P+  A + GH  ++  L++  +                           D NA   +   ++P+H A +YE  N+A  LL +G NV     + +  +H A   GN  + +LL+D+G  I++C ++   P+H A R GH  + E+L++    ++A T + + PIH A +       GD +++   LL++    I+       +PL +A   G+  V  L+ +K    N    NG   L  A ++ +I+  E++++    I+   +  + P+H A   GH+ IVK LL+     ++
Sbjct:   10 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQ-------GD-HLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNV 423          

HSP 7 Score: 137.117 bits (344), Expect = 1.201e-31
Identity = 88/367 (23.98%), Postives = 160/367 (43.60%), Query Frame = 3
Query:  129 FHQAIRTGNVD--DFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNC---QINVQNESKQSPLDLALENGNEEVINLIKEKLE-NPNM 1211
             H A R  + D  DF    K +   + +  + P+H A+R G  E+++LLL+     D  ++     +H   R  H+  AELL+  +            P+H A++YG + I   L+ +  +  +  K    P+H A  +N   I  +L+ K        +  + P+H A +    +    L+      NAQ+ Q  +P+H A    + ++ + LL K  NV  G    + P+H A   G+  IA++L+     + +     + P+H A  YG+  +V+ L+  + ++ A T     P+H A        A   + +I  LL++      Q ++ +    SP  LA E         + E ++ +PN+
Sbjct:  432 LHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQA--------AQQGHTDIVTLLLKNGACPNQASMVSALTLSPPQLANERHRMSFPETMDEPMDVSPNI 790          

HSP 8 Score: 95.1301 bits (235), Expect = 6.892e-19
Identity = 80/387 (20.67%), Postives = 167/387 (43.15%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIKLNPIFISS 1571
            A+R G L+     +    +I   ++N    +H + +    ++ T L+ K+  +E  TK+    +H A   G  +++  L+    ++N+Q+ + ++P++ A    +  +   LLE G N    T D   P+  A   G+  +   LI  G       +     +H A+R        +L+    + +  +     P+H A  + +        + +A LL+ R   +N   ++  S L +A   GN  ++ L+ ++    +      L     A + G+++ +E+++     I    K+ + PIH A    H++ V+LLL+    +D I   + +   V +      + K+ L+   + N    N +  L++ CK  HI++  + + S
Sbjct:   10 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYEN--------LNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 384          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 191.045 bits (484), Expect = 4.138e-48
Identity = 113/402 (28.11%), Postives = 190/402 (47.26%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFN 1415
            P+H A+  G   + KLLLDK    +AR+ + +  +H AC++SH  V ELL+K   +I+      L P+H AS  G L IV +L+ K  +          P+H A R    ++A  L++    + A  K++  P+H A R GH E++ +L+      +  T+   +P+H      +   A  LL+      S T     P+H A   G  QIA+LL+++     S  +    P+H A  + H  +V +L+N          +   P+H A K           V+ A  L++     N Q+    +PL LA + G+ +++ L+  K  N ++ N   L     ASQEG++  AEV++     +    +    P+H AC  G+I++VK LL++   ++ + K  
Sbjct:  337 PLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRS--------VDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLG 730          

HSP 2 Score: 176.022 bits (445), Expect = 1.856e-43
Identity = 104/392 (26.53%), Postives = 187/392 (47.70%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +   A+H A R  +  +  LL+ +   I+ C  D L P+H A R G + I   L+     I+AK KN   PIH A + +  +   +L++    I+  T ++  P+H A   GH  +  +L+ K    NA+    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ KG      + +   P+H A+R  H  + + LI  K  + A   D   P+H A +          + E+  LL+E     +    +  +PL L    G+ +   L+ + +  + +MT      L  A++ G I+ AE+++ R+   N   K  + P+H A    H+ IV+LLL
Sbjct:  202 GFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAAR--------SGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLL 585          

HSP 3 Score: 166.392 bits (420), Expect = 1.549e-40
Identity = 111/459 (24.18%), Postives = 218/459 (47.49%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK------AGDN-----------------YVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            Q+ L   H + + G+V    +   ++ +     + G   +H A+  GQ ++++ L++   +++++S   +  ++ A +E+H  V + L++   N      D   P+  A + G  N+V  LI        K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       S +H A       +   LL++G  +++ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH AS+  H   V +L+  +  ++  TLD + P+H A  C H+  +K      A  N                 ++ +  LL++    I+   ES  +PL +A   G+  ++  + +K  +PN+ +      L  A++  +   A+ +I+ K  +N   KDD  P+H A   GH E+V+LLL+N    D
Sbjct:   39 QNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM----KGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD 493          

HSP 4 Score: 166.392 bits (420), Expect = 1.549e-40
Identity = 100/389 (25.71%), Postives = 188/389 (48.33%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLK 1379
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  N+     + +  +H ASR G + +V  L+ +   I+A  K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+     ++  T  + +P+H A +  +  +A  LL+KG    +   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+         ++    P+H A +          + ++A  LI+   ++N + +  Q+PL  A  +G+ E++ L+ E   +P+   T GH  L   ++ G+ + AE+++  +       K    P+H A   G I+I +LLL+
Sbjct:  173 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAAR--------AAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLE 553          

HSP 5 Score: 155.606 bits (392), Expect = 2.877e-37
Identity = 95/393 (24.17%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL K    +  S      +H A R +H+DVA+ LI+ K  +     D   P+H A+R G   +V  L+    + +        P+H   R    + A +L+       + TK+ + P+H A +YG  +I  +L+ +    N+      +P+H A  + + NI   LL KG +      +   P+H A    +   A+ L+  G    + + +   P+H A++ GH  +V +L++ + ++       + P+H A +        + ++ IA +L+  +  +  +     +PL +                              A   GNIK  + +++ + ++N   K    P+H A  +GH +IV LLLKN  
Sbjct:  400 GLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQ--------EGHLNIAEVLVSHDASVAAETRMGFAPLHV------------------------------ACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 754          

HSP 6 Score: 142.124 bits (357), Expect = 3.687e-33
Identity = 99/422 (23.46%), Postives = 192/422 (45.50%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPL---------------------------DLNAQ--TSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKL--ENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G L+     L    DI+  + +   A+H + +E H  +   L+ K   +E         +H A+  G  ++V  L+    N+ ++ +  + P++ A + N   +   L++   +    T++ + P+  A + GH  ++  L++  +                           D NA   +   ++P+H A +YE  N+A  LL +G NV     + +  +H A   GN  + +LL+D+G  I++C ++   P+H A R GH  + E+L++    ++A T + + PIH A +       GD +++   LL++    I+       +PL +A   G+  V  L+ +K    N    NG   L  A ++ +I+  E++++    I+   +  + P+H A   GH+ IVK LL+     ++
Sbjct:   15 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQ-------GD-HLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNV 428          

HSP 7 Score: 140.584 bits (353), Expect = 1.269e-32
Identity = 85/363 (23.42%), Postives = 160/363 (44.08%), Query Frame = 3
Query:  129 FHQAIRTGNVD--DFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM 1211
             H A R  + D  DF    K +   + +  + P+H A+R G  E+++LLL+     D  ++     +H   R  H+  AELL+  +            P+H A++YG + I   L+ +  +  +  K    P+H A  +N   I  +L+ K        +  + P+H A +    +    L+      NAQ+ Q  +P+H A    + ++ + LL K  NV  G    + P+H A   G+  IA++L+     + +     + P+H A  YG+  +V+ L+  + ++ A T     P+H A +          + +I  LL++     N  + +  +PL +A   G   V +++    + P++
Sbjct:  437 LHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQ--------GHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHI 791          

HSP 8 Score: 94.7449 bits (234), Expect = 9.896e-19
Identity = 80/387 (20.67%), Postives = 167/387 (43.15%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIKLNPIFISS 1571
            A+R G L+     +    +I   ++N    +H + +    ++ T L+ K+  +E  TK+    +H A   G  +++  L+    ++N+Q+ + ++P++ A    +  +   LLE G N    T D   P+  A   G+  +   LI  G       +     +H A+R        +L+    + +  +     P+H A  + +        + +A LL+ R   +N   ++  S L +A   GN  ++ L+ ++    +      L     A + G+++ +E+++     I    K+ + PIH A    H++ V+LLL+    +D I   + +   V +      + K+ L+   + N    N +  L++ CK  HI++  + + S
Sbjct:   15 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYEN--------LNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 389          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 191.045 bits (484), Expect = 4.181e-48
Identity = 113/402 (28.11%), Postives = 190/402 (47.26%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFN 1415
            P+H A+  G   + KLLLDK    +AR+ + +  +H AC++SH  V ELL+K   +I+      L P+H AS  G L IV +L+ K  +          P+H A R    ++A  L++    + A  K++  P+H A R GH E++ +L+      +  T+   +P+H      +   A  LL+      S T     P+H A   G  QIA+LL+++     S  +    P+H A  + H  +V +L+N          +   P+H A K           V+ A  L++     N Q+    +PL LA + G+ +++ L+  K  N ++ N   L     ASQEG++  AEV++     +    +    P+H AC  G+I++VK LL++   ++ + K  
Sbjct:  374 PLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRS--------VDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLG 767          

HSP 2 Score: 175.637 bits (444), Expect = 2.088e-43
Identity = 104/392 (26.53%), Postives = 187/392 (47.70%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +   A+H A R  +  +  LL+ +   I+ C  D L P+H A R G + I   L+     I+AK KN   PIH A + +  +   +L++    I+  T ++  P+H A   GH  +  +L+ K    NA+    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ KG      + +   P+H A+R  H  + + LI  K  + A   D   P+H A +          + E+  LL+E     +    +  +PL L    G+ +   L+ + +  + +MT      L  A++ G I+ AE+++ R+   N   K  + P+H A    H+ IV+LLL
Sbjct:  239 GFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAAR--------SGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLL 622          

HSP 3 Score: 166.392 bits (420), Expect = 1.546e-40
Identity = 100/389 (25.71%), Postives = 188/389 (48.33%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLK 1379
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  N+     + +  +H ASR G + +V  L+ +   I+A  K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+     ++  T  + +P+H A +  +  +A  LL+KG    +   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+         ++    P+H A +          + ++A  LI+   ++N + +  Q+PL  A  +G+ E++ L+ E   +P+   T GH  L   ++ G+ + AE+++  +       K    P+H A   G I+I +LLL+
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAAR--------AAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLE 590          

HSP 4 Score: 166.392 bits (420), Expect = 1.599e-40
Identity = 111/459 (24.18%), Postives = 218/459 (47.49%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK------AGDN-----------------YVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            Q+ L   H + + G+V    +   ++ +     + G   +H A+  GQ ++++ L++   +++++S   +  ++ A +E+H  V + L++   N      D   P+  A + G  N+V  LI        K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       S +H A       +   LL++G  +++ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH AS+  H   V +L+  +  ++  TLD + P+H A  C H+  +K      A  N                 ++ +  LL++    I+   ES  +PL +A   G+  ++  + +K  +PN+ +      L  A++  +   A+ +I+ K  +N   KDD  P+H A   GH E+V+LLL+N    D
Sbjct:   76 QNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM----KGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD 530          

HSP 5 Score: 155.606 bits (392), Expect = 2.747e-37
Identity = 95/393 (24.17%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL K    +  S      +H A R +H+DVA+ LI+ K  +     D   P+H A+R G   +V  L+    + +        P+H   R    + A +L+       + TK+ + P+H A +YG  +I  +L+ +    N+      +P+H A  + + NI   LL KG +      +   P+H A    +   A+ L+  G    + + +   P+H A++ GH  +V +L++ + ++       + P+H A +        + ++ IA +L+  +  +  +     +PL +                              A   GNIK  + +++ + ++N   K    P+H A  +GH +IV LLLKN  
Sbjct:  437 GLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQ--------EGHLNIAEVLVSHDASVAAETRMGFAPLHV------------------------------ACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 791          

HSP 6 Score: 142.124 bits (357), Expect = 3.957e-33
Identity = 99/422 (23.46%), Postives = 192/422 (45.50%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPL---------------------------DLNAQ--TSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKL--ENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G L+     L    DI+  + +   A+H + +E H  +   L+ K   +E         +H A+  G  ++V  L+    N+ ++ +  + P++ A + N   +   L++   +    T++ + P+  A + GH  ++  L++  +                           D NA   +   ++P+H A +YE  N+A  LL +G NV     + +  +H A   GN  + +LL+D+G  I++C ++   P+H A R GH  + E+L++    ++A T + + PIH A +       GD +++   LL++    I+       +PL +A   G+  V  L+ +K    N    NG   L  A ++ +I+  E++++    I+   +  + P+H A   GH+ IVK LL+     ++
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQ-------GD-HLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNV 465          

HSP 7 Score: 140.198 bits (352), Expect = 1.361e-32
Identity = 85/363 (23.42%), Postives = 160/363 (44.08%), Query Frame = 3
Query:  129 FHQAIRTGNVD--DFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM 1211
             H A R  + D  DF    K +   + +  + P+H A+R G  E+++LLL+     D  ++     +H   R  H+  AELL+  +            P+H A++YG + I   L+ +  +  +  K    P+H A  +N   I  +L+ K        +  + P+H A +    +    L+      NAQ+ Q  +P+H A    + ++ + LL K  NV  G    + P+H A   G+  IA++L+     + +     + P+H A  YG+  +V+ L+  + ++ A T     P+H A +          + +I  LL++     N  + +  +PL +A   G   V +++    + P++
Sbjct:  474 LHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQ--------GHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHI 828          

HSP 8 Score: 94.7449 bits (234), Expect = 1.030e-18
Identity = 80/387 (20.67%), Postives = 167/387 (43.15%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIKLNPIFISS 1571
            A+R G L+     +    +I   ++N    +H + +    ++ T L+ K+  +E  TK+    +H A   G  +++  L+    ++N+Q+ + ++P++ A    +  +   LLE G N    T D   P+  A   G+  +   LI  G       +     +H A+R        +L+    + +  +     P+H A  + +        + +A LL+ R   +N   ++  S L +A   GN  ++ L+ ++    +      L     A + G+++ +E+++     I    K+ + PIH A    H++ V+LLL+    +D I   + +   V +      + K+ L+   + N    N +  L++ CK  HI++  + + S
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYEN--------LNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 426          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 190.66 bits (483), Expect = 5.080e-48
Identity = 113/402 (28.11%), Postives = 190/402 (47.26%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFN 1415
            P+H A+  G   + KLLLDK    +AR+ + +  +H AC++SH  V ELL+K   +I+      L P+H AS  G L IV +L+ K  +          P+H A R    ++A  L++    + A  K++  P+H A R GH E++ +L+      +  T+   +P+H      +   A  LL+      S T     P+H A   G  QIA+LL+++     S  +    P+H A  + H  +V +L+N          +   P+H A K           V+ A  L++     N Q+    +PL LA + G+ +++ L+  K  N ++ N   L     ASQEG++  AEV++     +    +    P+H AC  G+I++VK LL++   ++ + K  
Sbjct:  299 PLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRS--------VDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLG 692          

HSP 2 Score: 175.637 bits (444), Expect = 2.222e-43
Identity = 104/392 (26.53%), Postives = 187/392 (47.70%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +   A+H A R  +  +  LL+ +   I+ C  D L P+H A R G + I   L+     I+AK KN   PIH A + +  +   +L++    I+  T ++  P+H A   GH  +  +L+ K    NA+    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ KG      + +   P+H A+R  H  + + LI  K  + A   D   P+H A +          + E+  LL+E     +    +  +PL L    G+ +   L+ + +  + +MT      L  A++ G I+ AE+++ R+   N   K  + P+H A    H+ IV+LLL
Sbjct:  164 GFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAAR--------SGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLL 547          

HSP 3 Score: 166.007 bits (419), Expect = 1.663e-40
Identity = 100/389 (25.71%), Postives = 188/389 (48.33%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLK 1379
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  N+     + +  +H ASR G + +V  L+ +   I+A  K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+     ++  T  + +P+H A +  +  +A  LL+KG    +   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+         ++    P+H A +          + ++A  LI+   ++N + +  Q+PL  A  +G+ E++ L+ E   +P+   T GH  L   ++ G+ + AE+++  +       K    P+H A   G I+I +LLL+
Sbjct:  135 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAAR--------AAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLE 515          

HSP 4 Score: 164.081 bits (414), Expect = 7.148e-40
Identity = 110/458 (24.02%), Postives = 217/458 (47.38%), Query Frame = 3
Query:  114 DDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK------AGDN-----------------YVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            + L   H + + G+V    +   ++ +     + G   +H A+  GQ ++++ L++   +++++S   +  ++ A +E+H  V + L++   N      D   P+  A + G  N+V  LI        K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       S +H A       +   LL++G  +++ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH AS+  H   V +L+  +  ++  TLD + P+H A  C H+  +K      A  N                 ++ +  LL++    I+   ES  +PL +A   G+  ++  + +K  +PN+ +      L  A++  +   A+ +I+ K  +N   KDD  P+H A   GH E+V+LLL+N    D
Sbjct:    2 NGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM----KGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD 455          

HSP 5 Score: 155.606 bits (392), Expect = 3.089e-37
Identity = 95/393 (24.17%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL K    +  S      +H A R +H+DVA+ LI+ K  +     D   P+H A+R G   +V  L+    + +        P+H   R    + A +L+       + TK+ + P+H A +YG  +I  +L+ +    N+      +P+H A  + + NI   LL KG +      +   P+H A    +   A+ L+  G    + + +   P+H A++ GH  +V +L++ + ++       + P+H A +        + ++ IA +L+  +  +  +     +PL +                              A   GNIK  + +++ + ++N   K    P+H A  +GH +IV LLLKN  
Sbjct:  362 GLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQ--------EGHLNIAEVLVSHDASVAAETRMGFAPLHV------------------------------ACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 716          

HSP 6 Score: 140.198 bits (352), Expect = 1.422e-32
Identity = 85/363 (23.42%), Postives = 160/363 (44.08%), Query Frame = 3
Query:  129 FHQAIRTGNVD--DFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM 1211
             H A R  + D  DF    K +   + +  + P+H A+R G  E+++LLL+     D  ++     +H   R  H+  AELL+  +            P+H A++YG + I   L+ +  +  +  K    P+H A  +N   I  +L+ K        +  + P+H A +    +    L+      NAQ+ Q  +P+H A    + ++ + LL K  NV  G    + P+H A   G+  IA++L+     + +     + P+H A  YG+  +V+ L+  + ++ A T     P+H A +          + +I  LL++     N  + +  +PL +A   G   V +++    + P++
Sbjct:  399 LHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQ--------GHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHI 753          

HSP 7 Score: 138.272 bits (347), Expect = 5.191e-32
Identity = 92/393 (23.41%), Postives = 180/393 (45.80%), Query Frame = 3
Query:  318 AIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPL---------------------------DLNAQ--TSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKL--ENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+H + +E H  +   L+ K   +E         +H A+  G  ++V  L+    N+ ++ +  + P++ A + N   +   L++   +    T++ + P+  A + GH  ++  L++  +                           D NA   +   ++P+H A +YE  N+A  LL +G NV     + +  +H A   GN  + +LL+D+G  I++C ++   P+H A R GH  + E+L++    ++A T + + PIH A +       GD +++   LL++    I+       +PL +A   G+  V  L+ +K    N    NG   L  A ++ +I+  E++++    I+   +  + P+H A   GH+ IVK LL+     ++
Sbjct:    6 ALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQ-------GD-HLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNV 390          

HSP 8 Score: 91.6633 bits (226), Expect = 1.049e-17
Identity = 75/362 (20.72%), Postives = 156/362 (43.09%), Query Frame = 3
Query:  504 NDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIKLNPIFISS 1571
            N    +H + +    ++ T L+ K+  +E  TK+    +H A   G  +++  L+    ++N+Q+ + ++P++ A    +  +   LLE G N    T D   P+  A   G+  +   LI  G       +     +H A+R        +L+    + +  +     P+H A  + +        + +A LL+ R   +N   ++  S L +A   GN  ++ L+ ++    +      L     A + G+++ +E+++     I    K+ + PIH A    H++ V+LLL+    +D I   + +   V +      + K+ L+   + N    N +  L++ CK  HI++  + + S
Sbjct:    2 NGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYEN--------LNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 351          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 190.66 bits (483), Expect = 5.189e-48
Identity = 113/402 (28.11%), Postives = 190/402 (47.26%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFN 1415
            P+H A+  G   + KLLLDK    +AR+ + +  +H AC++SH  V ELL+K   +I+      L P+H AS  G L IV +L+ K  +          P+H A R    ++A  L++    + A  K++  P+H A R GH E++ +L+      +  T+   +P+H      +   A  LL+      S T     P+H A   G  QIA+LL+++     S  +    P+H A  + H  +V +L+N          +   P+H A K           V+ A  L++     N Q+    +PL LA + G+ +++ L+  K  N ++ N   L     ASQEG++  AEV++     +    +    P+H AC  G+I++VK LL++   ++ + K  
Sbjct:  374 PLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRS--------VDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLG 767          

HSP 2 Score: 175.252 bits (443), Expect = 2.506e-43
Identity = 104/392 (26.53%), Postives = 187/392 (47.70%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE-KLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +   A+H A R  +  +  LL+ +   I+ C  D L P+H A R G + I   L+     I+AK KN   PIH A + +  +   +L++    I+  T ++  P+H A   GH  +  +L+ K    NA+    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ KG      + +   P+H A+R  H  + + LI  K  + A   D   P+H A +          + E+  LL+E     +    +  +PL L    G+ +   L+ + +  + +MT      L  A++ G I+ AE+++ R+   N   K  + P+H A    H+ IV+LLL
Sbjct:  239 GFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAAR--------SGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLL 622          

HSP 3 Score: 166.007 bits (419), Expect = 1.856e-40
Identity = 100/389 (25.71%), Postives = 188/389 (48.33%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLK 1379
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  N+     + +  +H ASR G + +V  L+ +   I+A  K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+     ++  T  + +P+H A +  +  +A  LL+KG    +   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+         ++    P+H A +          + ++A  LI+   ++N + +  Q+PL  A  +G+ E++ L+ E   +P+   T GH  L   ++ G+ + AE+++  +       K    P+H A   G I+I +LLL+
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAAR--------AAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLE 590          

HSP 4 Score: 166.007 bits (419), Expect = 1.936e-40
Identity = 111/459 (24.18%), Postives = 218/459 (47.49%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASK------AGDN-----------------YVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            Q+ L   H + + G+V    +   ++ +     + G   +H A+  GQ ++++ L++   +++++S   +  ++ A +E+H  V + L++   N      D   P+  A + G  N+V  LI        K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       S +H A       +   LL++G  +++ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH AS+  H   V +L+  +  ++  TLD + P+H A  C H+  +K      A  N                 ++ +  LL++    I+   ES  +PL +A   G+  ++  + +K  +PN+ +      L  A++  +   A+ +I+ K  +N   KDD  P+H A   GH E+V+LLL+N    D
Sbjct:   76 QNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM----KGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD 530          

HSP 5 Score: 155.221 bits (391), Expect = 3.559e-37
Identity = 95/393 (24.17%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL K    +  S      +H A R +H+DVA+ LI+ K  +     D   P+H A+R G   +V  L+    + +        P+H   R    + A +L+       + TK+ + P+H A +YG  +I  +L+ +    N+      +P+H A  + + NI   LL KG +      +   P+H A    +   A+ L+  G    + + +   P+H A++ GH  +V +L++ + ++       + P+H A +        + ++ IA +L+  +  +  +     +PL +                              A   GNIK  + +++ + ++N   K    P+H A  +GH +IV LLLKN  
Sbjct:  437 GLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQ--------EGHLNIAEVLVSHDASVAAETRMGFAPLHV------------------------------ACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 791          

HSP 6 Score: 141.739 bits (356), Expect = 4.673e-33
Identity = 99/422 (23.46%), Postives = 192/422 (45.50%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPL---------------------------DLNAQ--TSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKL--ENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            A+R G L+     L    DI+  + +   A+H + +E H  +   L+ K   +E         +H A+  G  ++V  L+    N+ ++ +  + P++ A + N   +   L++   +    T++ + P+  A + GH  ++  L++  +                           D NA   +   ++P+H A +YE  N+A  LL +G NV     + +  +H A   GN  + +LL+D+G  I++C ++   P+H A R GH  + E+L++    ++A T + + PIH A +       GD +++   LL++    I+       +PL +A   G+  V  L+ +K    N    NG   L  A ++ +I+  E++++    I+   +  + P+H A   GH+ IVK LL+     ++
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQ-------GD-HLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNV 465          

HSP 7 Score: 140.198 bits (352), Expect = 1.649e-32
Identity = 85/363 (23.42%), Postives = 160/363 (44.08%), Query Frame = 3
Query:  129 FHQAIRTGNVD--DFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM 1211
             H A R  + D  DF    K +   + +  + P+H A+R G  E+++LLL+     D  ++     +H   R  H+  AELL+  +            P+H A++YG + I   L+ +  +  +  K    P+H A  +N   I  +L+ K        +  + P+H A +    +    L+      NAQ+ Q  +P+H A    + ++ + LL K  NV  G    + P+H A   G+  IA++L+     + +     + P+H A  YG+  +V+ L+  + ++ A T     P+H A +          + +I  LL++     N  + +  +PL +A   G   V +++    + P++
Sbjct:  474 LHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQ--------GHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHI 828          

HSP 8 Score: 94.7449 bits (234), Expect = 1.046e-18
Identity = 80/387 (20.67%), Postives = 167/387 (43.15%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIKLNPIFISS 1571
            A+R G L+     +    +I   ++N    +H + +    ++ T L+ K+  +E  TK+    +H A   G  +++  L+    ++N+Q+ + ++P++ A    +  +   LLE G N    T D   P+  A   G+  +   LI  G       +     +H A+R        +L+    + +  +     P+H A  + +        + +A LL+ R   +N   ++  S L +A   GN  ++ L+ ++    +      L     A + G+++ +E+++     I    K+ + PIH A    H++ V+LLL+    +D I   + +   V +      + K+ L+   + N    N +  L++ CK  HI++  + + S
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYEN--------LNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 426          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 190.274 bits (482), Expect = 4.952e-48
Identity = 105/395 (26.58%), Postives = 199/395 (50.38%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK    +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H A    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  365 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 751          

HSP 2 Score: 184.111 bits (466), Expect = 4.077e-46
Identity = 105/455 (23.08%), Postives = 211/455 (46.37%), Query Frame = 3
Query:   60 NINLIFYDKFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            N+  +  ++        ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  +  AK  N + P+H AC+ N+  +  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H A+R GH  +   L++    +   T     P+H A K+          +E+A+LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  243 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 689          

HSP 3 Score: 167.162 bits (422), Expect = 6.999e-41
Identity = 101/428 (23.60%), Postives = 200/428 (46.73%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK--------------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK     +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS               A     E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  A++EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  167 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK 590          

HSP 4 Score: 162.925 bits (411), Expect = 1.339e-39
Identity = 104/460 (22.61%), Postives = 211/460 (45.87%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ +S  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K    NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV +L+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L +L  N N N
Sbjct:  229 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSL-LLSRNANVN 685          

HSP 5 Score: 162.54 bits (410), Expect = 1.533e-39
Identity = 85/393 (21.63%), Postives = 173/393 (44.02%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H A R    ++A  L+     +   TK+ + P+H A +YG  E+ ++L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L++   ++       + P+H A +        ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+    +H A  +GH  I+ +LL+NN 
Sbjct:  427 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQ--------EDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 781          

HSP 6 Score: 154.066 bits (388), Expect = 6.031e-37
Identity = 76/344 (22.09%), Postives = 170/344 (49.42%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS 1235
            G   +H A+R GQ E+++ L+     ++A++ D+   +H + R   +D+ + L+++  +          P+H A+R G  ++   L+    ++    K  + P+H A +  + E+A++L++K+   +A  K    P+H A  Y + ++  +L+ +    +A     ++P+H A      +IA++LLE G +  + T   +  +H A   G+  +  LL+ +  ++   N+    P+H A++     + E+L+N    ++A T     P+H  C + +        ++I   L++ + ++N + ++  + L  A + G+  +IN++ +   +PN    NG+  L+
Sbjct:  460 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN--------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALA 795          

HSP 7 Score: 150.214 bits (378), Expect = 8.476e-36
Identity = 99/418 (23.68%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM-----------------------AKPL----DLNA--QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            A+R G LE     +    D++  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                       A  L    D NA  ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  +PN    NG   L  A ++  I+  E++++    I    +  + PIH A   GH+ IV  L+ +  
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGA 451          

HSP 8 Score: 147.132 bits (370), Expect = 9.551e-35
Identity = 83/356 (23.31%), Postives = 164/356 (46.07%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGR---RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +   +Y  ++  + E   +    P+H ++R G+ +I++ LL +    +A ++  +  +H A RE H DVA  L+    ++         P+H A++YG L + + L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +    +H A +          +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  464 LHMAARSGQAE-VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQ--------GHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 810          

HSP 9 Score: 142.895 bits (359), Expect = 1.713e-33
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE--KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H A+R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+++  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  +  +H A++ GH  ++ +L+
Sbjct:  491 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 777          

HSP 10 Score: 111.694 bits (278), Expect = 4.950e-24
Identity = 81/392 (20.66%), Postives = 164/392 (41.84%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN----------------------------------LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            A+R G L      I    ++   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                                   L++  +   ++TN +   L  A+  G+ K A+V++ +K   N    +   P+H AC K  I +++LLLK+   +  +
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV 423          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 189.889 bits (481), Expect = 6.017e-48
Identity = 105/395 (26.58%), Postives = 199/395 (50.38%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK    +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H A    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 740          

HSP 2 Score: 184.111 bits (466), Expect = 4.365e-46
Identity = 105/455 (23.08%), Postives = 211/455 (46.37%), Query Frame = 3
Query:   60 NINLIFYDKFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            N+  +  ++        ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  +  AK  N + P+H AC+ N+  +  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H A+R GH  +   L++    +   T     P+H A K+          +E+A+LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 678          

HSP 3 Score: 167.162 bits (422), Expect = 6.786e-41
Identity = 101/428 (23.60%), Postives = 200/428 (46.73%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK--------------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK     +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS               A     E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  A++EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  156 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 4 Score: 162.54 bits (410), Expect = 1.565e-39
Identity = 104/460 (22.61%), Postives = 211/460 (45.87%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ +S  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K    NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV +L+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L +L  N N N
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSL-LLSRNANVN 674          

HSP 5 Score: 162.54 bits (410), Expect = 1.647e-39
Identity = 85/393 (21.63%), Postives = 173/393 (44.02%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H A R    ++A  L+     +   TK+ + P+H A +YG  E+ ++L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L++   ++       + P+H A +        ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+    +H A  +GH  I+ +LL+NN 
Sbjct:  416 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQ--------EDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 770          

HSP 6 Score: 154.066 bits (388), Expect = 6.653e-37
Identity = 76/344 (22.09%), Postives = 170/344 (49.42%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS 1235
            G   +H A+R GQ E+++ L+     ++A++ D+   +H + R   +D+ + L+++  +          P+H A+R G  ++   L+    ++    K  + P+H A +  + E+A++L++K+   +A  K    P+H A  Y + ++  +L+ +    +A     ++P+H A      +IA++LLE G +  + T   +  +H A   G+  +  LL+ +  ++   N+    P+H A++     + E+L+N    ++A T     P+H  C + +        ++I   L++ + ++N + ++  + L  A + G+  +IN++ +   +PN    NG+  L+
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN--------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALA 784          

HSP 7 Score: 150.214 bits (378), Expect = 8.379e-36
Identity = 99/418 (23.68%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM-----------------------AKPL----DLNA--QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            A+R G LE     +    D++  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                       A  L    D NA  ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  +PN    NG   L  A ++  I+  E++++    I    +  + PIH A   GH+ IV  L+ +  
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGA 440          

HSP 8 Score: 146.747 bits (369), Expect = 1.091e-34
Identity = 83/356 (23.31%), Postives = 164/356 (46.07%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGR---RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +   +Y  ++  + E   +    P+H ++R G+ +I++ LL +    +A ++  +  +H A RE H DVA  L+    ++         P+H A++YG L + + L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +    +H A +          +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  453 LHMAARSGQAE-VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQ--------GHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 9 Score: 142.895 bits (359), Expect = 1.653e-33
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE--KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H A+R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+++  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  +  +H A++ GH  ++ +L+
Sbjct:  480 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 10 Score: 112.849 bits (281), Expect = 2.129e-24
Identity = 85/411 (20.68%), Postives = 171/411 (41.61%), Query Frame = 3
Query:  372 KKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN----------------------------------LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            K+K    + +   LR    A+R G L      I    ++   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                                   L++  +   ++TN +   L  A+  G+ K A+V++ +K   N    +   P+H AC K  I +++LLLK+   +  +
Sbjct:   16 KRKGKKSDANASYLR----AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV 412          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 189.889 bits (481), Expect = 7.702e-48
Identity = 105/395 (26.58%), Postives = 199/395 (50.38%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK    +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H A    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 740          

HSP 2 Score: 183.341 bits (464), Expect = 6.605e-46
Identity = 105/455 (23.08%), Postives = 211/455 (46.37%), Query Frame = 3
Query:   60 NINLIFYDKFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            N+  +  ++        ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  +  AK  N + P+H AC+ N+  +  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H A+R GH  +   L++    +   T     P+H A K+          +E+A+LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 678          

HSP 3 Score: 166.392 bits (420), Expect = 9.855e-41
Identity = 101/428 (23.60%), Postives = 200/428 (46.73%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK--------------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK     +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS               A     E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  A++EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  156 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 4 Score: 162.155 bits (409), Expect = 2.138e-39
Identity = 85/393 (21.63%), Postives = 173/393 (44.02%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H A R    ++A  L+     +   TK+ + P+H A +YG  E+ ++L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L++   ++       + P+H A +        ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+    +H A  +GH  I+ +LL+NN 
Sbjct:  416 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQ--------EDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 770          

HSP 5 Score: 162.155 bits (409), Expect = 2.387e-39
Identity = 104/460 (22.61%), Postives = 211/460 (45.87%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ +S  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K    NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV +L+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L +L  N N N
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSL-LLSRNANVN 674          

HSP 6 Score: 153.68 bits (387), Expect = 8.396e-37
Identity = 76/344 (22.09%), Postives = 170/344 (49.42%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS 1235
            G   +H A+R GQ E+++ L+     ++A++ D+   +H + R   +D+ + L+++  +          P+H A+R G  ++   L+    ++    K  + P+H A +  + E+A++L++K+   +A  K    P+H A  Y + ++  +L+ +    +A     ++P+H A      +IA++LLE G +  + T   +  +H A   G+  +  LL+ +  ++   N+    P+H A++     + E+L+N    ++A T     P+H  C + +        ++I   L++ + ++N + ++  + L  A + G+  +IN++ +   +PN    NG+  L+
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN--------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALA 784          

HSP 7 Score: 149.828 bits (377), Expect = 1.220e-35
Identity = 99/418 (23.68%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM-----------------------AKPL----DLNA--QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            A+R G LE     +    D++  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                       A  L    D NA  ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  +PN    NG   L  A ++  I+  E++++    I    +  + PIH A   GH+ IV  L+ +  
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGA 440          

HSP 8 Score: 146.362 bits (368), Expect = 1.397e-34
Identity = 83/356 (23.31%), Postives = 164/356 (46.07%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGR---RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +   +Y  ++  + E   +    P+H ++R G+ +I++ LL +    +A ++  +  +H A RE H DVA  L+    ++         P+H A++YG L + + L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +    +H A +          +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  453 LHMAARSGQAE-VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQ--------GHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 9 Score: 142.51 bits (358), Expect = 2.114e-33
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE--KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H A+R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+++  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  +  +H A++ GH  ++ +L+
Sbjct:  480 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 10 Score: 112.849 bits (281), Expect = 2.677e-24
Identity = 85/411 (20.68%), Postives = 171/411 (41.61%), Query Frame = 3
Query:  372 KKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN----------------------------------LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            K+K    + +   LR    A+R G L      I    ++   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                                   L++  +   ++TN +   L  A+  G+ K A+V++ +K   N    +   P+H AC K  I +++LLLK+   +  +
Sbjct:   16 KRKGKKSDANASYLR----AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV 412          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 189.504 bits (480), Expect = 9.052e-48
Identity = 105/395 (26.58%), Postives = 199/395 (50.38%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK    +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H A    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 740          

HSP 2 Score: 183.341 bits (464), Expect = 8.138e-46
Identity = 105/455 (23.08%), Postives = 211/455 (46.37%), Query Frame = 3
Query:   60 NINLIFYDKFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            N+  +  ++        ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  +  AK  N + P+H AC+ N+  +  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H A+R GH  +   L++    +   T     P+H A K+          +E+A+LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 678          

HSP 3 Score: 166.777 bits (421), Expect = 9.176e-41
Identity = 101/428 (23.60%), Postives = 200/428 (46.73%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK--------------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK     +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS               A     E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  A++EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  156 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 4 Score: 162.155 bits (409), Expect = 2.090e-39
Identity = 104/460 (22.61%), Postives = 211/460 (45.87%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ +S  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K    NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV +L+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L +L  N N N
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSL-LLSRNANVN 674          

HSP 5 Score: 161.77 bits (408), Expect = 2.718e-39
Identity = 85/393 (21.63%), Postives = 173/393 (44.02%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H A R    ++A  L+     +   TK+ + P+H A +YG  E+ ++L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L++   ++       + P+H A +        ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+    +H A  +GH  I+ +LL+NN 
Sbjct:  416 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQ--------EDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 770          

HSP 6 Score: 153.295 bits (386), Expect = 1.036e-36
Identity = 76/344 (22.09%), Postives = 170/344 (49.42%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS 1235
            G   +H A+R GQ E+++ L+     ++A++ D+   +H + R   +D+ + L+++  +          P+H A+R G  ++   L+    ++    K  + P+H A +  + E+A++L++K+   +A  K    P+H A  Y + ++  +L+ +    +A     ++P+H A      +IA++LLE G +  + T   +  +H A   G+  +  LL+ +  ++   N+    P+H A++     + E+L+N    ++A T     P+H  C + +        ++I   L++ + ++N + ++  + L  A + G+  +IN++ +   +PN    NG+  L+
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN--------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALA 784          

HSP 7 Score: 149.828 bits (377), Expect = 1.324e-35
Identity = 99/418 (23.68%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM-----------------------AKPL----DLNA--QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            A+R G LE     +    D++  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                       A  L    D NA  ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  +PN    NG   L  A ++  I+  E++++    I    +  + PIH A   GH+ IV  L+ +  
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGA 440          

HSP 8 Score: 146.362 bits (368), Expect = 1.606e-34
Identity = 83/356 (23.31%), Postives = 164/356 (46.07%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGR---RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +   +Y  ++  + E   +    P+H ++R G+ +I++ LL +    +A ++  +  +H A RE H DVA  L+    ++         P+H A++YG L + + L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +    +H A +          +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  453 LHMAARSGQAE-VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQ--------GHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 9 Score: 142.51 bits (358), Expect = 2.287e-33
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE--KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H A+R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+++  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  +  +H A++ GH  ++ +L+
Sbjct:  480 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 10 Score: 112.464 bits (280), Expect = 3.224e-24
Identity = 85/411 (20.68%), Postives = 171/411 (41.61%), Query Frame = 3
Query:  372 KKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN----------------------------------LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            K+K    + +   LR    A+R G L      I    ++   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                                   L++  +   ++TN +   L  A+  G+ K A+V++ +K   N    +   P+H AC K  I +++LLLK+   +  +
Sbjct:   16 KRKGKKSDANASYLR----AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV 412          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 189.504 bits (480), Expect = 9.866e-48
Identity = 105/395 (26.58%), Postives = 199/395 (50.38%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK    +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H A    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 740          

HSP 2 Score: 182.956 bits (463), Expect = 9.741e-46
Identity = 105/455 (23.08%), Postives = 211/455 (46.37%), Query Frame = 3
Query:   60 NINLIFYDKFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            N+  +  ++        ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  +  AK  N + P+H AC+ N+  +  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H A+R GH  +   L++    +   T     P+H A K+          +E+A+LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 678          

HSP 3 Score: 166.392 bits (420), Expect = 1.176e-40
Identity = 101/428 (23.60%), Postives = 200/428 (46.73%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK--------------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK     +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS               A     E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  A++EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  156 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 4 Score: 162.155 bits (409), Expect = 2.547e-39
Identity = 104/460 (22.61%), Postives = 211/460 (45.87%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ +S  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K    NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV +L+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L +L  N N N
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSL-LLSRNANVN 674          

HSP 5 Score: 161.77 bits (408), Expect = 2.844e-39
Identity = 85/393 (21.63%), Postives = 173/393 (44.02%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H A R    ++A  L+     +   TK+ + P+H A +YG  E+ ++L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L++   ++       + P+H A +        ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+    +H A  +GH  I+ +LL+NN 
Sbjct:  416 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQ--------EDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 770          

HSP 6 Score: 153.295 bits (386), Expect = 1.094e-36
Identity = 76/344 (22.09%), Postives = 170/344 (49.42%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS 1235
            G   +H A+R GQ E+++ L+     ++A++ D+   +H + R   +D+ + L+++  +          P+H A+R G  ++   L+    ++    K  + P+H A +  + E+A++L++K+   +A  K    P+H A  Y + ++  +L+ +    +A     ++P+H A      +IA++LLE G +  + T   +  +H A   G+  +  LL+ +  ++   N+    P+H A++     + E+L+N    ++A T     P+H  C + +        ++I   L++ + ++N + ++  + L  A + G+  +IN++ +   +PN    NG+  L+
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN--------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALA 784          

HSP 7 Score: 149.443 bits (376), Expect = 1.628e-35
Identity = 99/418 (23.68%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM-----------------------AKPL----DLNA--QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            A+R G LE     +    D++  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                       A  L    D NA  ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  +PN    NG   L  A ++  I+  E++++    I    +  + PIH A   GH+ IV  L+ +  
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGA 440          

HSP 8 Score: 146.362 bits (368), Expect = 1.668e-34
Identity = 83/356 (23.31%), Postives = 164/356 (46.07%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGR---RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +   +Y  ++  + E   +    P+H ++R G+ +I++ LL +    +A ++  +  +H A RE H DVA  L+    ++         P+H A++YG L + + L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +    +H A +          +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  453 LHMAARSGQAE-VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQ--------GHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 9 Score: 142.51 bits (358), Expect = 2.457e-33
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE--KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H A+R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+++  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  +  +H A++ GH  ++ +L+
Sbjct:  480 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 10 Score: 112.464 bits (280), Expect = 3.467e-24
Identity = 85/411 (20.68%), Postives = 171/411 (41.61%), Query Frame = 3
Query:  372 KKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN----------------------------------LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            K+K    + +   LR    A+R G L      I    ++   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                                   L++  +   ++TN +   L  A+  G+ K A+V++ +K   N    +   P+H AC K  I +++LLLK+   +  +
Sbjct:   16 KRKGKKSDANASYLR----AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV 412          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 7.440e-47
Identity = 105/395 (26.58%), Postives = 199/395 (50.38%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK    +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H A    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 740          

HSP 2 Score: 182.956 bits (463), Expect = 6.857e-45
Identity = 105/455 (23.08%), Postives = 211/455 (46.37%), Query Frame = 3
Query:   60 NINLIFYDKFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            N+  +  ++        ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  +  AK  N + P+H AC+ N+  +  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H A+R GH  +   L++    +   T     P+H A K+          +E+A+LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 678          

HSP 3 Score: 166.392 bits (420), Expect = 7.919e-40
Identity = 101/428 (23.60%), Postives = 200/428 (46.73%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK--------------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK     +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS               A     E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  A++EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  156 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK 579          

HSP 4 Score: 162.155 bits (409), Expect = 1.773e-38
Identity = 104/460 (22.61%), Postives = 211/460 (45.87%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ +S  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K    NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV +L+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L +L  N N N
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSL-LLSRNANVN 674          

HSP 5 Score: 161.77 bits (408), Expect = 2.082e-38
Identity = 85/393 (21.63%), Postives = 173/393 (44.02%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H A R    ++A  L+     +   TK+ + P+H A +YG  E+ ++L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L++   ++       + P+H A +        ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+    +H A  +GH  I+ +LL+NN 
Sbjct:  416 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQ--------EDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 770          

HSP 6 Score: 153.295 bits (386), Expect = 7.737e-36
Identity = 76/344 (22.09%), Postives = 170/344 (49.42%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS 1235
            G   +H A+R GQ E+++ L+     ++A++ D+   +H + R   +D+ + L+++  +          P+H A+R G  ++   L+    ++    K  + P+H A +  + E+A++L++K+   +A  K    P+H A  Y + ++  +L+ +    +A     ++P+H A      +IA++LLE G +  + T   +  +H A   G+  +  LL+ +  ++   N+    P+H A++     + E+L+N    ++A T     P+H  C + +        ++I   L++ + ++N + ++  + L  A + G+  +IN++ +   +PN    NG+  L+
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN--------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALA 784          

HSP 7 Score: 149.443 bits (376), Expect = 1.131e-34
Identity = 99/418 (23.68%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM-----------------------AKPL----DLNA--QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            A+R G LE     +    D++  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                       A  L    D NA  ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  +PN    NG   L  A ++  I+  E++++    I    +  + PIH A   GH+ IV  L+ +  
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGA 440          

HSP 8 Score: 145.976 bits (367), Expect = 1.240e-33
Identity = 83/356 (23.31%), Postives = 164/356 (46.07%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGR---RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +   +Y  ++  + E   +    P+H ++R G+ +I++ LL +    +A ++  +  +H A RE H DVA  L+    ++         P+H A++YG L + + L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +    +H A +          +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  453 LHMAARSGQAE-VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQ--------GHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 9 Score: 142.51 bits (358), Expect = 1.795e-32
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE--KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H A+R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+++  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  +  +H A++ GH  ++ +L+
Sbjct:  480 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 10 Score: 112.464 bits (280), Expect = 2.591e-23
Identity = 85/411 (20.68%), Postives = 171/411 (41.61%), Query Frame = 3
Query:  372 KKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN----------------------------------LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            K+K    + +   LR    A+R G L      I    ++   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                                   L++  +   ++TN +   L  A+  G+ K A+V++ +K   N    +   P+H AC K  I +++LLLK+   +  +
Sbjct:   16 KRKGKKSDANASYLR----AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV 412          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 185.652 bits (470), Expect = 9.432e-46
Identity = 108/404 (26.73%), Postives = 197/404 (48.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS 1421
            P+H A+  G   + K+LLDK    ++R+ + +  +H AC+++H  V ELL+K   +I+      L P+H AS  G L IV +L+ +  +    +     P+H A R    E+A  L++    + A  K++  P+H A R GH  ++ +L+    + N  T+   +P+H A    +      LLEK  +    T     P+H A   G  ++A+LL+++     +  +    P+H A  + +  +V++L+       +P  +   P+H A K N         VE+A  L++     N ++    +PL LA + G+ E++ L+  K  N N+ N   L      +QEG++  A+V+I+    ++   +    P+H A   G+I++VK LL++  +++   K   S
Sbjct:  341 PLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ--------VEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYS 736          

HSP 2 Score: 180.259 bits (456), Expect = 5.138e-44
Identity = 116/456 (25.44%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q+ L   H A + G+V    +   +E +     + G   +H A+  GQ E+++ L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +   +N       +P+H A       +   LL++G  +E+ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH A++  H   V +L+    +++  TLD + P+H A  C H+  +K                          N+V +  LL++    I+   ES  +PL +A   G+  ++  + ++  +PN++N      L  A++ G+ + A+ +++ K  +N   KDD  P+H A   GH  +VKLLL+NN 
Sbjct:   43 QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNA 494          

HSP 3 Score: 176.022 bits (445), Expect = 8.096e-43
Identity = 104/392 (26.53%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGN-EEVINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++   ++    +    +H A R  +  +  LL+ +   IE    D L P+H A+R G + I   L+     I+AK KN   PIH A + +  +   +L++ + +I+  T ++  P+H A   GH  +  +L+ K    N++    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ +G      N +   P+H A+R GH  + + L+  K  + A   D   P+H A +          +  +  LL+E N   N+   +  +PL +A   G+ E V+ L++++     MT      L  A++ G ++ AE+++ R    N   K+ + P+H A    +++IVKLLL
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAAR--------IGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 589          

HSP 4 Score: 174.866 bits (442), Expect = 2.058e-42
Identity = 103/392 (26.28%), Postives = 192/392 (48.98%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  ++     + + P+H ASR G + +V  L+ +   IE K K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+    +++  T  + +P+H A +  +  +A  LL+KG    S   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+          +    P+H       A++AG  + E+A  L++   ++N + +  Q+PL  A   G+  ++ L+ E   NPN+  T GH  L  A++EG+++    ++ ++       K    P+H A   G + + +LLL+ + 
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHM------AARAG--HTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA 560          

HSP 5 Score: 171.014 bits (432), Expect = 3.000e-41
Identity = 113/483 (23.40%), Postives = 211/483 (43.69%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDD----FNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS 1439
            Q+ +   H A R GNV       ++  + E   K++    P+H A+R+G + I ++LLD    I A++ +    IH A +  H D   LL++    I++   D L P+H A+  G   +   L+ K     ++  N + P+H AC+ N   +  +L+K    I+A T+    P+H A   GH  I+  L+ +    N    +  +P+H A    +  +A  LL+    V +   D   P+H A   G+  + +LL++   +          P+H A+R GH   V  L+  +      T     P+H A K+          V +A LL+ER+   N   ++  +PL +A+ + N +++ L+  +  +P+    NG+  L                                   A+QEG+ +   +++ ++ + N+ +K  + P+H    +GH+ +  +L+K+   +D   +   +   V S
Sbjct:  237 QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGK--------VRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVAS 709          

HSP 6 Score: 155.606 bits (392), Expect = 1.661e-36
Identity = 96/393 (24.43%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL +    +  +      +H A R  H++VA+ L++ K  +     D   P+H A+R G  N+V  L+  + N          P+H A R    E    L++K       TK+ + P+H A +YG   +  +L+ +    NA      +P+H A ++   +I   LL +G +  S   +   P+H A      ++A+ L+  G    + + +   P+H A++ GH  +V +L++ + +        + P+H   +        + +V +A +LI+    ++       +PL +                              AS  GNIK  + +++ + D+N   K    P+H A  +GH +IV LLLKN  
Sbjct:  404 GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQ--------EGHVPVADVLIKHGVMVDATTRMGYTPLHV------------------------------ASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 758          

HSP 7 Score: 132.494 bits (332), Expect = 1.792e-29
Identity = 70/272 (25.74%), Postives = 132/272 (48.53%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA 1025
            G  P+H A+R G +E +  LL+K       +   +  +H A +     VAELL+++  +      + L P+H A  +  L+IV  L+ +  +  +   N + P+H A + NQ E+A  L++      A + +   P+H A + GHAE++ +L++K  + N       +P+H      +  +A  L++ GV V++ T     P+H A   GN ++ + L+    D+ +  +  + P+H A++ GH  +V +L+         + D   P+  A
Sbjct:  503 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 8 Score: 129.798 bits (325), Expect = 1.242e-28
Identity = 88/401 (21.95%), Postives = 182/401 (45.39%), Query Frame = 3
Query:  297 RSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENI-----------------------------ASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE---KLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            R +D   +   A R  + D A   ++   +I  C+ + L  +H AS+ G + +V  L+ K   +E   K     +H A    Q E+   LV    ++ A +++ + P++ A +  H E++  L+    + N  T   ++P+  A    +EN+                             A+ LL+   N +  +     P+H A    N  +AQLL+++G  +    +    P+H ASR G+  +V +L++    +E  T D++ P+H A +        + +V I+ +L++    I  + ++  SP+ +A +  + + + L+ +   ++++  + +   L  A+  G+ + A+V++ +    N    +   P+H AC K H+ +++LLLK    +D +
Sbjct:    8 READAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAAR--------NGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAV 400          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 1.905e-44
Identity = 109/404 (26.98%), Postives = 196/404 (48.51%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS 1421
            P+H A+  G   + K+LLDK    ++R+ + +  +H AC+++H  V ELL+K   +I+      L P+H AS  G L IV +L+ +  +    +     P+H A R    E+A  L++      A  K++  P+H A R GH  ++ +L+      N  T+   +P+H A    + + A  LLEK  +    T     P+H A   G  ++A+LL++      +  +    P+H A  + +  +V++L+       +P  +   P+H A K N         +E+A  L++     N ++    +PL LA + G+ E++ L+  K  N N+ N   L      SQEG++  A+V+I+    ++   +    P+H A   G+I++VK LL++  +++   K   S
Sbjct:  337 PLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ--------IEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYS 732          

HSP 2 Score: 169.474 bits (428), Expect = 9.847e-41
Identity = 114/456 (25.00%), Postives = 219/456 (48.03%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q+ L   H A + G+V    +   +E +     + G   +H A+  GQ E+++ L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +   +N       +P+H A       +   LL++G  +E+ T D++ P+H A  NG+ +I+++L+D G  I++  +    PIH A++  H   V +L+    +++  TLD + P+H A  C H+  +K                          N++ +  LL++    I+   ES  +PL +A   G+  ++  + ++  +PN++N      L  A++ G+ + A+ +++ K   N   KDD  P+H A   GH  +VKLLL+N  
Sbjct:   39 QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGA 490          

HSP 3 Score: 167.933 bits (424), Expect = 2.914e-40
Identity = 102/392 (26.02%), Postives = 193/392 (49.23%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNM--TNGHRLL-SASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    + +VA+LL+ +  ++     + + P+H ASR G + +V  L+ +   IE + K++  P+H A RN    I+ IL+     I+A TK    P+H A +  H + + +L+    +++  T  + +P+H A +  +  +A  LL+KG    S   +   P+H AC   + ++ +LL+  G  I++  E    P+H AS  GH  +V+ L+          +    P+H       A++AG  + E+A  L++   + N + +  Q+PL  A   G+  ++ L+ E   +PN+  T GH  L +A++EG++  A  ++ ++       K    P+H A   G + + +LLL+++ 
Sbjct:  173 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHM------AARAG--HTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDA 556          

HSP 4 Score: 166.777 bits (421), Expect = 6.357e-40
Identity = 111/483 (22.98%), Postives = 208/483 (43.06%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDD----FNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS 1439
            Q+ +   H A R GNV       ++  + E   K++    P+H A+R+G + I ++LLD    I A++ +    IH A +  H D   LL++    I++   D L P+H A+  G   +   L+ K     ++  N + P+H AC+ N   +  +L+K    I+A T+    P+H A   GH  I+  L+ +    N    +  +P+H A    +  +A  LL+      +   D   P+H A   G+  + +LL++ G            P+H A+R GH      L+  +      T     P+H A K+          V +A LL+E +   N   ++  +PL +A+ + N +++ L+  +  +P+    NG+  L                                   A+QEG+ +   +++ ++ + N+ +K  + P+H    +GH+ +  +L+K+   +D   +   +   V S
Sbjct:  233 QNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGK--------VRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVAS 705          

HSP 5 Score: 164.851 bits (416), Expect = 2.065e-39
Identity = 101/392 (25.77%), Postives = 187/392 (47.70%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGN-EEVINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++   ++    +    +H A R  +  +  LL+ +   IE    D L P+H A+R G + I   L+     I+AK KN   PIH A + +  +   +L++ N +I+  T ++  P+H A   GH  +  +L+ K    N++    ++P+H AC   +  +   LL+ G ++++ T   + P+H A   G+  I + L+ +G      N +   P+H A+R GH  + + L+  K    A   D   P+H A +          +  +  LL+E     N+   +  +PL  A   G+ +  + L++++     MT      L  A++ G ++ AE+++      N   K+ + P+H A    +++IVKLLL
Sbjct:  202 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAAR--------IGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 585          

HSP 6 Score: 147.517 bits (371), Expect = 4.155e-34
Identity = 97/395 (24.56%), Postives = 171/395 (43.29%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLI--GKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H AS  G L I+K LL +    +  +      +H A R  H++VA+ L++ K        D   P+H A+R G   +V  L+  G S N+     +   P+H A R    + A  L++K       TK+ + P+H A +YG   +  +L+      NA      +P+H A ++   +I   LL +G +  S   +   P+H A      ++A+ L+  G    + + +   P+H A++ GH  +V +L++ + +        + P+H   +        + +V +A +LI+    ++       +PL +                              AS  GNIK  + +++ + D+N   K    P+H A  +GH +IV LLLKN  
Sbjct:  400 GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHT--PLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQ--------EGHVPVADVLIKHGVTVDATTRMGYTPLHV------------------------------ASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 754          

HSP 7 Score: 127.872 bits (320), Expect = 4.071e-28
Identity = 91/406 (22.41%), Postives = 183/406 (45.07%), Query Frame = 3
Query:  282 CDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENI-----------------------------ASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE---KLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            C  DA +S        A R  + D A   ++   +I  C+ + L  +H AS+ G + +V  L+ K   +E   K     +H A    Q E+   LV    ++ A +++ + P++ A +  H E++  L+    + N  T   ++P+  A    +EN+                             A+ LL+   N +  +     P+H A    N  +AQLL+++G  +    +    P+H ASR G+  +V +L++    +E  T D++ P+H A +        + +V I+ +L++    I  + ++  SP+ +A +  + + + L+ +   ++++  + +   L  A+  G+ + A+V++ +    N    +   P+H AC K HI +++LLLK    +D +
Sbjct:    4 CKADAATS-----FLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAAR--------NGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAV 396          

HSP 8 Score: 104.375 bits (259), Expect = 6.812e-21
Identity = 86/398 (21.61%), Postives = 173/398 (43.47%), Query Frame = 3
Query:  396 CDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEK---LENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIKLNPIFISS 1571
            C  D       A+R G L+     +    +I   ++N    +H A +    ++   L+ K   +E  TK+    +H A   G  E++  L+    ++NAQ+ + ++P++ A    +  +   LLE G N    T D   P+  A   G+  +   LI+ G       +     +H A+R        +L+    + +  +     P+H A  + +        + +A LL+ R   +N   ++  +PL +A   GN  ++ L+ ++   +E         L  A++ G+++ +E+++     I    K+ + PIH A    H++ V+LLL+ N E+D I   + +   V +      + K+ L+   + N    N +  L++ CK  HI++  + + +
Sbjct:    4 CKADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYEN--------LNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKT 389          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 5.493e-44
Identity = 104/395 (26.33%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK  + +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H +    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  379 LHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 765          

HSP 2 Score: 175.252 bits (443), Expect = 2.073e-42
Identity = 104/438 (23.74%), Postives = 206/438 (47.03%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  N  AK  N + P+H AC+ N+  +  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H ++R GH  +   L++    +   T     P+H A K+          +E+A+LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  274 RNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK 703          

HSP 3 Score: 154.836 bits (390), Expect = 2.833e-36
Identity = 103/460 (22.39%), Postives = 212/460 (46.09%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ ++  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K  + NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV +L+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L + R N N N
Sbjct:  243 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSLLLSR-NANVN 699          

HSP 4 Score: 154.836 bits (390), Expect = 3.243e-36
Identity = 101/436 (23.17%), Postives = 200/436 (45.87%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCN--------IEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASKAGDNY--------------VEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLSAS-QEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N        +         P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK  +  +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS    N                E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  S +EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  173 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK 604          

HSP 5 Score: 154.066 bits (388), Expect = 5.384e-36
Identity = 86/392 (21.94%), Postives = 174/392 (44.39%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNN 1385
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H + R    ++A  L+     +   TK+ + P+H A +YG  E+ ++L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L++   ++       + P+H A        A ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+   P+H A  +GH  I+ +LL+NN
Sbjct:  441 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLA--------AQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 794          

HSP 6 Score: 149.443 bits (376), Expect = 1.312e-34
Identity = 76/347 (21.90%), Postives = 173/347 (49.86%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLSASQ 1244
            G   +H A+R GQ E+++ L+     ++A++ D+   +H + R   +D+ + L+++  +          P+H ++R G  ++   L+    ++    K  + P+H A +  + E+A++L++K+   +A  K    P+H A  Y + ++  +L+ +    +A     ++P+H A      +IA++LLE G +  + T   +  +H A   G+  +  LL+ +  ++   N+    P+H A++     + E+L+N    ++A T     P+H  C + +        ++I   L++ + ++N + ++  +PL  A + G+  +IN++ +   +PN    NG+  L+ ++
Sbjct:  474 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGN--------IKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIAR 812          

HSP 7 Score: 147.517 bits (371), Expect = 4.736e-34
Identity = 99/422 (23.46%), Postives = 192/422 (45.50%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLD---------------------LNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            A+R G LE     +    D++  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                A+  D                     +N  T   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  NPN    NG   L  A ++  I+  E++++    I    +  + PIH A   GH+ IV  L+
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 461          

HSP 8 Score: 140.584 bits (353), Expect = 7.702e-32
Identity = 83/355 (23.38%), Postives = 164/355 (46.20%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +      ++  +   K +  + P+H ++R G+ +I++ LL +    +A ++  +  +H + RE H DVA  L+    ++         P+H A++YG L + + L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +   P+H A        A   +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  478 LHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQA--------AQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 824          

HSP 9 Score: 136.346 bits (342), Expect = 1.197e-30
Identity = 71/287 (24.74%), Postives = 139/287 (48.43%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLEKEQF--GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H ++R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+++  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  + P+H A++ GH  ++ +L+
Sbjct:  505 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 791          

HSP 10 Score: 112.464 bits (280), Expect = 2.415e-23
Identity = 83/398 (20.85%), Postives = 165/398 (41.46%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIES------CNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN----------------------------------LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            A+R G L      I    ++   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   DIES        E  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                                   L++  +   ++TN +   L  A+  G+ K A+V++ +K + N    +   P+H AC K  I +++LLLK+   +  +
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV 437          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 178.333 bits (451), Expect = 2.400e-43
Identity = 104/395 (26.33%), Postives = 200/395 (50.63%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+LLDK  + +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G +NIV+ L+    +    +      +H A R+ Q E+   LV+    +EA  K++  P+H + R G A+I+  L+ +    NA T+  ++P+H +    +E++A+ LL+ G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         ++IA  L+E     N       + + LA + G+ ++++L+  +  N N++N   L     A+QE  +  AEV++ +   ++   K    P+H  C  G+I+IV  LL+++ +++
Sbjct:  371 LHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN 757          

HSP 2 Score: 172.555 bits (436), Expect = 1.468e-41
Identity = 104/438 (23.74%), Postives = 206/438 (47.03%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            ++D+   H A + GN +          +   K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL++    +++   D L  +H A+  G   +   L+ K  N  AK  N + P+H AC+ N+ ++  +L+K    I+A T+    P+H A   GH  I++ LM      N    +  + +H A       +   L++ G  VE+   D   P+H +   G   I Q L+ +G    +     + P+H ++R GH  +   L++    +   T     P+H A K+          +E+A LL++++   +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  +  A  ++    D N   +  +  +H A  +GH+++V LLL  N  +++ +K
Sbjct:  266 RNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGK--------LEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNK 695          

HSP 3 Score: 156.762 bits (395), Expect = 8.408e-37
Identity = 101/428 (23.60%), Postives = 200/428 (46.73%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASKAGDNY--------------VEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLSAS-QEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ ++  ++   +ND  P+H A +     +  +L+ +   I+A T++   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++L+DK  +  +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS    N                E+   L++   Q+  + +  Q+PL ++   G  +++  + ++  +PN   T+G+  L  S +EG+   A  ++     ++I  K    P+H A   G +E+  LLL+ +   D   K
Sbjct:  173 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGK 596          

HSP 4 Score: 155.221 bits (391), Expect = 2.496e-36
Identity = 104/460 (22.61%), Postives = 212/460 (46.09%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK----------------HNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNN 1505
            G  P+H A+ +G + +  LLL++   +D  + ++   +H A +  ++++ +LL+ +   I+    D L P+H  +R G   +V  L+ ++  I +K KN   P+H A + +      +L++ N  ++  T +    +H A   GH ++  +L+ K  + NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L+  G    + N      +H A+R G   +V  L+     +EA   D   P+H + +                 N A+ +G         + + ++AA L++    +++  +   +PL +A + G  EV NL+ +K  +P+      L     A+   N K A +++ +    +   K+   P+H A  K  ++I   LL+   + + + +  + + SV    ++  ++ ++L + R N N N
Sbjct:  235 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTR--QGIASVHLAAQEGHVDMVSLLLGR-NANVN 691          

HSP 5 Score: 154.451 bits (389), Expect = 4.779e-36
Identity = 87/392 (22.19%), Postives = 173/392 (44.13%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNN 1385
            G  P+H A+  G + I+  L+      +  +     A+H A R   ++V   L++    +E    D   P+H ++R G  +IV  L+ +  +  A   + + P+H + R    ++A  L+     +   TK+ + P+H A +YG  E+ N+L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A       IA  L++ G D  +   +    +H A++ GH  +V +L+    ++       + P+H A        A ++ V +A +L+ +   ++ Q +   +PL +    GN +++N                               +++    +N   K+   P+H A  +GH  I+ +LL+NN
Sbjct:  433 GLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLA--------AQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNF------------------------------LLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 786          

HSP 6 Score: 149.443 bits (376), Expect = 1.569e-34
Identity = 100/414 (24.15%), Postives = 192/414 (46.38%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNA-------------QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            A+R G LE     +    DI+  + +   A+H A +E H +V   L++++ N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  E+   L+         T++ + P+  A + GH +++++L+                A+  D  A             ++   ++P+H A +Y   N+A+ LL +   V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ N  ++       + L +A   G+ +V  ++ +K  NPN    NG   L  A ++  IK  E++++    I    +  + PIH A   GH+ IV  L+
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 453          

HSP 7 Score: 138.272 bits (347), Expect = 3.513e-31
Identity = 83/355 (23.38%), Postives = 163/355 (45.92%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R+G  +      ++  +   K +  + P+H ++R G+ +I++ LL +    +A ++  +  +H + RE H DVA  L+    ++         P+H A++YG L +   L+ KS + +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    +I   L+    D NA T Q  + +H A    + ++ S LL +  NV       + P+H A       +A++L+++G  +++  +  + P+H    YG+  +V  L+     + A T +   P+H A        A   +  I  +L++ N   N    +  + L +A   G   V++ +K
Sbjct:  470 LHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQA--------AQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 8 Score: 135.191 bits (339), Expect = 3.090e-30
Identity = 71/287 (24.74%), Postives = 138/287 (48.08%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLEKEQF--GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            +DD    H + R G  D   +  ++          G  P+H ++R G  ++   LLD    +   +   +  +H A +    +VA LL++K  + +      L P+H A+ Y    +   L+ +  +  A  KN + P+H A + NQ +IAT L++   D  A T++    VH A + GH +++++L+ +  ++N       +P+H A   +  N+A  L+ +G +V++ T     P+H  C  GN +I   L+     + +  +  + P+H A++ GH  ++ +L+
Sbjct:  497 KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 783          

HSP 9 Score: 111.694 bits (278), Expect = 4.601e-23
Identity = 82/392 (20.92%), Postives = 166/392 (42.35%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN----------------------------------LIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            A+R G L      I    +I   ++N    +H A +    E+ + L+++  +++A TK+    +H A   G AE++ +L+    ++NAQ+   ++P++ A    +  +   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +A+        +  LL++R  +I+ +     +PL     +G+E+V+                                   L++  +   ++TN +   L  A+  G+ K A+V++ +K + N    +   P+H AC K  I++++LLLK+   +  +
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN--------MVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAV 429          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A182GGY8 (ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 5.348e-68
Identity = 134/400 (33.50%), Postives = 231/400 (57.75%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMT--NGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            P+H A ++G  E++++L+ +  +IDA +   +  +H AC+  H +V E+LI +K NI+        P+H A + G   +V  LI    NIEA ++ +W P+H+AC N   E+  IL+++  +IEA  ++NW P+H +CR+GH E++ IL+ + +++ A    NW+P+H AC   ++ +   L+ +  N+E+       P+H A  NG+ ++ ++LI +  +IE+  +ENW P+H A R GH  +VE+LI  K ++EA T D   P+H AC++  A        E+  +L++    I+   E K +PL LA +NG++EV+  LI EK     +T      L  A Q G+ +  E+++  K +I   ++D+  P+H AC KGH E+VK+L+     +D + +
Sbjct: 1336 PLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHA--------EVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQ 1727          

HSP 2 Score: 264.618 bits (675), Expect = 1.393e-67
Identity = 134/398 (33.67%), Postives = 232/398 (58.29%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEK--LENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            P+H+A ++G+ E++++L+ +  +I+A +  NW  +H AC+  H +V E+LIK+  NI+        P+H A   G    V  LIG+  NI+A D+N + P+H AC+N   E+  ILVK+  +I+A  ++ + P+H AC+ GH E++ IL+ +  +++A T +  +P+H AC   ++ +   L+    N+E+       P+HFAC NG+ ++ ++LI +  +IE+ N++NW P+H + R+GH  +VE+LI  K ++EA   D   P+H AC+        D + E+  +LI     I   N+   +PL +A  NG+E+V+  LI+EK  +E     N   L  A + G+ +  E++IR K +I    +D+  P+H AC  GH E+V++L+K    +D +
Sbjct: 1237 PLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQ--------DGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDAL 1626          

HSP 3 Score: 253.832 bits (647), Expect = 3.014e-64
Identity = 147/497 (29.58%), Postives = 266/497 (53.52%), Query Frame = 3
Query:  129 FHQAIRTGNV---DDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEK--LENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSL---------QSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            F  A++ G+    D   + F E    K+  G   +H A+  G +E +K L++   +++A S   + A+H +    H  + ELL+    N+   D +   P+H A   G+  +V  LIG   NI+A  KN   P+H+AC+N + E+  IL+++  +IEA  + NW P+H AC+ GH E++ IL+ +  +++A T   ++P+H AC   ++     L+ +  N+++   +K  P+H AC NG+ ++ ++L+ +  +I++  E+ + P+H A + GH  +VE+LI  K +++A T  +  P+H AC+        + + E+  +LI     I   N+   +PL  A  NG++EV+  LI+EK  +E  N  N   L  + + G+ +  E++IR K +I   ++D+  P+H AC  GH E+V++L++    ++ ++++N +          + VV  L +E+ N  AL      G  NW  L+L C+  H ++  I I  K
Sbjct: 1106 FQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPL-MHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQ--------NGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEAL------GQENWTPLHLACRNGHKEVVEILIRGK 1587          

HSP 4 Score: 244.973 bits (624), Expect = 1.460e-61
Identity = 142/464 (30.60%), Postives = 251/464 (54.09%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEK--LENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSL---------QSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            P+H+A   G  E++++L+    +IDA + +    +H+AC+    +V E+LI++K NIE  +     P+H A + G   +V  LI ++ NI+A  ++ + P+H AC     E   IL+ +  +I+A  +  + P+H AC+ GHAE++ IL+ +  +++A   + ++P+H AC   ++ +   L+ +  N+++ T  K  P+H AC NG+ ++ ++LI    +IE+ N+ NW P+HFA   GH  +VE+LI  K ++EA   D   P+H +C+H         + E+  +LI     I   N+   +PL LA ++G++EV+  LI+E+  +E  N  N   L  AS  G+ K  E++IR K +I    +++  P+H AC  GH E+V++L++    ++ + + N +            VV  L KE+ N  AL          +  L+L C+  H ++  I I  K
Sbjct: 1204 PLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRH--------GHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDAL------AEKKFTPLHLACQNGHKEVVEILIGEK 1653          

HSP 5 Score: 243.432 bits (620), Expect = 4.647e-61
Identity = 112/325 (34.46%), Postives = 200/325 (61.54%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEK 1193
            P+H + RHG  E++++L+ +  +I+A + DNW  +H AC++ H +V E+LI+++ NIE  +     P+H AS  G   +V  LI +  NIEA  + +W P+H ACRN   E+  IL++   +IEA T++NW P+H AC+ GHAE++ IL+ +  +++A   + ++P+H AC   ++ +   L+ +  N+++ T  K  P+H AC NG+ ++ ++L+ +  +IE+ N++NW P+H A   GH  +V++LI  K +++A T  +  P+H AC+          + E+  + + +N  I   ++ K +PL+LA +NG+ EV  ++KEK
Sbjct: 1468 PLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQR--------GHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIMKEK 1784          

HSP 6 Score: 231.106 bits (588), Expect = 2.912e-57
Identity = 117/390 (30.00%), Postives = 208/390 (53.33%), Query Frame = 3
Query:  204 QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            Q    P+H+A  +G  E++++L+ +  +I+A + DNW  +H +CR  H +V E+LI++K NIE  + D   P+H A + G   +V  LI +  NIEA ++ ++ P+H A  N   ++  IL+++  +IEA  +ENW P+H ACR GH E++ IL+    ++ A T  NW+P+H AC   +  +   L+++  N+++    K  P+H AC NG+ ++ ++LI +  +I++  E+   P+H A + GH  +VE+L+  K ++EA   D   P+H AC+          + E+  +LI     I+   + K +PL LA + G++EV+                              E+ +R+  +I   D +   P++ A   GH E+ K++
Sbjct: 1430 QVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACE--------KGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVV------------------------------EIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIM 1781          

HSP 7 Score: 183.341 bits (464), Expect = 1.339e-42
Identity = 132/503 (26.24%), Postives = 237/503 (47.12%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGK------SCNI--------------------------EAKDKN-DWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEK-----LENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSL---------QSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            G   + +A  +G   ++++LL+K  DI+ R+++ W A+HYA       +++ LI K  N+     +   P++ A+  G   +V  LI K      S NI                           A  K+ D   +H A  +   E    L+    ++ A +   +  +H +   GH  I+ +L+    ++NA  +  ++P+H+AC    + +   L+    N+++   +K  P+HFAC NG  ++ ++LI +  +IE+ N+ NW P+H A + GH  +VE+LI    +++A T  +  P+H AC           + E   +LI     I+  +E+K +PL  A +NG+ EV+  L+KEK     L     T  H    A Q G+ +  E++I  K +I+   +    P+H AC  GH E+V++L++    ++ +++ N +          + VV  L +E++N  AL        +NW  L+L C+  H ++  I I  K
Sbjct: 1003 GLAALIWAVIYGHKNLVRILLEKGADINIRNTEGWSALHYAVHHKRIAISKFLIDKGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLAC--------ARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHL---ACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEAL------NQDNWTPLHLSCRHGHKEVVEILIREK 1488          

HSP 8 Score: 179.489 bits (454), Expect = 2.528e-41
Identity = 90/297 (30.30%), Postives = 164/297 (55.22%), Query Frame = 3
Query:  105 VQQDDLELFHQAIRTGNVDDFNKYFKEE--FLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEA 989
            + QD+    H A + G+ +      +EE       Q+   P+H AS +G  +++++L+ +  +I+A   +NW  +H ACR  H +V E+LI+ K NIE    D   P+H A + G   +V  L+ +  NI+A  +  + P+H AC+N   E+  IL+ +  +I+A T++   P+H AC+ GH E++ IL+ +  ++ A    NW+P+H AC   ++ +   L+ +  N+++ T  K  P+H AC  G+ ++ ++ + K  +I + ++E   P++ AS+ GH T VE ++  K    A
Sbjct: 1494 LNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGH-TEVEKIMKEKAKFHA 1789          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: Q16FI9 (AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 8.552e-64
Identity = 124/466 (26.61%), Postives = 234/466 (50.21%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAG---DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI-----LRINGNNNWQKLNLVCKAMHIKLNPIFISSK 1574
            G  P+H A+ +G LE++KLL+D   ++D + +  W  +H A +  H +V +LLI+ + N++    +   P+H AS+ G L +V  LI    N++      W P+H A +N   E+  +L++   +++    E W P+HFA + GH E++  L+    +++    + W+P+H A    +  +   L+E   NV++  +    P+H A  NG+ ++ + LID   ++++   E W P+H AS+ GH  +V++LI+ K +++      + P+HFA ++          DN   +  LLIE    ++       +PL  A +NG+ EV+ L+ E   N   T       L  AS+ G+++  +++I  + +++    +   P++ A I GH+E+VKLL+ N   +D     N     +    K   L  + L I     +    N  W  L++  +  H+++  + I ++
Sbjct:   85 GWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQ--NEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNR 548          

HSP 2 Score: 232.261 bits (591), Expect = 1.181e-59
Identity = 109/405 (26.91%), Postives = 211/405 (52.10%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIK--------KAEV---MIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKN 1382
            GR P+H AS++G L+++KLL+D   ++D    + W  +H A    + +V +LLI    N++    +   P+H A+  G L +V  LI    N++ K    W P+H A +N   E+  +L++   +++    E W P+HFA + GH E++  L+    +++    + W+P+H A    +  +   L+E   NV++  ++   P+HFA  NG+ ++ + LID   ++++  +E W P+H A+  GH  +V++LI  + +++        P+H A +        + ++E+   LI+    ++       +PL +A +NG+ EV+ L+ +   N + T    +     ASQ G+++        +A V   +I  + +++      + P+H+A   GH+E+VKLL++N
Sbjct:   19 GRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQ--------NGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIEN 415          

HSP 3 Score: 231.106 bits (588), Expect = 2.881e-59
Identity = 111/413 (26.88%), Postives = 215/413 (52.06%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEY-----------ENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIID 1406
            G  P+H AS++G LE++KLL++   ++D + ++ W  +H+A +  H +V + LI  + N++    +   P+H A+  G L +V  LI    N++ K    W P+H A +N   E+   L+    +++    E W P+H A + GH E++ +L+    +++   ++  +P+HFA    +            N+   L+E   NV++  +  + P+HFA  NG+ ++ +LLI+   ++ +   E W P+HFASR GH  +V++LI  + +++    +   P++ A          + ++E+  LLI     ++       +PL +A +NG+ EV+ L+ +   N + T       L  ASQ G+++  +++I  + +++      + P++ A   GH+E+VKLL+ N   +D  D
Sbjct:  184 GWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASI--------NGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTD 588          

HSP 4 Score: 230.72 bits (587), Expect = 3.830e-59
Identity = 110/414 (26.57%), Postives = 215/414 (51.93%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQ-----------MRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            K+  G  P+H AS++G LE++KLL++   ++D + ++ W  +H+A +  H +V + LI  + N++    +   P+H AS+ G L +V  LI    N++ K    W P+H+A +N   E+   L+    +++    E W P+H A   GH E++ +L+    +++ + +  W+P+H A    +  +   L++   NV++   +   P+H A  NG+ ++ +LLID   ++++   +   P+HFAS+ GH  +V++LI+ + ++    ++            + P+HFA +        + ++E+  LLIE    +        +PL  A  NG+ EV+ L+ E   N + T       L  AS  G+++  +++I  + +++    +   P++ A   GH+E+VKLL+ N   +D
Sbjct:  114 KKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQ--------NGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVD 519          

HSP 5 Score: 228.794 bits (582), Expect = 1.576e-58
Identity = 108/410 (26.34%), Postives = 215/410 (52.44%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDI-----------DARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            G  P+H+AS++G LE++KLL+D   ++           D   +     +H+A +  H +V +LLI+ + N+     +   P+H ASR G L +V  LI    N++      W P++ A  N   E+  +L+    +++    E W P++ A + GH E++ +L+    +++   ++ W+P+H A    +  +   L++   NV++  +  + P++ A  NG+ ++ +LLID   ++++ + E W P+H AS+ GH  +V++LI  + +++      + P+HFA +        + ++E+  LLI+    ++       +PL +A +NG+ EV+ L+ E   N + T    +     ASQ G+++  +++I  + +++    +   P+H A   GH+E+VKLL+ N   +D
Sbjct:  349 GITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQ--------NGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVD 750          

HSP 6 Score: 224.172 bits (570), Expect = 5.003e-57
Identity = 104/399 (26.07%), Postives = 215/399 (53.88%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            G  P+H+AS++G LE++KLL++   ++    ++ W  +H+A R  H +V +LLI+ + N++    +   P++ AS  G L +V  LI    N++      W P++ A +N   E+  +L+    +++    E W P+H A + GH E++ +L+    +++   ++  +P++ A    +  +   L++   NV++  ++   P+H A  NG+ ++ +LLI+   ++++   +   P+HFAS+ GH  +V++LI+ + +++    +   P+H A +        + ++E+  LLIE    ++       +PL  A +NG+ EV+ L+ +   N + T       L  ASQ G+++  +++I  + +++      + P++ A I GH+E+VKLL+ N   +D
Sbjct:  393 GITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQ--------NGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVD 783          

HSP 7 Score: 211.46 bits (537), Expect = 8.485e-53
Identity = 100/379 (26.39%), Postives = 198/379 (52.24%), Query Frame = 3
Query:  255 ILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT---NGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKN 1382
            ++K L+D + +ID  ++     +H A +  H  V +LLI    N++    +   P+H A+  G L +V  LI    N++      W P+H A  N   E+  +L+    +++      W P+H A + GH E++ +L+    +++ + ++ W+P+HFA    +  +   L++   NV++   +   P+H A  NG+ ++ +LLI+   ++++   E W P+HFAS+ GH  +V+ LI+ + +++    +   P+H A +        + ++E+  LLIE    ++ +     +PL +A +NG+ EV+  + +   N + T       L  ASQ G+++  +++I  K +++      + P+H+A   GH+E+VKLL+ N
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAE--------NGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDN 371          

HSP 8 Score: 193.741 bits (491), Expect = 5.162e-47
Identity = 84/306 (27.45%), Postives = 168/306 (54.90%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQIN-VQNES 1124
            G  P++ AS++G LE++KLL+D   ++D   ++ W  +H A +  H +V +LLI  + N++      + P++ AS+ G L +V  LI    N++  D   W P+H A +N   E+  +L++   +++    +   P+HFA + GH E++ +L+    +++   ++ W+P+H A    +  +   L+E   NV++  +  + P+HFA  NG+ ++ +LLID   ++++   E W P+H AS+ GH  +V++LI+ + +++      + P++ A          + ++E+  LLI+    ++  QNE 
Sbjct:  492 GWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASI--------NGHLEVVKLLIDNRANVDTTQNEG 789          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: B3EU24 (Uncharacterized protein OS=Amoebophilus asiaticus (strain 5a2) OX=452471 GN=Aasi_1435 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 3.413e-63
Identity = 142/485 (29.28%), Postives = 259/485 (53.40%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLE---KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI-----LRINGNNNWQKLNLVCKAMHIKL 1550
             H A R GN++   KY  E+  +    ++ G   +HYA   G LE++KLL+DK  DI+ +S+D   A+H+A R  H ++ + L+ K  +I+  + ++   + +A + G L +V +L+ K  +I  K+KN W  +H+A R    EI   L+ K  DI     + W  +HFA RY H EI+  L+ K  D+N + +  W+ +HFA  Y +  I   LLEKG ++ +        +H AC NG+ ++ + L+DKG DI   N + W  +HFA+RY H  +V++L++   D+ A   +    +H AC+        ++++EI  LL+++   INV+N  + + L  A    + E++  + +K  + N+ N  +  +   A++  ++K  + ++ +  DIN+ D D    +H+A    H++IVKLLL+   ++   +K + +L  ++   KK +L  +   +     + +  N+ W  L+ V +  H+++
Sbjct:  805 LHYACREGNLE-VVKYLVEKGADINATDEDGETLLHYACNKGNLEVVKLLVDKGADINIKSNDQCTALHFATRYDHLEIVKYLLDKGADIQAKNKEVETLLIYACKKGDLEVVKNLVDKGSDINVKNKNQWTALHFATRYGHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKLLLEKGADINAKNKYGNTTLHKACENGHLEVVKYLLDKGADINVKNNDQWTALHFATRYNHLKIVKLLLDKGADINAKNKEGNTTLHKACE--------NDHLEIVKLLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATRYDHLKIVKYLLDKGADINVKDNDQWTALHFATRYDHLKIVKLLLEKGADIHAKNKESETL--LIYACKKGDLELVKYLLDKGADINVKNNDQWTALHFVTRYNHLEI 1278          

HSP 2 Score: 233.417 bits (594), Expect = 5.561e-58
Identity = 147/569 (25.83%), Postives = 279/569 (49.03%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI---LRINGNNNWQKLNLVCKAMHIKLNPIFISSKKENKCRFYLNNFYFPNEGVGKTQSEANCNAVEKFLNTFVNISKISSTTDYIL-----NNH-DVRFEVVSKAETQKITNQNGNLPL---KDKKIVNLADMILSKF 1859
            K ++G   +H A  +G LE++K LLDK  DI+ +++D W A+H+A R +H  + +LL+ K  +I   + +    +H A     L IV  L+ K  +I  K+ + W  +H+A R N  EI   L+ K  DI     + W  +HFA RY H +I+  L+ K  D+N + +  W+ +HFA  Y++  I   LLEKG ++ +   +    + +AC  G+ ++ + L+DKG DI   N + W  +HF +RY H  +V+ L++   D+ A        +H AC+        ++++EI  LL+++   INV+N  + + L  A    + E++  + +K  + N+ N  + ++   A++  +++  + ++ +  DIN+ + D    +H+A    H++IVKLLL    ++++ +    +     +     E+ K  L+    + +   N W  L+   +  H+K+  + +    +     +  N Y  N  + K     +   ++  +    +I+  +   +  L     N H +V   ++ K    +  N+NGN P+   K KK   L +++  K 
Sbjct: 1028 KNKYGNTTLHKACENGHLEVVKYLLDKGADINVKNNDQWTALHFATRYNHLKIVKLLLDKGADINAKNKEGNTTLHKACENDHLEIVKLLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATRYDHLKIVKYLLDKGADINVKDNDQWTALHFATRYDHLKIVKLLLEKGADIHAKNKESETLLIYACKKGDLELVKYLLDKGADINVKNNDQWTALHFVTRYNHLEIVKYLLDKGADINAKNKYGNTTLHKACE--------NDHLEIVKLLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWIALHFATRYNHLEIVKYLLDKGADINVKNNDQWIALHFATRYNHLKIVKLLLDKGADINVKNNDQWTALHFATRYDHLEIVKYLLDKGADINVKNKNQWTALHFATRYNHLKIVKLLLDKGAD----IHAKNKY-GNTPLHKACENGHLEVIKYLVEKGADINAKNKNGNTPLHKACENGHLEVVKYLLDKGADIQAKNKNGNTPIDIAKQKKYGALVNLLTEKL 1583          

HSP 3 Score: 223.787 bits (569), Expect = 4.529e-55
Identity = 140/509 (27.50%), Postives = 257/509 (50.49%), Query Frame = 3
Query:  126 LFHQAIRTGNVDDFNKYFKEEFLEKE---QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHND-------ASKAGD------------------NYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI---LRINGNNNWQKLNLVCKAMHIKL 1550
            L + A R G+++   KY  E+ ++ +   + G   +H A  +  LE++K L++K  DI+    D    +H  C+  + ++ + L++K  +I   DGD   P+H+A   G L IV  L+ K  +I   D      +HYACR    E+   LV+K  DI A  ++    +H+AC  G+ E++ +L+ K  D+N +++   + +HFA  Y++  I   LL+KG ++++   +    + +AC  G+ ++ + L+DKG DI   N+  W  +HFA+RYGH  +V+ L++   D+     DQ   +HFA ++N          K  D                  N++EI  LL+E+   IN +N+   + L  A ENG+ EV+  + +K  + N+ N  +  +   A++  ++K  ++++ +  DIN  +K+    +H AC   H+EIVKLLL    ++++ +    +     +     E+ K  L+    + +  N+ W  L+   +  H+K+
Sbjct:  672 LLYWACREGDLEVI-KYLVEKGVDIQATNEDGETLLHCAYSNNHLELVKYLVEKGADINITDGDGATLLHCICKNDNIELVKYLVEKGADINITDGDGWTPLHYACENGELEIVKYLVEKGADINVIDGYGVTSLHYACREGNLEVVKYLVEKGADINATDEDGETLLHYACNKGNLEVVKLLVDKGADINIKSNDQCTALHFATRYDHLEIVKYLLDKGADIQAKNKEVETLLIYACKKGDLEVVKNLVDKGSDINVKNKNQWTALHFATRYGHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKLLLEKGADINAKNKYGNTTLHKACENGHLEVVKYLLDKGADINVKNNDQWTALHFATRYNHLKIVKLLLDKGADINAKNKEGNTTLHKACENDHLEIVKLLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATRYDHLKI 1179          

HSP 4 Score: 215.312 bits (547), Expect = 2.181e-52
Identity = 134/488 (27.46%), Postives = 250/488 (51.23%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLE---KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKF-NRSLQSVVSGLKKEELNKIALEILRINGNNN--WQKLNLVCKAMHIKLNPIFI 1565
             H A R GN++   KY  E+  +   K + G  P H+A  +  LE++K LL+K  +I A+S ++   +++ACRE   +V + L++K  +I+  + D    +H A     L +V  L+ K  +I   D +    +H  C+N+  E+   LV+K  DI     + W P+H+AC  G  EI+  L+ K  D+N       + +H+AC      +   L+EKG ++ +   D    +H+AC  GN ++ +LL+DKG DI   + +    +HFA+RY H  +V+ L++   D++A   +    + +ACK  D        +E+   L+++   INV+N+++ + L  A   G+ E++  + +K  + N+ N  +  +   A++  +++  + ++ +  DIN+ + D    +H+A    H+EIVKLLL+   +++  +K+ N +L         E +  +  +   IN  NN  W  L+   +  H+K+  + +
Sbjct:  607 LHYACRDGNLE-VVKYLVEKGADIQAKNKDGETPFHWAHDNDHLEVVKYLLEKGANIQAKSRESESLLYWACREGDLEVIKYLVEKGVDIQATNEDGETLLHCAYSNNHLELVKYLVEKGADINITDGDGATLLHCICKNDNIELVKYLVEKGADINITDGDGWTPLHYACENGELEIVKYLVEKGADINVIDGYGVTSLHYACREGNLEVVKYLVEKGADINATDEDGETLLHYACNKGNLEVVKLLVDKGADINIKSNDQCTALHFATRYDHLEIVKYLLDKGADIQAKNKEVETLLIYACKKGD--------LEVVKNLVDKGSDINVKNKNQWTALHFATRYGHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKLLLEKGADINAKNKYGNTTLHKACENGHLEVVKYLLDKGADINVKNNDQWTALHFATRYNHLKIVKLLL 1085          

HSP 5 Score: 205.682 bits (522), Expect = 1.907e-49
Identity = 102/327 (31.19%), Postives = 178/327 (54.43%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLE 1199
             +H+ +R+  LEI+K LLDK  DI+A++      +H AC   H ++ +LL+ K  +I   + D    +H A+RY  L IV  L+ K  +I  K+ + W  +H+A R N  EI   L+ K  DI     + W  +HFA RY H +I+ +L+ K  D+N + +  W+ +HFA  Y++  I   LL+KG ++     ++   +HFA    + +I +LL+DKG DI + N+    P+H A   GH  +++ L+    D+ A   +   P+H AC+        + ++E+   L+++   I  +N++  +P+D+A +     ++NL+ EKL+
Sbjct: 1266 ALHFVTRYNHLEIVKYLLDKGADINAKNKYGNTTLHKACENDHLEIVKLLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWIALHFATRYNHLEIVKYLLDKGADINVKNNDQWIALHFATRYNHLKIVKLLLDKGADINVKNNDQWTALHFATRYDHLEIVKYLLDKGADINVKNKNQWTALHFATRYNHLKIVKLLLDKGADIHAKNKYGNTPLHKACENGHLEVIKYLVEKGADINAKNKNGNTPLHKACE--------NGHLEVVKYLLDKGADIQAKNKNGNTPIDIAKQKKYGALVNLLTEKLD 1584          

HSP 6 Score: 202.601 bits (514), Expect = 1.466e-48
Identity = 128/521 (24.57%), Postives = 253/521 (48.56%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLE---KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR------------------------------------LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI---LRINGNNNWQKLNLVCKAMHIKLNPIFI 1565
             H+A R GN++   KY  E+ ++   K + G  P+ YA   G LE++K L++K  DI+A   D    +H  C+  + ++ + L++K  +I   DG  + P+H+A R G L +V  L+ K  +I+AK+K+   P H+A  N+  E+   L++K  +I+A ++E+   +++ACR G  E++  L+ K +D+ A      + +H A +  +  +   L+EKG ++     D    +H  C N N ++ + L++KG DI   + + W P+H+A   G   +V+ L+    D+       +  +H+AC+  +        +E+   L+E+   IN  +E  ++ L  A   GN EV+ L+ +K  + N+ +  +                                    L+ A ++G+++  + ++ +  DIN+ +K+    +H+A   GH+EIVK LL    ++++ +    +     +     E+ K  L+    + +  N+ W  L+   +  H+++  + +
Sbjct:  508 LHKACRIGNLEAV-KYLIEKGVDIHAKNKHGNTPLCYACDKGHLEVVKYLVEKGADINATDEDGETLLHCVCKNDNIELVKYLVEKGVDINVIDGYGVTPLHYACRDGNLEVVKYLVEKGADIQAKNKDGETPFHWAHDNDHLEVVKYLLEKGANIQAKSRESESLLYWACREGDLEVIKYLVEKGVDIQATNEDGETLLHCAYSNNHLELVKYLVEKGADINITDGDGATLLHCICKNDNIELVKYLVEKGADINITDGDGWTPLHYACENGELEIVKYLVEKGADINVIDGYGVTSLHYACREGN--------LEVVKYLVEKGADINATDEDGETLLHYACNKGNLEVVKLLVDKGADINIKSNDQCTALHFATRYDHLEIVKYLLDKGADIQAKNKEVETLLIYACKKGDLEVVKNLVDKGSDINVKNKNQWTALHFATRYGHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKLLL 1019          

HSP 7 Score: 185.267 bits (469), Expect = 3.203e-43
Identity = 132/503 (26.24%), Postives = 243/503 (48.31%), Query Frame = 3
Query:   99 QDVQQDDLELFHQAIRTGNVDDFNKYFKEEFLEKEQFG-----------RRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI-----LRINGNNNWQKLNLVCKAMHIKL 1550
            +D Q D + L  QA         +   ++++++ +Q G           + P+H A R G LE +K L++K  DI A++      + YAC + H +V + L++K  +I   D D    +H   +   + +V  L+ K  +I   D     P+HYACR+   E+   LV+K  DI+A  K+   P H+A    H E++  L+ K  ++ A++ ++ S +++AC      +   L+EKGV++++   D    +H A  N + ++ + L++KG DI   + +    +H   +  +  LV+ L+    D+     D   P+H+AC++ +        +EI   L+E+   INV +    + L  A   GN EV+  + EK  + N T  +G  LL  A  +GN++  ++++ +  DINI   D    +H+A    H+EIVK LL    ++   +K   +L  ++   KK +L  +   +     + +   N W  L+   +  H+++
Sbjct:  465 EDNQSDGIALLGQA---------SAIVEDKYVQLQQAGVKLADRLVKERKYPLHKACRIGNLEAVKYLIEKGVDIHAKNKHGNTPLCYACDKGHLEVVKYLVEKGADINATDEDGETLLHCVCKNDNIELVKYLVEKGVDINVIDGYGVTPLHYACRDGNLEVVKYLVEKGADIQAKNKDGETPFHWAHDNDHLEVVKYLLEKGANIQAKSRESESLLYWACREGDLEVIKYLVEKGVDIQATNEDGETLLHCAYSNNHLELVKYLVEKGADINITDGDGATLLHCICKNDNIELVKYLVEKGADINITDGDGWTPLHYACENGE--------LEIVKYLVEKGADINVIDGYGVTSLHYACREGNLEVVKYLVEKGADINATDEDGETLLHYACNKGNLEVVKLLVDKGADINIKSNDQCTALHFATRYDHLEIVKYLLDKGADIQAKNKEVETL--LIYACKKGDLEVVKNLVDKGSDINVKNKNQWTALHFATRYGHLEI 948          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A4Q4V343 (Uncharacterized protein OS=Monosporascus sp. mg162 OX=1081914 GN=DL768_011775 PE=4 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.082e-62
Identity = 119/413 (28.81%), Postives = 215/413 (52.06%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGH---RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS 1439
            G  P H AS +G LE++KLL +K  D+   S+  W  +H A R    ++ +L  +K  ++     D   P++ AS  G + +V  L  K  ++     N W P+H A  N   E+  +L++K  D+   +   W  ++ A   GH E++ +L+ K  D++  ++  W+P H A N  +  I   LLEKG +V    ++   P+H A  NG+ +I +++++KG D+       W P++ AS  G+  + ++L+    D+   + +   P+H A ++         YVE+  LL+E+   ++V N +  +PL LA  NG+ EV+ L+ EK  + ++ N      L SAS  G+ +  ++++ +  D+++   D + P++ A   GH E+VKLLL+N  + ++ D  +R+  S  S
Sbjct:  646 GWTPFHLASSNGHLEVVKLLFEKGADVSVTSTSKWTPLHLASRNGDVEMVKLFFEKGADVSVATVDKWTPLNLASINGHIELVKLLFEKGADVSVASANKWTPLHLASNNGHVEVVKLLLEKGADVSLVSAGGWTALNSASDSGHFEVVKLLLEKGADISVASADGWTPFHLASNNGHVEIVKLLLEKGADVSVAGANGWTPLHLASNNGHVEIVKVVLEKGADVSVAGANGWTPLYLASSNGYVEIFKLLLEKGADVSVASANGWTPLHLASRN--------GYVEMVKLLLEKGADVSVNNANGWTPLYLASTNGHVEVVKLLLEKGADVSVGNADGWTALNSASDSGHFEVVKLLLEKGADVSVASADGLTPLNSASDSGHFEVVKLLLENGVDPNLKDDISRTSLSFAS 1050          

HSP 2 Score: 208.379 bits (529), Expect = 1.412e-50
Identity = 96/322 (29.81%), Postives = 172/322 (53.42%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLI 1184
            P+H AS +G +E++KLLL+K  D+   S+  W A++ A    H +V +LL++K  +I     D   P H AS  G + IV  L+ K  ++     N W P+H A  N   EI  ++++K  D+       W P++ A   G+ EI  +L+ K  D++  ++  W+P+H A    Y  +   LLEKG +V    ++   P++ A  NG+ ++ +LL++KG D+   N + W  ++ AS  GHF +V++L+    D+   + D + P+      N AS +G  + E+  LL+E     N++++  ++ L  A +NG+  ++ ++
Sbjct:  748 PLHLASNNGHVEVVKLLLEKGADVSLVSAGGWTALNSASDSGHFEVVKLLLEKGADISVASADGWTPFHLASNNGHVEIVKLLLEKGADVSVAGANGWTPLHLASNNGHVEIVKVVLEKGADVSVAGANGWTPLYLASSNGYVEIFKLLLEKGADVSVASANGWTPLHLASRNGYVEMVKLLLEKGADVSVNNANGWTPLYLASTNGHVEVVKLLLEKGADVSVGNADGWTALNSASDSGHFEVVKLLLEKGADVSVASADGLTPL------NSASDSG--HFEVVKLLLENGVDPNLKDDISRTSLSFASKNGDSRIVMML 1061          

HSP 3 Score: 197.593 bits (501), Expect = 2.750e-47
Identity = 101/403 (25.06%), Postives = 195/403 (48.39%), Query Frame = 3
Query:  375 KKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI---LRINGNNNWQKLNLVCKAMHIKLNPIFI 1565
            K  ++   D D   P+  AS  G   +V  L+ K  ++     + W P H A  N   E+  +L +K  D+   +   W P+H A R G  E++ +   K  D++  T   W+P++ A    +  +   L EKG +V   +++K  P+H A  NG+ ++ +LL++KG D+   +   W  ++ AS  GHF +V++L+    D+   + D   P H A  +         +VEI  LL+E+   ++V   +  +PL LA  NG+ E++ ++ EK  + ++   +    L  AS  G ++  ++++ +  D+++   +   P+H A   G++E+VKLLL+   ++ + +    +   + S     E+ K+ LE    + +   + W  LN    + H ++  + +
Sbjct:  602 KGADVTVADADGWTPLDLASDSGHFEVVKLLLEKGADVSVASADGWTPFHLASSNGHLEVVKLLFEKGADVSVTSTSKWTPLHLASRNGDVEMVKLFFEKGADVSVATVDKWTPLNLASINGHIELVKLLFEKGADVSVASANKWTPLHLASNNGHVEVVKLLLEKGADVSLVSAGGWTALNSASDSGHFEVVKLLLEKGADISVASADGWTPFHLASNN--------GHVEIVKLLLEKGADVSVAGANGWTPLHLASNNGHVEIVKVVLEKGADVSVAGANGWTPLYLASSNGYVEIFKLLLEKGADVSVASANGWTPLHLASRNGYVEMVKLLLEKGADVSVNNANGWTPLYLASTNGHVEVVKLLLEKGADVSVGNADGWTALNSASDSGHFEVVKLLL 996          

HSP 4 Score: 175.637 bits (444), Expect = 1.884e-40
Identity = 81/278 (29.14%), Postives = 145/278 (52.16%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDA 1043
            G   ++ AS  G  E++KLLL+K  DI   S+D W   H A    H ++ +LL++K  ++     +   P+H AS  G + IV  ++ K  ++     N W P++ A  N   EI  +L++K  D+   +   W P+H A R G+ E++ +L+ K  D++   +  W+P++ A    +  +   LLEKG +V  G +D    ++ A  +G+F++ +LL++KG D+   + +   P++ AS  GHF +V++L+    D           + FA K+ D+
Sbjct:  778 GWTALNSASDSGHFEVVKLLLEKGADISVASADGWTPFHLASNNGHVEIVKLLLEKGADVSVAGANGWTPLHLASNNGHVEIVKVVLEKGADVSVAGANGWTPLYLASSNGYVEIFKLLLEKGADVSVASANGWTPLHLASRNGYVEMVKLLLEKGADVSVNNANGWTPLYLASTNGHVEVVKLLLEKGADVSVGNADGWTALNSASDSGHFEVVKLLLEKGADVSVASADGLTPLNSASDSGHFEVVKLLLENGVDPNLKDDISRTSLSFASKNGDS 1055          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: Q16FR1 (AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014668 PE=4 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.568e-62
Identity = 130/507 (25.64%), Postives = 251/507 (49.51%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYF--KEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIE--------------------RNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE---ILRINGNNNWQKLNLVCKAMHIKLNPIFI 1565
             H+A   G++D        K      +  G  P+HYASR+G LE++KLL+D   ++D    + W  +HYA R    DV +LLI  + N++    +   P+H+AS+ G L +V  LI    N++      W P+HYA +N Q ++  +L+    +++    E   P+H+A R G+ E++ +L+    +++    + W+P+H+A      ++   L++   NV++  ++   P+H+A  NGN ++ +LLID   ++++   E W P+H+AS+ G   +V++LI+ + +++    +   P+H+A ++ +        +E+  LLI+                    RN  ++       +PL  A  NGN E++ L+ E   N +         L  +SQ G++K  +++I  K +++    +   P+H+A   GH+E+VK L+ N   +D ++    +   +VS   +  L K+ ++    +    N  W  L+   +  H+++    I
Sbjct:  102 LHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGN--------LELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLI 600          

HSP 2 Score: 235.343 bits (599), Expect = 2.987e-60
Identity = 110/403 (27.30%), Postives = 213/403 (52.85%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLI---KEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            K+  G  P+HYASR+G LE++KLL+D   ++D   ++ W  +HYA +  H DV +LLI  + N++    +   P+H A+  G L++V  LI    N++      W P+HYA RN   E+  +L+    +++    E W P+H+A R G  +++ +L+    +++   ++  +P+H+A       +   L++   NV++   +   P+H+A  NG   + +LLID   ++++   E   P+H+ASR G+  LV++LI+ + +++    +   P+H+A +        +  +++  LLI+    ++       +PL  A  NGN E++ L+   +  ++         L  ASQ G +   +++I  + +++    +   P+H+A   G++E+VKLL+ N   +D
Sbjct:   28 KDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASR--------NGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVD 422          

HSP 3 Score: 229.95 bits (585), Expect = 1.813e-58
Identity = 122/483 (25.26%), Postives = 240/483 (49.69%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKH----------------NDASKAGDNYVEIAA---------LLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE---ILRINGNNNWQKLNLVCKAMHIKLNPIFI 1565
            G  P+HYASR+G LE++KLL+D   ++D    + W  +HYA R    DV +LLI  + N++    +   P+H+ASR G L +V  LI    N++      W P+HYA +N Q ++  +L+    +++    E   P+H+A R G+ E++ +L+    +++    + W+P+H+A              +  NV++  ++   P+H+A  NGN ++ +LLI+   ++++   E W P+H++S+ GH  +V++LI  K +++    +   P+H+A ++                +  +  G     I +         LLI+    ++  +    +PL  A +NG+ EV+  + +   N +  N     S   AS+ G ++  +++I    +++  + +   P+H+A   GH+E+VKLL+ N   +D  +    +   +VS   + E+ K+ ++    +    N  W  L+   +  H+++  + I
Sbjct:  263 GCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYAS-------------RNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLI 732          

HSP 4 Score: 219.164 bits (557), Expect = 7.003e-55
Identity = 101/396 (25.51%), Postives = 213/396 (53.79%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR---LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G +E++KLL+D + +ID +  +    +HYA R  + ++ +LLI  + N++    +   P+H+AS+ G +++V  LI    N++        P+H A  N   ++  +L+    +++    E W P+H+A R G+ E++ +L+    +++    + W+P+H+A      ++   L++   NV++  ++   P+H+A  NGN ++ +LLID   ++++   E W P+H+AS+ G   +V++LI+ + +++    +   P+H+A ++ +        +E+  LLI+    ++       +PL  A  NG  +V+ L+ +   N + T       L  AS+ GN++  +++I  + +++    +   P+H+A   G +++VKLL+ N   +D
Sbjct:    2 PLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGN--------LELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVD 389          

HSP 5 Score: 216.083 bits (549), Expect = 5.697e-54
Identity = 117/459 (25.49%), Postives = 219/459 (47.71%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDL-------------------------------NAQTSQN--WSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE 1478
            G  P+HYASR+G LE++KLL+D   ++D    + W  +HYA R ++ D  +         E C      P+H+ASR G L +V  LI    N++      W P+HY+ +N   ++  +L++   +++    E W P+H+A + GH E++  L+    ++                               N  T+ N  W+P+H+A    +  +   L++ G N ++  +      H A  NG  ++ +LLID G ++++ N E W P+H+ASR GH  +V++LI+   +++          H   +        +  +E+  LLI+    ++  +    +PL  A  NG+ EV+ L+ +   N +  N     S   AS+ G ++  +++I    +++  + +   P+H+A   GH+E+VKLL+ N   +D  +    +   +VS   + E+ K+ ++
Sbjct:  395 GCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQ--------NEGC-----TPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQ--------NGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLID 832          

HSP 6 Score: 204.912 bits (520), Expect = 2.816e-50
Identity = 112/450 (24.89%), Postives = 205/450 (45.56%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHA---------------------------------SRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKL 1370
             H A R  NVD             +  G  P+HYASR+G LE++KLL++   ++D   ++ W  +HY+ +  H  V +LLI+ K N++    +   P+H+A                                 S+ G L +V  LI    N++  D   W P+HYA +N   E+   L+    + +          H A + G  E++ +L+    +++   ++ W+P+H+A    +  +   L++ G NV++  +      H    NG  ++ +LLID   ++++ + E W P+H+ASR GH  +V++LI+   +++          H A K        +  +E+  LLI+    ++  N    +PL  A  NG+ EV+ L+ +   N +  N     S    SQ G ++  +++I    +++    +    +H A + GH+E+VKL
Sbjct:  432 LHYASRNANVD-----------TTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASK--------NGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKL 862          

HSP 7 Score: 162.925 bits (411), Expect = 7.676e-37
Identity = 73/260 (28.08%), Postives = 133/260 (51.15%), Query Frame = 3
Query:  189 FLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLIN 968
            F  K   G    H AS++G+LE++KLL+D   ++D  +++ W  +HYA R  H +V +LLI    N++  +       H  S+ G L +V  LI    N++  D   W P+HYA RN   E+  +L+    +++          H A + G  E++ +L+    +++   ++ W+P+H+A    +  +   L++ G NV++  +      H    NG  ++ +LLID G ++++   E W  +H AS  GH  +V++ I+
Sbjct:  606 FDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKLSID 865          

HSP 8 Score: 160.229 bits (404), Expect = 4.814e-36
Identity = 77/294 (26.19%), Postives = 154/294 (52.38%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIE 1091
            G  P+HYAS++G LE++K L+D   + D +++    + H A +    +V +LLI    N++  + +   P+H+ASR G L +V  LI    N++ K+       H   +N + E+  +L+    +++    E W P+H+A R GH E++ +L+    +++ + ++  +  H A       +   L++ G NV++  ++   P+H+A  NG+ ++ +LLID G ++++ N       H  S+ G   +V++LI+   +++    ++   +H      DAS  G  ++E+  L I+
Sbjct:  580 GWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLH------DASLNG--HLEVVKLSID 865          

HSP 9 Score: 114.39 bits (285), Expect = 1.140e-21
Identity = 56/232 (24.14%), Postives = 120/232 (51.72%), Query Frame = 3
Query:  711 SPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLI---KEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +P+H A       +   L++   N+++   +   P+H+A  NGN ++ +LLID   ++++   E W P+H+AS+ GH  +V++LI+ + +++    +   P+H A +        + ++++  LLI+    ++       +PL  A  NGN E++ L+   +  ++         L  AS+ G +   +++I  + +++    +   P+H+A   G++E+VKLL+ N   +D
Sbjct:    1 TPLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAE--------NGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVD 224          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 192.971 bits (489), Expect = 4.961e-49
Identity = 119/427 (27.87%), Postives = 205/427 (48.01%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM---AKP--------------------------LDLNAQ----TSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVIN-LIKEKLENPNMTN-GHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCE 1391
            P+H A+  G   + K+LLDK    + R+ + +  +H AC+++H  V +LL+K   ++E      L P+H AS  G LNIV  L+ K  +  A +     P+H A R   CE+A  L++    ++A  K++   +H A R GH E++ +L+   A P                          LD+NAQ    T + ++P+H A  Y   ++A  LLE+G N  +   + + P+H A  + N  +  LL+ KG    S     + P+H AS+     +   L+       A +L  + P+H A +   A        ++ +LLI +   +N+ N+S  +PL L  + G+  + + L+K+       T  G+  L  A   GNIK  + +++++ ++N   +    P+H A  +GH +IV LLLK+  +
Sbjct:  313 PLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRA--------DMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQ 731          

HSP 2 Score: 172.17 bits (435), Expect = 1.182e-42
Identity = 99/395 (25.06%), Postives = 189/395 (47.85%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLI------KEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +    +H A R  +  +  LL+ +   I+    D L P+H A+R G + I+  L+ +   I+AK KN   PIH A + +  +    L++ N +I+  T ++  P+H A   GH  +  +L+ K    N +    ++P+H AC   +  +   LL+   ++E+ T   + P+H A   G+  I ++L+ KG    + N +   P+H ASR GH  + E L+     ++A   D    +H A +          + E+  LL+E     N    +  +PL +A   G+ + + ++      + K+     T  H    A++ G +  AE+++ R  + N   K+ + P+H A    ++++V LL+
Sbjct:  178 GFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARM--------GHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLH---VAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLV 561          

HSP 3 Score: 157.532 bits (397), Expect = 3.349e-38
Identity = 135/601 (22.46%), Postives = 258/601 (42.93%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRES-----HSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGH------RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI---LRINGNNNWQKLNLVCKAMHIKLNPIFISSKKENKCRFYLNNFYFPNEGVGKTQSEANCNAVEKFLNTFVNISKISSTTDYILNNHDVRFEVV----SKAETQKITNQNGNLPL---KDKKIVNLADMILSKFTRDLWKVLNECCAITKINFIPKFIRC 1937
            + Q G  P++ A++   LE++K LL+   +    +     A+  A   S      ++ + + +K  C+     G    P+H A+ Y  LN+   L+ +  N+    KN   P+H A R     +  +L+ +   I+A TK+   P+H A R GH  I+ IL+ +   + A+T    SPIH A   ++ +    LL+    ++  T D + P+H A   G+ ++A++L+DKG    +     + P+H A +  H  ++++L+     +EA T   + P+H A      S  G  ++ I  +L+++    N  N   ++PL +A   G+ EV   +   L+N    +         L  A++ G+ +  ++++  K + N        P+H A  +GH + V++LL  N +   + K   +   V +   K ++ ++ LE        G N    L++     H  L+ + +   K         N Y P   +   Q++    +         N   +   T   L   + R ++V    SK     + N++G  PL     +  V +AD+++ +             A T++ + P  + C
Sbjct:  105 QSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATG--FTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVA------SFMG--HLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFL---LQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVH--HNNLDVVNLLVSKGGSPHSAARNGYTPLH-IASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGA--------SVYAATRMGYTPLHVAC 681          

HSP 4 Score: 152.91 bits (385), Expect = 1.022e-36
Identity = 86/355 (24.23%), Postives = 161/355 (45.35%), Query Frame = 3
Query:  129 FHQAIRTGN--VDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIK 1187
             H A R G+  V +F          K +  +  +H A+R G  E++KLLL+   + ++ ++     +H A RE H+    +L+       +       P+H A++YG +++   L+ +  N  A  KN   P+H A  +N  ++  +LV K     +  +  + P+H A +    E+ + L+      NA++ Q  +P+H A      ++ S L+ K  NV  G    + P+H     G+  IA +L+ +G  + +     + P+H A  YG+  +V+ L+  + ++   T     P+H A +          + +I  LL++   Q N    +  S L +A   G   VI+++K
Sbjct:  413 LHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQ--------QGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVLK 759          

HSP 5 Score: 140.198 bits (352), Expect = 6.969e-33
Identity = 107/464 (23.06%), Postives = 204/464 (43.97%), Query Frame = 3
Query:  108 QQDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNN-------QCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q D    F +A R+GN+D    + K   +     Q G   +H AS+ G ++++  LL     ++  +     A+H A       V   L+    N+         P++ A++   L +V  L+    N       + +P   +  N+           + I +K  C     T   + P+H A  Y +  +  +L+ +  ++N       +P+H A       +   LL++G  +++ T D++ P+H A  NG+ +I ++L+D+G  I++  +    PIH A++  H   V  L+    +++  TLD + P+H A  C H+  +K                          N++ +  LL++ +  +    ES  +PL +A   G+  ++ ++ +K  +PN +N      L  AS+ G+ + AE +++    ++   KDD   +H A   GH E+VKLLL++  
Sbjct:    7 QADAATSFLRAARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN--QSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSF--ITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKA 466          

HSP 6 Score: 131.724 bits (330), Expect = 2.650e-30
Identity = 98/419 (23.39%), Postives = 186/419 (44.39%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNA---QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE 1478
            A+R G L+     +    DI+  + +    +H A +E H  +   L+     +E         +H A+  G   +VT L+    N+ A+ +  + P++ A + N  E+   L++   +    T+     V  A  Y     L+   +     N     T+  ++P+H A +YE  N+A  LL +G NV     + + P+H A   GN  + +LL+D+G  I++  ++   P+H A+R GH  ++E+L++    ++A T + + PIH A +       GD +++    L++ N +I+       +PL +A   G+                   HR+           A+V++ +    N    +   P+H AC K H+ ++ LLLK++  L+ + +   +   V S +    + KI L+
Sbjct:   17 AARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQ-------GD-HMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGH-------------------HRM-----------AKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQ 397          

HSP 7 Score: 87.0409 bits (214), Expect = 1.220e-16
Identity = 75/382 (19.63%), Postives = 156/382 (40.84%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFA-----CLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE---ILRINGNNNWQKLNLVCKAMHIKL 1550
            A+R G L+     I    +I   ++N    +H A +    ++   L+     +E  TK+    +H A   G  +++  L+    ++NAQ+ + ++P++ A    +  +   LLE G N    T  K   +  A      L  +   + + +   C   +     + P+H A+ Y +  + ++L+N   ++     + + P+H A +  +        V +  LL++R   I+ + + + +PL  A  NG+  +I                              E+++ +   I    K+ + PIH A    H++ V+ LL+ N E+D I   + +   V +      + K+ L+          N +  L++ CK  H+++
Sbjct:   17 AARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITAT--GFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGN--------VIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRII------------------------------EILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRV 358          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 189.889 bits (481), Expect = 3.730e-48
Identity = 109/403 (27.05%), Postives = 205/403 (50.87%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQ--SPLDLALENGNEEVINLIKEKLENPNMTNGHRL-LSA-------SQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G   + K+LLDK    +AR+ + +  +H AC+++H    +LL+K   ++E      L P+H A+  G LNIV SL+ +  +  A +     P+H A R   CE+A  L++    ++A  K++  P+H A R GH E++ +L+    + ++ T+   +P+H A    + +    LL+        T     P+H AC  G   +A+LL+++G +  +  +    P+H A  + +  +V++L++      +   +   P+H A K N         +E+A+ L++  C  N  +ES Q  +PL LA + G  +++ L+  K  N N+ N  R  L+A       +QEG++  A++++++   +    +     +H AC  G+I++VK LL+    ++
Sbjct:  316 PLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQ--------LEVASSLLQ--CGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVN 708          

HSP 2 Score: 179.874 bits (455), Expect = 5.359e-45
Identity = 111/446 (24.89%), Postives = 214/446 (47.98%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVS-GLKKEELNKIALEILRINGNNNWQKLNLVCKAMHI 1544
            P+H A+R+G + ++++LLD+   I A++ +    IH A +  H D    L++    I++   D L P+H A+  G   +   L+ K     A+  N + P+H AC+ N      +L+K +  +EA T+    P+H A   GH  I+  L+ +    NA   +  +P+H A    +  +A  LL+    V++   D   P+H A   G+ ++ +LL++   + +S       P+H A+R GH     +L++        T     P+H ACK+          V++A LL+ER    N   ++  +PL +A+ + N +V+ L+  K  +P+ T  NG+  L  A+++  ++ A  +++   + N      + P+H A  +G  ++V LL+     +++ +K    L ++    L  +E +    ++L   G + +    +   A+H+
Sbjct:  250 PLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGK--------VDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHV 687          

HSP 3 Score: 168.703 bits (426), Expect = 1.405e-41
Identity = 100/392 (25.51%), Postives = 188/392 (47.96%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    +  VA+LL+ +  N+     + + P+H A+R G + +V  L+ +   I+A+ K++  P+H A RN    +  IL+ +   I+A TK    P+H A +  H + +  L+    +++  T  + +P+H A +  +  +A  LL+KG    +   +   P+H AC   + +   LL+     +E+  E    P+H A+  GH  +V+ L+       A  +    P+H       A++AG  + E+A  L++   Q++ + +  Q+PL  A   G++E++ L+ E   NP+   T GH  L  A++EG+     +++          K    P+H AC  G +++ +LLL+   
Sbjct:  152 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHM------AARAG--HCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGA 535          

HSP 4 Score: 166.392 bits (420), Expect = 6.793e-41
Identity = 97/395 (24.56%), Postives = 187/395 (47.34%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLI------KEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  L + +LLL++  +++    +    +H A R  +  +  LL+ +   I+    D L P+H A+R G + ++  L+ +   I+AK KN   PIH A + +  +    L++ N +I+  T ++  P+H A   GH  +  +L+ K    NA+    ++P+H AC   +      LL+   ++E+ T   + P+H A   G+  I + L+ +G    + N +   P+H A+R GH  + + L+     ++A   D   P+H A +          + E+  LL+E     +    +  +PL +A   G+     ++      + K+     T  H    A + G +  AE+++ R  + N   K+ + P+H A    ++++VKLL+
Sbjct:  181 GFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARM--------GHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLH---VACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 564          

HSP 5 Score: 160.229 bits (404), Expect = 5.268e-39
Identity = 109/454 (24.01%), Postives = 211/454 (46.48%), Query Frame = 3
Query:  120 LELFHQAIRTGNVDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            LEL H  I      D     K+        G   +H A+  GQ +++  L+    +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       +P+H A       +   LL++G  +++ T D++ P+H A  NG+ ++ ++L+D+G  I++  +    PIH A++  H   V  L+    +++  TLD + P+H A  C H+  +K                          N++    LL++ +  +    ES  +PL +A   G+  ++  + ++  +PN +N      L  A++ G+ + A+ +++    ++   KDD  P+H A   GH E+VKLLL++    D
Sbjct:   37 LELLHHGI------DLETTTKK--------GNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPD 472          

HSP 6 Score: 143.665 bits (361), Expect = 7.033e-34
Identity = 90/374 (24.06%), Postives = 169/374 (45.19%), Query Frame = 3
Query:  129 FHQAIRTGN--VDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDK-----MRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRL 1229
             H A R G+  V  F      +   K +  + P+H A+R G  E++KLLL+   + D+ ++     +H A RE H+    +L+       +       P+H A +YG +++   L+ +  N  A  KN   P+H A  +N  ++  +LV K     +  +  + P+H A +    E+ + L+    + N+++ Q  +P+H A      ++ + L+ K  NV  G   +     + P+H     G+  IA +L+ +G  + S +   +  +H A  YG+  +V+ L+  +  +   T     P+H A +          + +I  LL++     N    +  SPL +A   G   VI+++K   E  +M+  HR+
Sbjct:  416 LHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQ--------QGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEE-SMSAKHRM 780          

HSP 7 Score: 115.161 bits (287), Expect = 3.281e-25
Identity = 81/377 (21.49%), Postives = 171/377 (45.36%), Query Frame = 3
Query:  369 IKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGV-----------------------------NVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEE-VINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            IK    I   + + L  +H AS+ G + +V  L+    ++E   K     +H A    Q ++   LV    ++ A +++ + P++ A +  H E++  L+    + +  T   ++P+  A    +EN+ + L+  G                              N +  +     P+H A    N  +AQLL+++G ++    +    P+H A+R G+  +V +L++    ++A T D++ P+H A +        + +V +  +L+++   I  + ++  SP+ +A +  + + V  L++   E  ++T  H   L  A+  G+ + A+V++ +    N    +   P+H AC K H+  + LLLK++  L+ +
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAAR--------NGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV 375          

HSP 8 Score: 113.62 bits (283), Expect = 1.038e-24
Identity = 82/348 (23.56%), Postives = 150/348 (43.10%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLEKEQF---GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAK------------------PLDLNAQ--------------------TSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEML-------INAKCDMEAP-TLDQM 1007
            +DD    H A R G+  +  K   E     +     G  P+H A+R G     ++LLD +      +   +  +H AC+    DVAELL+++  N      + L P+H A  +  L++V  L+ K  +  +  +N + P+H A + NQ E+A+ L++   +  + + +   P+H A + G  +++ +L++K                  PL L AQ                    +   ++ +H AC+Y    +   LL++  +V   T     P+H A   G+  I  LL+  G            P+  A R G+ +++++L       ++AK  M  P T+D++
Sbjct:  443 KDDQTPLHCAARMGH-KELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESMSAKHRMSFPETVDEI 789          

HSP 9 Score: 102.064 bits (253), Expect = 2.924e-21
Identity = 79/360 (21.94%), Postives = 158/360 (43.89%), Query Frame = 3
Query:  486 IEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIK 1547
            I   ++N    +H A +    ++   L+    D+E  TK+    +H A   G  +++  L+    ++NAQ+ + +SP++ A    +  +   LLE G N    T D   P+  A   G+  +  LLI+ G       +     +H A+R        +L+    + +  +     P+H A  + + S        +A LL+ R   +N   ++  +PL +A   GN  ++ L+ ++    +      L     A++ G+++  E+++ +   I    K+ + PIH A    H++ V+ LL+ N E+D I   + +   V +      + K+ L+   + N    N +  L++ CK  H++
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLS--------VAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMR 360          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 186.037 bits (471), Expect = 7.935e-47
Identity = 108/406 (26.60%), Postives = 198/406 (48.77%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQS 1430
            +H A+  G  ++ K+++DK  + +A++ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G  NIVT L+    +    +      +H A R  Q E+   LV+    ++A +K++  P+H + R G  EI+  L+      ++ T+  ++P+H A    ++++AS LL++G ++   T     P+H A   G  ++A LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         +EIA  L+E     N       SPL LA + GN +++ L+  +    N+ N   L     A+QE  +  AEV++     ++   K    P+H AC  G++++V  LLKN  +++   K   + Q 
Sbjct:  318 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQ--------MEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQG 715          

HSP 2 Score: 178.718 bits (452), Expect = 1.331e-44
Identity = 104/439 (23.69%), Postives = 210/439 (47.84%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLE---KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            ++D+   H A + GN  +  K   E       K + G  P+H  +R G  +++++LLD+   I +++ +    +H A +  H +  +LL+  +  +++   D L  +H A+  G   +   ++ K  N  AK  N + P+H AC+ N+ ++  +L+K    I+A T+    P+H A   GH  I+  LM      N    +  + +H A       +   L++ G  V++ + D   P+H +   G  +I Q L+  G   +S     + P+H A+R GH  +  +L++    +   T     P+H A K+          +E+A LL+++    +   +S  +PL +A    N++V  L+ ++  +P+    NG+  L  A+++  ++ A  ++    D N   +  + P+H A  +G++++V LL+  +  +++ +K
Sbjct:  213 RNDITPLHVASKRGN-SNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGK--------IEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNK 642          

HSP 3 Score: 162.925 bits (411), Expect = 9.581e-40
Identity = 103/430 (23.95%), Postives = 202/430 (46.98%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC--KHND-------------------------ASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ +   ++ K +ND  P+H A +     +  +L+++   I+A TK+   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL   V V+  T+D +  +H A   G++++A++++DK  +  +     + P+H A +     ++E+L+     ++A T   + PIH A    H +                         A++AG    E+   L++    ++ +++  Q+PL ++   G  E+I  + +    P+   T+G+  L  A++EG+   A +++ +   + I  K    P+H A   G IE+  LLL+     D   K
Sbjct:  120 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQ--TEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGK 543          

HSP 4 Score: 158.688 bits (400), Expect = 1.800e-38
Identity = 96/428 (22.43%), Postives = 197/428 (46.03%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHF-----------------ACKHNDASK--------AGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+H A+ +G + +  LLL++   +D ++ ++   +H A +  +S++ +LL+++   I+    D L P+H  +R G   +V  L+ +   I +K KN   P+H A + +      +L+     ++  T +    +H A   GH ++  +++ K  + NA+    ++P+H AC      +   LL+ G ++++ T   + PIH A   G+  I   L++ G    + N      +H A+R G   +V+ L+     ++A + D   P+H                  AC  +  +         A + + ++A++L+++   + +  +   +PL +A + G  EV NL+ +K   P+ +    L     A+   N K A +++ +    +   K+   P+H A  K  +EI   LL+   + + I +
Sbjct:  182 GFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITR 609          

HSP 5 Score: 153.68 bits (387), Expect = 6.013e-37
Identity = 86/388 (22.16%), Postives = 181/388 (46.65%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            G  P+H A+  G   I+  L++     +  +     A+H A R   ++V + L++    ++    D   P+H +SR G   I+  L+      ++   + + P+H A R    ++A+IL+ +   +   TK+ + P+H A +YG  E+ N+L+ K    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A      +IA  L++ G D  +   +   P+H AS+ G+  +V +L+     +       + P+H A +        ++ V +A +L+     ++ + +   +PL +A   GN ++++ +   L+N    N    ++A+Q+G+     ++++     N    +    +  A   G+I +V  L
Sbjct:  380 GLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQ--------EDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFL---LKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          

HSP 6 Score: 151.754 bits (382), Expect = 2.648e-36
Identity = 101/460 (21.96%), Postives = 204/460 (44.35%), Query Frame = 3
Query:  204 QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLI--GKSCNIEAKD---------------------KNDWR------PIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRY---------------------------------GHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q G   +H AS+ G +E++  L+     +DA +     A+H A     SDV + L+    N+     +   P++ A++   L++V  L+  G S +I  +D                     +ND +       +H A R +  + A +L++ + + +  +K  + P+H A  YG+  +  +L+ +   ++ +   + +P+H A      N+   LLE+G  +++ T D + P+H    +G+ Q+ ++L+D+G  I S  +    P+H A++                                  GH+ + +++++ K +  A  L+   P+H ACK         N +++  LL++    I    ES  +P+ +A   G+E ++  +     +PN TN  G   L  A++ G  +  + +++    ++   KDD  P+H +   G  EI++ LL++  
Sbjct:   19 QNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACK--------KNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGA 470          

HSP 7 Score: 141.739 bits (356), Expect = 3.280e-33
Identity = 96/405 (23.70%), Postives = 184/405 (45.43%), Query Frame = 3
Query:  270 LDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNA-------------QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            L    DI+  + +   A+H A +E H +V   LIK    ++         +H AS  G  ++V  L+    N+ A+ +N + P++ A + N  ++   L+         T++ + P+  A + GH +++++L+                A+  D  A             ++   ++P+H A +Y   N+A+ LL +G  V+    + + P+H A   GN  + +LL+++G  I++  ++   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL+     ++       + L +A   G+ +V  +I +K  NPN    NG   L  A ++  IK  E++++    I    +  + PIH A   GH  IV  L+ +  
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGA 404          

HSP 8 Score: 136.346 bits (342), Expect = 1.303e-31
Identity = 78/314 (24.84%), Postives = 141/314 (44.90%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFL---EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEML------INAKCDMEAPTLDQMRPIHFACKHNDA 1043
             H A R G  +   KY  +       K +  + P+H +SR G+ EI++ LL      D+ ++  +  +H A RE H DVA +L+ +  ++         P+H A++YG + +   L+ K    +A  K+   P+H A   +  ++A +L+ +     A  K  + P+H A +    EI   L+    D NA T Q  SP+H A      ++ + L+ +   +       + P+H A       +A++L++ G  ++   +  + P+H A  YG+  +V  L      +NAK  + A        I+   +H  A
Sbjct:  417 LHMAARAGQTE-VVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAA 729          

HSP 9 Score: 106.301 bits (264), Expect = 2.141e-22
Identity = 77/369 (20.87%), Postives = 159/369 (43.09%), Query Frame = 3
Query:  498 DKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLI-------------------------------DKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKL--------------------------------ENP--NMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            ++N    +H A +    E+ T L+K    ++A TK+    +H A   G ++++  L+    ++NAQ+   ++P++ A    + ++   LL+ G +    T D   P+  A   G+ Q+  LL+                               D   D+ES  +  + P+H A+ YG+  +  +L+N    ++    + + P+H A K  +++        +  LL+ER  +I+ + +   +PL     +G+E+V+ ++ ++                                 E P  ++TN +   L  A+  G+ K A+V++ +K + N    +   P+H AC K  I++++LLLK+   +  +
Sbjct:   18 NQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVES--KSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSN--------MVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAV 376          

HSP 10 Score: 102.449 bits (254), Expect = 2.862e-21
Identity = 82/358 (22.91%), Postives = 158/358 (44.13%), Query Frame = 3
Query:  567 VKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI--NAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEK---LENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIAL----EILRINGNNNW-QKLNLVCKAMHIKLNPIFISSKKENKCRFYLNNF 1610
            +K   DI  C +     +H A + GH E++  L+     ++A T +  + +H A      ++   L+  G NV + + +   P++ A    +  + + L+D G       E+ + P+  A + GH  +V +L+  + K  +  P L      H A + +D         + AALL++ +   +V+++S  +PL +A   GN  V  L+  +   ++     +   L  AS+ GN    ++++ R   I+   KD + P+H     GH ++V++LL       I+ K    L  +    + + LN + L    E+   +  N++   L++     H K+  + +  KK N     LN F
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPAL------HIAARKDD--------TKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAP--ILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIV-DKKANPNAKALNGF 348          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 183.726 bits (465), Expect = 4.662e-46
Identity = 105/395 (26.58%), Postives = 195/395 (49.37%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G  ++ K+++DK  + +A++ + +  +H AC+++   V ELL+K   +++      L PIH A+  G  NIV  L     +    +      +H A R  Q ++   L++    ++   K++   +H A R G AEI+ +L+ K    +A T+  ++P+H A    ++  AS LLE G ++ + T     P+H A   G  + A+LL+ K    ++  +    P+H A+ Y +  +  +L++      A   +   P+H A K N         +EI   L+E   + N       SPL LA + G+ ++++L+  K  N NM N + L     A+QE  +  AEV++    +++   K    P+H AC  G++++V  LL+N  +++
Sbjct:  373 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQ--------LEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKIN 759          

HSP 2 Score: 160.999 bits (406), Expect = 3.768e-39
Identity = 103/428 (24.07%), Postives = 202/428 (47.20%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK-----AGDNYVEIAA---------LLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEK--LENPNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            G  P+  A + G  +++ LLL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ +   ++   +ND  P+H A +     +  +L+ +   I+A TK+   P+H   R GH +++ +L+ +   + ++T    SP+H A   ++ N    LL+  V V+  T+D +  +H A   G++++A++++DK  +  +     + P+H A +     ++E+L+     ++A T   + PIH A             H+ AS       G+  + +AA          L++   +++++ +  Q+ L +A   G  E++ L+ +K    +   T+G+  L  A +EG+ + A +++     ++   K    P+H A   G IE  KLLL+     D   K
Sbjct:  175 GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGK 598          

HSP 3 Score: 152.525 bits (384), Expect = 1.351e-36
Identity = 90/393 (22.90%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            G  P+H A+  G   I+K L       +  +     A+H A R   +DV   L++    ++    D    +H ASR G   IV  L+ K     A   + + P+H A R    E A++L++    + A TK+ + P+H A +YG  E   +L+ K    +       +P+H A +Y+ + +A  LL+ G +  +   +   P+H A      +I   L++ G +  +   +   P+H A++ G   LV +L+    ++     + + P+H A +        ++ V +A +L+    +++   ++  +PL +A   GN ++++ +   LEN                           +  IN   K    P+H A  +GH  I+ +LL++  
Sbjct:  435 GLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQ--------EDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFL---LEN---------------------------QAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRA 789          

HSP 4 Score: 150.599 bits (379), Expect = 5.240e-36
Identity = 112/502 (22.31%), Postives = 213/502 (42.43%), Query Frame = 3
Query:   84 KFEMSQDVQQDDLELFHQAIRTGNVDDFNKYFKEEFLEK--EQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLI--GKSCNIEAKD---------------------KNDWR------PIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRY---------------------------------GHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            K    Q  + D    + +A R GN++    Y K         Q G   +H AS+ G +E++  LL     +DA +     A+H A     +DV   L+    N+     +   P++ A++   L +V  L+  G S +I  +D                     +ND +       +H A R +  + A +L++ + + +  +K  + P+H A  YG+  +  +L+ +   ++     + +P+H A      N+   LL++G  +++ T D + P+H    +G+ Q+ ++L+D+G  I S  +    P+H A++                                  GH+ + +++++ K +  A  L+   P+H ACK         N V++  LL++    +    ES  +P+ +A   G+E ++  +     +PN TN  G   L  A++ G       +++    ++I  KDD   +H A   G  EIV+LLL+   
Sbjct:   32 KHSREQKKKSDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACK--------KNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGA 525          

HSP 5 Score: 148.673 bits (374), Expect = 2.138e-35
Identity = 108/481 (22.45%), Postives = 215/481 (44.70%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDL-------------NAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGH---------------------------------IEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE 1478
            A+R G LE     L    DI+  + +   A+H A +E H +V   L+K   +++         +H AS  G  ++V  L+    N+ A+ +N + P++ A + N  E+   L++        T++ + P+  A + GH +++++L+                A+  D              + ++   ++P+H A +Y   N+A+ LL +G  V+    + + P+H A   GN  + +LL+D+G  I++  ++   P+H  +R GH  +VEML++    + + T + + P+H A +       GD ++    LL++ +  ++       + L +A   G+ +V  +I +K  NPN    NG   L  A ++  +K  E++++    +    +  + PIH A   GH                                  ++V+ LL+N  ++DI  K +++   + S L K E+ ++ L+
Sbjct:   50 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQ 522          

HSP 6 Score: 148.288 bits (373), Expect = 2.554e-35
Identity = 90/365 (24.66%), Postives = 163/365 (44.66%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKEEFLE---KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT 1214
             H A R G  D   +Y  +   +   K +  +  +H ASR G+ EI++LLL K     A ++  +  +H A RE H + A LL++   ++         P+H A++YG +     L+ K    +   K    P+H A   +   +A +L+       A  K  + P+H A +    EI   L+    + NA T Q  SP+H A      ++ S LL K  NV  G  + + P+H A       +A++L++ G ++++  +  + P+H A  YG+  +V  L+  +  + + T     P+H A +          +  I  +L++     N    +  + L +A   G   V++ ++  L + N+T
Sbjct:  472 LHMAARAGQAD-VVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQ--------GHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLR-GLTDENLT 826          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037173.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21074007:21119253:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000037173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 8.213e-46
Identity = 109/429 (25.41%), Postives = 208/429 (48.48%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            F +A R GN+D   +Y K   +     Q G   +H A++ G +++++ LL++   +D+ +     A+H A     ++V ++L+K+  +I     +   P++ AS+   L++V  L+    N     ++ + P+  A +    ++ +IL++ +       K     +H A R    +   +L+    + + Q+   ++P+H A +Y   N+A+ LL +G  V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H A+R GH T VE+L+     + A T + + P+H A +       GD +VE    L++    ++       + L +A   G+  V  L+ +K  NPN    NG   L  A ++  +K  E++++    I    +  + PIH A   GH+ IV LLL+N    D+
Sbjct:   19 FLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQ-------GD-HVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDV 435          

HSP 2 Score: 140.584 bits (353), Expect = 8.251e-35
Identity = 92/408 (22.55%), Postives = 186/408 (45.59%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFLEK-------EQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRY---------------------------------GHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT 1214
            Q+ L   H A + G++D       +E LE+        + G   +H AS  GQ E++K+L+ +  DI+A+S + +  ++ A +E+H DV   L++   N      D   P+  A + G   +V+ L+      + K K     +H A R +  + A +L++ + + +  +K  + P+H A  YG+  +  +L+ +   ++       +P+H A      N+   LL++G  +++ T D + P+H A  +G+    +LL+++G  I +  +    P+H A++                                  GH+ + ++L++ + +  A  L+   P+H ACK         N V++  LL++    I    ES  +P+ +A   G+  ++ L+ +   +P++T
Sbjct:   46 QNGLNALHLAAKEGHMD-----LVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACK--------KNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT 436          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.601 bits (514), Expect = 1.322e-53
Identity = 111/393 (28.24%), Postives = 197/393 (50.13%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            P+H A+  G   + KLLLD+  + +AR+ + +  +H AC+++   V ELL+K   +I       L PIH AS  G LN+V  L+    +  A +     P+H A R  Q E+   L++    +    +E+  P+H A R G AEI+ +L+ +  D NA T+   +P++FA    + ++AS LLE G ++   T     P+H A   G  ++A LL++K    +   +    P+H A+ Y H  +  +L++      +   +   P+H A K         N +E+  +L+E   + N+  +   +PL LA + G+ +++ L+  +  + ++     L +   A+QE  +  AE++ + K D+N   K    P+H A   G+I++V  LL+N  
Sbjct:  347 PLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAK--------KNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA 731          

HSP 2 Score: 190.66 bits (483), Expect = 1.085e-49
Identity = 103/407 (25.31%), Postives = 201/407 (49.39%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            K + G  P+H A+R G  +++++LL++   I A++ +    +H A +  H    +LL+ ++  +++   D L P+H A+  G   +   L+ +     A+  N + P+H AC+ N+ ++  +L+K    I   T+    P+H A   GH  ++ +L+      NA   +  +P+H A       +  TLL+ G  V     +   P+H A   G  +I QLL+ +G D  +       P++FASR GH  +  +L+    D+   T     P+H A K+          +E+A LL+E+    + + ++  +PL +A    +++V  L+ +K  +P+ T  NG+  L  A+++  ++  +V++    + N+  +  + P+H A  +GH ++V LLL  +  + +  K
Sbjct:  274 KTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKY--------GRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK 672          

HSP 3 Score: 171.014 bits (432), Expect = 1.642e-43
Identity = 104/432 (24.07%), Postives = 196/432 (45.37%), Query Frame = 3
Query:  195 EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLEN--PNMTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI 1481
            +  + G  P+H A+ +G + +  LLL+    +D  + +    +H A +  ++++ +LL+ +   I+    D L P+H A+R G   ++  L+ +   I AK KN   P+H A +        +L+ +   ++  T +   P+H A   GH  +  +L+ +  + NA+    ++P+H AC      +   LL+ G ++ + T   + PIH A   G+  + QLL+  G    + N     P+H ASR G   +V+ L+ +   +     +   P+H A +   A        EI  LL++R    N    S  +PL  A   G+ +V +L+ E   +  P    G   L  AS+ G ++ A +++ +    +   K+ + P+H A    H ++  LLL          K   +   + +   + E+ K+ LE+
Sbjct:  207 QTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKA--------EIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLEL 630          

HSP 4 Score: 169.859 bits (429), Expect = 3.843e-43
Identity = 108/440 (24.55%), Postives = 197/440 (44.77%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLL--------RPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKG---------------------------------CDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN---MTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            G  P+  A + G  +++ LLL+     D +      A+H A R+  ++ A LL++ + N +     +L         P+H A+ YG +N+ T L+     ++   +N   P+H A +     +  +L+ +   I+  T++   P+H A R GH +++ +L+ +   + A+T    SP+H A   E+      LL +   V+  T D + P+H A   G++++A+LL+D+G                                   I +  E    PIH AS  GH  +V++L+       A  +    P+H       AS+AG   +E+   L++   ++ V+    Q+PL +A   G  E++ L+ ++  +PN    +    L  AS+EG+   A +++    DI+   K    P+H A   G +E+  LLL+     D
Sbjct:  142 GFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHM------ASRAGQ--LEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASAD 569          

HSP 5 Score: 155.221 bits (391), Expect = 1.810e-38
Identity = 109/442 (24.66%), Postives = 200/442 (45.25%), Query Frame = 3
Query:  108 QQDDLELFHQAIRTGNVDDFNKYFKEEFLEKE--QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWR--PVHFACRYGHAEILNILM--------AKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            + D    F +A R GN++    + K         Q G   +H AS+ G ++++  LL +  +ID  +     A+H A     +D+  +L++   NI     +   P++ A++   L IV  L+    N     ++ + P+  A +    ++  +L      +E+ TK   R   +H A R        +L+           + LN  T   ++P+H A +Y   N+A+ LL  G  V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H A+R GH  ++EML+     + A T + + P+H A +          ++    LL+ R   ++       +PL +A   G+  V  L+ ++   PN    NG   L  A ++  IK  E++++    I+   +  + PIH A   GH+ +V+LLL+N  
Sbjct:    7 KSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLL------LESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQ--------GEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGA 434          

HSP 6 Score: 154.836 bits (390), Expect = 1.941e-38
Identity = 80/303 (26.40%), Postives = 146/303 (48.18%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK 1031
             H A R G ++      +       K +  + P+H ASR G+ EI++LLL +  D +A ++     +++A RE H DVA LL++   +I         P+H AS+YG L + T L+ K  + + K KN   P+H A   +  ++A +L+ K     +  K  + P+H A +    E+  +L+    + N  T Q  +P+H A    + ++ + LL +  ++   T   +  +H A       +A++L     D+ +  +  + P+H AS YG+  +V  L+  +  + A T +   P+H A +
Sbjct:  447 LHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQ 749          

HSP 7 Score: 149.443 bits (376), Expect = 9.806e-37
Identity = 83/369 (22.49%), Postives = 168/369 (45.53%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKA-----------------------GDNY--VEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS 1235
            G  P+H AS  G L +++LLL      +A +      +H A R    +V + L++    +     +   P+H ASR G   IV  L+ +  +  A   +   P+++A R    ++A++L++   DI   TK+ + P+H A +YG  E+  +L+ K    + +     +P+H A +Y+++ +A  LL+KG +  S   +   P+H A      ++ ++L++ G +     ++   P+H A++ GH  +V +L+     +   T   +  +H A + +  + A                         +Y  +++   L+     +N +  +  +PL  A + G+  V+N + +   +PN    NG+  L+
Sbjct:  410 GLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALA 778          

HSP 8 Score: 116.316 bits (290), Expect = 2.233e-26
Identity = 84/362 (23.20%), Postives = 160/362 (44.20%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLID---KG----------------------------CDIES------CNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS----ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCE 1391
            A+R G L  +   +    +I   ++N    +H A +    ++ T L+K+  +I+  TK     +H A   G  +I+ +L+    ++NAQ+   ++P++ A    +  I   LL+ G N    T D   P+  A   G+ Q+  LL++   KG                             D+ S        E  + P+H A+ YG+  +  +L+N    ++    + + P+H A K     +  +N V+   LL++R  +I+ +     +PL  A  +G+E+VI ++ E+ + P +      LS    A+Q  ++   ++++ R+  ++    D + P+H A   GH  + KLLL    E
Sbjct:   17 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAK-----RGNNNMVK---LLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGE 369          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.83 bits (512), Expect = 1.386e-53
Identity = 112/395 (28.35%), Postives = 198/395 (50.13%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDK--GCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            P+H A+  G   + KLLLD+  + +AR+ + +  +H AC+++   V ELL+K   +I       L PIH AS  G LN+V  L+    +  A +     P+H A R  Q E+   L++    +    +E+  P+H A R G AEI+ +L+ +  D NA T+   +P++FA    + ++AS LLE G ++   T     P+H A   G  ++A LL++K    D +   +    P+H A+ Y H  +  +L++      +   +   P+H A K         N +E+  +L+E   + N+  +   +PL LA + G+ +++ L+  +  + ++     L +   A+QE  +  AE++ + K D+N   K    P+H A   G+I++V  LL+N  
Sbjct:  340 PLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAK--------KNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA 726          

HSP 2 Score: 187.963 bits (476), Expect = 4.942e-49
Identity = 104/409 (25.43%), Postives = 201/409 (49.14%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQIN--VQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            K + G  P+H A+R G  +++++LL++   I A++ +    +H A +  H    +LL+ ++  +++   D L P+H A+  G   +   L+ +     A+  N + P+H AC+ N+ ++  +L+K    I   T+    P+H A   GH  ++ +L+      NA   +  +P+H A       +  TLL+ G  V     +   P+H A   G  +I QLL+ +G D  +       P++FASR GH  +  +L+    D+   T     P+H A K+          +E+A LL+E+    +  V  ++  +PL +A    +++V  L+ +K  +P+ T  NG+  L  A+++  ++  +V++    + N+  +  + P+H A  +GH ++V LLL  +  + +  K
Sbjct:  267 KTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKY--------GRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK 667          

HSP 3 Score: 174.481 bits (441), Expect = 8.901e-45
Identity = 107/432 (24.77%), Postives = 195/432 (45.14%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKG---------------------------------CDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN---MTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            G  P+  A + G  +++ LLL+     D +      A+H A R+  ++ A LL++ + N +        P+H A+ YG +N+ T L+     ++   +N   P+H A +     +  +L+ +   I+  T++   P+H A R GH +++ +L+ +   + A+T    SP+H A   E+      LL +   V+  T D + P+H A   G++++A+LL+D+G                                   I +  E    PIH AS  GH  +V++L+       A  +    P+H       AS+AG   +E+   L++   ++ V+    Q+PL +A   G  E++ L+ ++  +PN    +    L  AS+EG+   A +++    DI+   K    P+H A   G +E+  LLL+     D
Sbjct:  143 GFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHM------ASRAGQ--LEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASAD 562          

HSP 4 Score: 170.244 bits (430), Expect = 2.097e-43
Identity = 104/429 (24.24%), Postives = 195/429 (45.45%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLEN--PNMTNGHRLLS-ASQEGNIKKAEVMIRR--KCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI 1481
            G  P+H A+ +G + +  LLL+    +D  + +    +H A +  ++++ +LL+ +   I+    D L P+H A+R G   ++  L+ +   I AK KN   P+H A +        +L+ +   ++  T +   P+H A   GH  +  +L+ +  + NA+    ++P+H AC      +   LL+ G ++ + T   + PIH A   G+  + QLL+  G    + N     P+H ASR G   +V+ L+ +   +     +   P+H A +   A        EI  LL++R    N    S  +PL  A   G+ +V +L+ E   +  P    G   L  AS+ G ++ A +++ +    D  +  ++ + P+H A    H ++  LLL          K   +   + +   + E+ K+ LE+
Sbjct:  205 GFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKA--------EIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLEL 625          

HSP 5 Score: 160.999 bits (406), Expect = 1.855e-40
Identity = 112/491 (22.81%), Postives = 219/491 (44.60%), Query Frame = 3
Query:   33 FLYAYRFI*NINL-IFYDKFEMSQDVQ---QDDLELFHQAIRTGNVDDFNKYFKEE--FLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPI------HHASRYGLL-----------------------NIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCE 1391
            FL A R   N NL    D  +   D+    Q+ L   H A + G+VD   +  K E       + G   +H A+  GQ +I+++L++   +I+A+S + +  ++ A +E+H ++ + L+    N      D   P+       H    GLL                       N    L+    N +   K+ + P+H A       +AT+L+     ++   +    P+H A + G+  ++ +L+ +   ++ +T    +P+H A    +E +   LLE+   + + T + + P+H A    +    QLL+ +   ++    +   P+H A+  GH+ + ++L++   +  A  L+   P+H ACK         N +++  LL++    I+   ES  +P+ +A   G+  V+ L+ +   + N TN  G   L  AS+ G ++  + +++    + +  ++D  P+H A   G  EIV+LLL+   +
Sbjct:   15 FLRAAR---NGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACK--------KNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSD 494          

HSP 6 Score: 157.532 bits (397), Expect = 2.303e-39
Identity = 107/434 (24.65%), Postives = 199/434 (45.85%), Query Frame = 3
Query:  108 QQDDLELFHQAIRTGNVDDFNKYFKEEFLEKE--QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWR--PVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q D    F +A R GN++    + K         Q G   +H AS+ G ++++  LL +  +ID  +     A+H A     +D+  +L++   NI     +   P++ A++   L IV  L+    N     ++ + P+  A +    ++  +L      +E+ TK   R   +H A R        +L+    + +  +   ++P+H A +Y   N+A+ LL  G  V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H A+R GH  ++EML+     + A T + + P+H A +          ++    LL+ R   ++       +PL +A   G+  V  L+ ++   PN    NG   L  A ++  IK  E++++    I+   +  + PIH A   GH+ +V+LLL+N  
Sbjct:    8 QSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLL------LESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQ--------GEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGA 427          

HSP 7 Score: 148.288 bits (373), Expect = 1.815e-36
Identity = 79/305 (25.90%), Postives = 146/305 (47.87%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAK--DKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK 1031
             H A R G ++      +       K +  + P+H ASR G+ EI++LLL +  D +A ++     +++A RE H DVA LL++   +I         P+H AS+YG L + T L+ K  + + K   +N   P+H A   +  ++A +L+ K     +  K  + P+H A +    E+  +L+    + N  T Q  +P+H A    + ++ + LL +  ++   T   +  +H A       +A++L     D+ +  +  + P+H AS YG+  +V  L+  +  + A T +   P+H A +
Sbjct:  440 LHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQ 744          

HSP 8 Score: 146.362 bits (368), Expect = 7.382e-36
Identity = 84/371 (22.64%), Postives = 167/371 (45.01%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAK--PLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKA-----------------------GDNY--VEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS 1235
            G  P+H AS  G L +++LLL      +A +      +H A R    +V + L++    +     +   P+H ASR G   IV  L+ +  +  A   +   P+++A R    ++A++L++   DI   TK+ + P+H A +YG  E+  +L+ K    D         +P+H A +Y+++ +A  LL+KG +  S   +   P+H A      ++ ++L++ G +     ++   P+H A++ GH  +V +L+     +   T   +  +H A + +  + A                         +Y  +++   L+     +N +  +  +PL  A + G+  V+N + +   +PN    NG+  L+
Sbjct:  403 GLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALA 773          

HSP 9 Score: 96.6709 bits (239), Expect = 2.014e-20
Identity = 49/202 (24.26%), Postives = 100/202 (49.50%), Query Frame = 3
Query:  165 FNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLE 770
              KY   +     Q G  P+H A+ +   ++  LLLDK     + + + +  +H A +++  +V ++L++            + P+H A++ G  ++V  L+G+  +I    K     +H A + ++  +A IL K   D+   TK  + P+H A  YG+ +++N L+     +NA+T   ++P+H A    + ++ + LL+
Sbjct:  555 LEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQ 756          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.718 bits (452), Expect = 2.229e-45
Identity = 104/395 (26.33%), Postives = 189/395 (47.85%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G     K+LLDK  + + R+ + +  +H AC+++   V ELL+K   +IE      L P+H ++  G LNIV  L+    +  A +      +H A R  Q E+   L++    ++A  +E   P+H A R G  EI+ +L+      +A TS  ++P+H A    +E++ + LLE G ++   T     P+H A   G  ++A LL+ +    ++  +    P+H AS Y +  +  +L++      A   +   P+H A K +         +EIA  L+E   + N       +PL L  + G+ +V +L+  +  + N      L     A+QE  +  AE++++    +N   K    P+  AC  G+I++V  LL++  +++
Sbjct:   76 LHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQ--------LEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVN 462          

HSP 2 Score: 170.244 bits (430), Expect = 7.511e-43
Identity = 97/409 (23.72%), Postives = 195/409 (47.68%), Query Frame = 3
Query:  204 QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS 1421
            Q G  P+H A+R G  +++++LL++   I A++ +    +H A +  H +  ++L++ +  +++   D L  +H A+  G       L+ K  N   +  N + P+H AC+ N+  +  +L+K    IEA T+    P+H +   G+  I+ IL+      NA   +  + +H A       +  +LL  G  V++   ++  P+H A   G  +I QLL+      ++     + P+H A+R GH  +  +L+     +   T     P+H A K+          +E+A+LL++R    +   ++  +PL +A    N++V  L+ ++  +P+ T  NG+  L  A+++  ++ A  ++    + N   +  + P+H    +GH ++  LLL    +++   K   S
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGK--------MEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLS 404          

HSP 3 Score: 164.466 bits (415), Expect = 5.562e-41
Identity = 92/390 (23.59%), Postives = 174/390 (44.62%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLK 1379
            G  P+H ++  G L I+ +LL      +A +     A+H A R   ++V   L++    ++    +   P+H A+R G L IV  L+    + +A   N + P+H A R    ++  IL++    +   TK+ + P+H A +YG  E+ ++L+ +    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A      +IA  L++ G +  +   +   P+H  ++ GH  +  +L+    D+   T   + P+H A +        ++ V +A +L++    +N   +   +P                              L+ A   GNIK    +++   D+N   K+   P+H A  +GH  IV LLLK
Sbjct:  138 GLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQ--------EDKVNVAEILVKHGAHVNATTKLGYTP------------------------------LIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK 489          

HSP 4 Score: 157.147 bits (396), Expect = 9.946e-39
Identity = 88/318 (27.67%), Postives = 152/318 (47.80%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFK--EEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLI---------GK------------------------SCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKC 977
             H A R G  +      +   +   K +  + P+H A+R G+LEI++LLL      DA +S+ +  +H A RE H DV  +L++   ++         P+H AS+YG + + + L+         GK                          +  A  KN + P+H A + +Q EIAT L++   +  A T++   P+H   + GHA++ ++L+A+  D+N  T    SP+H A   +  N+A  L++ G +V + T     P+  AC  GN ++   L+  G D+ S  +  + P+H A++ GH  +V +L+  KC
Sbjct:  175 LHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KC 490          

HSP 5 Score: 124.405 bits (311), Expect = 1.062e-28
Identity = 86/367 (23.43%), Postives = 163/367 (44.41%), Query Frame = 3
Query:  492 AKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKEN 1583
            A  ++   P+H A R+   ++  IL+++   I A TK    P+H A +  H E + +LM     ++  T    + +H A +  +   A  LL+KG N      +   P+H AC     ++ +LL+  G  IE+  E    P+H ++  G+  +V +L+       A  +     +H A      ++AG    E+   L+    Q++ +   +Q+PL +A   G  E++ L+ + + +P+   +NG+  L  A++EG+     +++     + +  K    P+H A   G +E+  LLL+     D   K   +   V S    +   K+AL +L    + +    N           P+ I++KK+ 
Sbjct:    1 AHRQDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMA------ARAGQT--EVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQ---KVALLLLDQGASPHATAKN--------GYTPLHIAAKKDQ 348          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 6.698e-44
Identity = 100/380 (26.32%), Postives = 182/380 (47.89%), Query Frame = 3
Query:  267 LLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            LLDK  + + R+ + +  +H AC+++   V ELL+K   +IE      L P+H ++  G LNIV  L+    +  A +      +H A R  Q E+   L++    ++A  +E   P+H A R G  EI+ +L+      +A TS  ++P+H A    +E++ + LLE G ++   T     P+H A   G  ++A LL+ +    ++  +    P+H AS Y +  +  +L++      A   +   P+H A K +         +EIA  L+E   + N       +PL L  + G+ +V +L+  +  + N      L     A+QE  +  AE++++    +N   K    P+  AC  G+I++V  LL++  +++
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQ--------LEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVN 372          

HSP 2 Score: 164.851 bits (416), Expect = 2.488e-41
Identity = 92/390 (23.59%), Postives = 174/390 (44.62%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLK 1379
            G  P+H ++  G L I+ +LL      +A +     A+H A R   ++V   L++    ++    +   P+H A+R G L IV  L+    + +A   N + P+H A R    ++  IL++    +   TK+ + P+H A +YG  E+ ++L+ +    +A      +P+H A +Y+ + +A  LL++G +  +   +   P+H A      +IA  L++ G +  +   +   P+H  ++ GH  +  +L+    D+   T   + P+H A +        ++ V +A +L++    +N   +   +P                              L+ A   GNIK    +++   D+N   K+   P+H A  +GH  IV LLLK
Sbjct:   48 GLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQ--------EDKVNVAEILVKHGAHVNATTKLGYTP------------------------------LIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK 399          

HSP 3 Score: 156.762 bits (395), Expect = 8.266e-39
Identity = 88/319 (27.59%), Postives = 152/319 (47.65%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFK--EEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLI---------GK------------------------SCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCD 980
             H A R G  +      +   +   K +  + P+H A+R G+LEI++LLL      DA +S+ +  +H A RE H DV  +L++   ++         P+H AS+YG + + + L+         GK                          +  A  KN + P+H A + +Q EIAT L++   +  A T++   P+H   + GHA++ ++L+A+  D+N  T    SP+H A   +  N+A  L++ G +V + T     P+  AC  GN ++   L+  G D+ S  +  + P+H A++ GH  +V +L+  KC 
Sbjct:   85 LHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCG 401          

HSP 4 Score: 90.1225 bits (222), Expect = 2.564e-18
Identity = 62/266 (23.31%), Postives = 117/266 (43.98%), Query Frame = 3
Query:  762 LLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEIL------RINGNNNWQKLNLVCK 1532
            LL+KG N      +   P+H AC     ++ +LL+  G  IE+  E    P+H ++  G+  +V +L+       A  +     +H A      ++AG    E+   L+    Q++ +   +Q+PL +A   G  E++ L+ + + +P+   +NG+  L  A++EG+     +++     + +  K    P+H A   G +E+  LLL+     D   K   +   V S    +   K+AL +L           N +  L++  K
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMA------ARAGQT--EVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQ---KVALLLLDQGASPHATAKNGYTPLHIAAK 255          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 3.850e-39
Identity = 112/453 (24.72%), Postives = 207/453 (45.70%), Query Frame = 3
Query:  135 QAIRTGNVDDFNK--YFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTL-VEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGH------------------RLLSASQEGNIKKA---EVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS 1421
            QAI  G+ D+     Y KEE    +   R P+H A+  G+ EI++LL+     ++++ +     +H AC        + L+K   ++   D +   P+H A+    +    ++I    +    D+     +H+A  N   E+   LV K  +I A  K++ R +H+A   GH E++ +L+A   D+  +  + +SP+H A +     +   LL+ GV+++   S     +H AC NG   +   LID G ++   NE  + P+HFA+   H  L +E+L+N   D+   + D   P+H    H   ++        +  LI+   +I+ ++    +PL +A   G+E +IN +     +      H                  +LLSA Q+ +I  +   E ++    +I+  D+     +H A   G++E + LLL    +++  D+F R+
Sbjct:   12 QAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTR--------SQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERT 456          

HSP 2 Score: 119.398 bits (298), Expect = 2.562e-27
Identity = 97/422 (22.99%), Postives = 185/422 (43.84%), Query Frame = 3
Query:  186 EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRY-GLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKP--LDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWR-PIHFASRYGHFTLVEMLI-NAKCD--MEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKL------ENPNMTNGHRLLSASQEGNIKK-AEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDK 1409
            E    ++FGR  +H A+  G +E L LLL    D++ +      A+HYA    +      L+     + E D     P+H+A+   G  + V+  +  + ++++     +  +H  C   Q  +  +L +K+ D     K+ + PVH+A  YGH   L +L+ +P     + ++    SP+H A  + +      L+   V+++    +   P+  A L G+    ++LI  G  +      + R  +H A+  GH   + +L+ NA  +  ++A   ++  P+  A         G+ + + A+LL+ +   IN ++    + L      G+EE ++L+ ++       E       H   +    G +    +  +     I + D++   P+HWAC  GH   V+LLL    ELD+  K
Sbjct:  413 EIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQS-----YIDVHSTCSEAQICLEHLL-RKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLA--------VGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLL----ELDVFQK 816          

HSP 3 Score: 118.242 bits (295), Expect = 6.760e-27
Identity = 105/415 (25.30%), Postives = 188/415 (45.30%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDG-DLLRPIHHASRYGLLNIVTSLIGKSCN---IEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLE----KGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEEN-WRPIHFASRYGHFTLVEMLIN---AKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGN----EEVINLIKE--KLENPNM-TNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIID 1406
            P+H A+ HG    L++L+    D+D R  + +  +  A    H+D   +LI+   ++   +G D    +H A+  G +  +  L+  + +   ++A D N+  P+  A  N   + A++L+ K   I A   +    +H     GH E +++L+ + +D++ +  +  +P+H A    +  I S L++     G  +     +   P+H+AC NG+    +LL++   D+    E N + P+H A    + +  EMLI+   AK  +  P      P+H A        A  ++VE   LL+  N  +NV + + +SPL +A ENG     E ++N  K   KL++ N  T  H   S S E         +     IN  +     P+H A   G   +V++LL     +  +D
Sbjct:  586 PLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLE--LDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKI-INCPDAKGRMPLHAA--------AFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVD 989          

HSP 4 Score: 89.7373 bits (221), Expect = 3.650e-18
Identity = 96/473 (20.30%), Postives = 190/473 (40.17%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGL-------------LNIVTS-----LIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYE------------------YENIASTLLEKGV--------NVESGTSDKM--RPIHFACLNGNFQIAQLLIDKGCDIESCNEENW--RPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC--KHNDA------------------------SKAGDNYVEIAALLIE---RNCQINVQNESKQSPLDLALENGNEEVINLIKEKL------ENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLK 1379
            G+ P+H  + HG+    + L+    +ID    D    +H A R  H  +   LI    +  +     + P+H A+  G               +IV+S     ++     I+  D+     +H A      E   +L+    D+    +     +H+A    + + +  L+A    LN Q  +  +P+H+A   +                  Y ++ ST  E  +        + + G  DK    P+H+A   G+    +LL+++    +S  +      P+H A+ +GH   +E+LI +  D++    +   P+  A    H D                         S A + +VE   LL+E    N  ++  + ++Q+P+ LA+ NG+ +  +L+  K       +N   T  HR    +  G+ +  +++++R  D+++ ++    P+H A   GH+ I+  L++
Sbjct:  304 GKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHR---GAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQ 773          

HSP 5 Score: 72.7886 bits (177), Expect = 5.556e-13
Identity = 57/226 (25.22%), Postives = 113/226 (50.00%), Query Frame = 3
Query:  813 PIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI 1481
            P+  A  NG+    + LI K  ++ + ++E   P+H A+  G   ++E+L+ +   + +     + P+H AC    AS++ +  V+    L++ +  +N ++++ Q+PL +A  N   +    I   L + N+++  G   L  A+  G+ +    ++ +  +IN  DK D R IHWA   GH E+VK+L+ +  ++   DK   S     S   +  + K+ L++
Sbjct:    9 PLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRAC----ASRS-EAAVQT---LLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDL 226          

HSP 6 Score: 71.2478 bits (173), Expect = 1.685e-12
Identity = 59/254 (23.23%), Postives = 108/254 (42.52%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLL----LDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLN-------IVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM-AKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKM---RPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRP 914
            +E+ GR P+H A+  G + IL  L    +     I     + +  +H+AC   H    ELL++     ++ +G+   P+H A    +LN       ++    G    I   D     P+H A   +  E   +L+  N  +         P+  AC  G A  + +L+ +   DL  Q +   + +H AC+  +E  A  +L+K  ++    +       P+H A  +G   + Q+L++KG  I + +   + P
Sbjct:  748 RERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDV-FQKQEGNAFSPLHCA----VLNDNESCAEMLIDTFGAKI-INCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTP 995          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 67.781 bits (164), Expect = 8.277e-13
Identity = 49/190 (25.79%), Postives = 89/190 (46.84%), Query Frame = 3
Query:  417 PIHHASRYGLLNIVTSLI-GKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKK--NCDIEACTKEN-WRPVHFACRYGHAEILNILMAKPL--DLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKG-CDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            P+H A        V  L+  K   +  KD++   P+H++      EI + L+ K  N +++    ++ W P H AC  G+ E++  L  +PL  DLN  T+Q  + +H A   ++  ++  L+E G +V         P+H A   G+ ++ +LL   G   +   +++ W P+  A   GH     +L+
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLV 194          

HSP 2 Score: 50.0618 bits (118), Expect = 7.184e-7
Identity = 39/168 (23.21%), Postives = 69/168 (41.07%), Query Frame = 3
Query:  189 FLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDI---DARSSDNWRAIHYACRESHSDVAELLIKK--KCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVK-KNCDIEACTKENWRPVHFACRYGHAEILNILMAK 674
             L+K+Q GR P+H++      EI   LL K  ++   D      W   H AC   + +V + L  +  K ++ +     +  +H A       +   LI    ++  KDK +  P+H A      ++  +L       +    K+ W P+  A   GH +   +L+ K
Sbjct:   29 LLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 55.4546 bits (132), Expect = 5.442e-8
Identity = 49/212 (23.11%), Postives = 88/212 (41.51%), Query Frame = 3
Query:  384 NIEECDGDLLRPIHHASRYGLLNIVTSLI-GK--SCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEA-CTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACN--------YEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDM 983
            N E  +  LL   H A + G L  V  +I GK    N +         +H+A  NN+  +   LV +  D+ A     +  P+H+A RYG+  I++ L+    D      Q ++ +H + N        Y   N+ S  L   ++++         + +A   G+      L+  G  I+  + E + P+H+ +  G   +++ LI    D 
Sbjct:   65 NDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGL---LDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          

HSP 2 Score: 51.9878 bits (123), Expect = 6.961e-7
Identity = 43/207 (20.77%), Postives = 91/207 (43.96%), Query Frame = 3
Query:  819 HFACLNGNFQIAQLLIDKGCDIESCNE----ENWRPIHFASRYGHFTLVEMLINAKCDMEA-PTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVI-----NLIKEKL-----ENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            H AC  G+    + +I  G  +E  N+    E+   +H+AS     ++V+ L++   D+ A        P+H+A ++         YV I   L++      + ++   + L L++ + N  ++     N++ + L      +P       LL A+ +G+      +++    I I D +   P+HW  +KG   ++K L+++  + 
Sbjct:   78 HTACQRGDLATVKEMI-HGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYG--------YVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRT--SLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 55.4546 bits (132), Expect = 6.489e-8
Identity = 44/163 (26.99%), Postives = 78/163 (47.85%), Query Frame = 3
Query:  255 ILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELL--IKKKCNIE----ECDGDLLRPIHHASRYGL--LNIVTSLIGKSCNIE-----AKDKND------WRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDL 686
            I K +LD   ++ + +   +  ++ AC+ ++ D A+LL  I+ K N +    +    L +P+   +  GL  L+IV  + G    I+       D N+      W PI YA R+   E+ T L+K N  ++        P+ +A    H ++LN L+ +PL+L
Sbjct:  489 IEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNL 651          

HSP 2 Score: 49.2914 bits (116), Expect = 4.550e-6
Identity = 64/266 (24.06%), Postives = 105/266 (39.47%), Query Frame = 3
Query:  813 PIHFACLNGNFQIAQLLIDKGC--DIESCNEENWRPIHFASRYGHFTLVEMLINA----KCDMEAPTLD-----------QMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRL-LSASQEGNIKKAEVMIRRKCDINICDK-DDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSL---------QSVVSGLKKEELNKIALEILRINGNNNWQKLNLV 1526
            P+H+A   G  +    L+      D++  + ++  P+  A    H  +V  L+         +E P LD           Q  P++ ACK N+         + A LL+E   + N  N   +S   L              + L   N T    L + A   G+ +  +++IR   D N  D  +   PI +A   GH E++  LLK+N  LDI D    S            V++ L +  LN  +  +  IN  ++ Q+LN +
Sbjct:  427 PLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNH--------DAAKLLLEIRSKQNADNAKNKSSQHLC-------------QPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEINSQSSTQRLNTI 671          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 53.9138 bits (128), Expect = 1.376e-7
Identity = 49/187 (26.20%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  243 GQLEILKLLLDKHCDI--DARSSDNWRAIHYACRESHSDVAELLIK----KKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCN-IEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAK---PLDLNAQTSQNWSPIHFACNYEYENIASTLLEK 773
            G L I+K LL ++ D+  +  S + W ++HYA       +   LI+    K   I+   G+    +H A   G    +  L+ +    I  + +N   PIH AC N+  +  ++L+    D+         P+H    YG    + +L+ +    LD N +   NW PI  A  +E  NI S +L++
Sbjct:   16 GNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTC--VHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLKE 200          

HSP 2 Score: 52.7582 bits (125), Expect = 2.480e-7
Identity = 38/151 (25.17%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  501 KNDWRPIHYACRNNQCEIATILVKKNCDIEACTK--ENWRPVHFACRYGHAEILNILMAK-PLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKG---CDIESCNEENWRPIHFASRY 935
            +N W  +HYA  + +  I   L++   D     K  +    VH A   GH + L++L+ + P  +N +     +PIH AC  +Y    S L+  G ++    ++   P+H     G+    ++L+++G    D    ++ NW+PI  A  +
Sbjct:   38 ENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTF 188          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 50.8322 bits (120), Expect = 1.595e-6
Identity = 54/232 (23.28%), Postives = 101/232 (43.53%), Query Frame = 3
Query:  306 DNWR--AIHYACRESHSDVAELLIK--KKCNI-EECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKK---NCDIEACTKENWRPVHFACRYGHAEILNILMA-KPLDLNAQTSQ-NWSPIHFACNYEYENIASTLLEKGVNVESGTSDKM---RPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEML 962
            DN++   +HY+C+   S+V +L+IK  K+ NI  E       PI   S +G                  D     P+H        +   +L++    N  +++ +      +H A  + +  +L++L++ K  D+N Q ++ + +P++ AC   +   A  LL  G ++E    +K+     I  A   G   I +LLI    + +  +E  W P+  A   GH  + +M+
Sbjct:  425 DNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEI------PIDDVSAFG------------------DAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSSSL-----LHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLE--IREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 82.0333 bits (201), Expect = 5.200e-18
Identity = 47/152 (30.92%), Postives = 77/152 (50.66%), Query Frame = 3
Query:  519 IHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQ---NWSPIHFACNYEYENIA-STLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIES-CNEENWRPIHFASRYGHFTLVEM 959
            +HYA R    +   +L+K    +    +  WRP+H A   GH E + +L+      NA+T +   N +P+H+A    + + A   L+E+G+++E+   D  R IH A  NG  ++   L+D G DIES   E     +H A+R G  T+  +
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 2 Score: 74.7146 bits (182), Expect = 1.725e-15
Identity = 44/152 (28.95%), Postives = 76/152 (50.00%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLR---PIHHASRYGLLNI-VTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKE-NWRPVHFACRYGHAEILNI 662
            +HYA+R+G  + ++LLL     ++      WR IH A    H++   +L++   +     G  +R   P+H+A+R G L+  V  L+ +  ++EA  ++ WR IH A  N + ++   L+    DIE+ T E     VH A R G   +  +
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 3 Score: 48.521 bits (114), Expect = 1.930e-6
Identity = 41/159 (25.79%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  816 IHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI------NAKCDMEAPTLDQMRPIHFACK--HNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEV-INLIKEKLENPNMTNGHRLLS---ASQEGNI 1256
            +H+A   GN +  +LL+  G  +       WRPIH A+  GH   V ML+      NAK      T+  M P+H+A +  H D +           +L+ER   +          + +A +NG  +V + L+   ++  + T   RL +   A+++G +
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAK---TGKTIRNMTPLHYAARMGHLDCA---------VRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQV 147          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 75.8702 bits (185), Expect = 4.560e-15
Identity = 55/232 (23.71%), Postives = 105/232 (45.26%), Query Frame = 3
Query:  708 WSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENP--NMTNGHRLLS----ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNN 1385
              P+H AC   +      LL  GV+V +  ++   P+H A  +GN    +LL+ +  D    ++    P+H+A+ + +F  V  L+ A  ++  P      P+H+A        A D   +    L+      + +++   S +  A  NG++  I ++ +   N   N ++G   ++    A+  G+    EV+I+   D+ + D     P+  A  +GH+E V+ LL +N
Sbjct:    1 MQPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYA-------AASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHN 225          

HSP 2 Score: 68.1662 bits (165), Expect = 1.880e-12
Identity = 52/227 (22.91%), Postives = 100/227 (44.05%), Query Frame = 3
Query:  510 WRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQ--IAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCD---MEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVI 1175
             +P+H AC     E    L+    D+ A    +  P+H A   G+   L +LM++  D N       +P+H+A  +       +L+  G NV    +    P+H+A  +      +  LL ++G +    +++ +  +H+AS  GH   +EML++   +     +     + P+H A  H         +     +LI+    + V+++  ++PLDLA   G+ E +
Sbjct:    1 MQPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRG-NASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFH--------GHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECV 218          

HSP 3 Score: 65.855 bits (159), Expect = 1.070e-11
Identity = 59/252 (23.41%), Postives = 104/252 (41.27%), Query Frame = 3
Query:  216 RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNN-QCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLIN 968
            +P+H A   G  E  K LL    D++A+ +++   +H A    + +  ELL+ +  +    D     P+H+A+ +     V SL+    N+   D     P+HYA  ++   +    L++   +     K+ +  VH+A   GH   + +L    LD++A    N                           S  S  + P+H A  +G+    ++LI    D+E  ++    P+  AS  GH   VE L+N
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEML----LDVSANDLLN--------------------------RSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLN 223          

HSP 4 Score: 61.6178 bits (148), Expect = 2.613e-10
Identity = 46/209 (22.01%), Postives = 87/209 (41.63%), Query Frame = 3
Query:  411 LRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYE-NIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDI---ESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA 1025
            ++P+H A   G       L+    ++ AKD ND  P+H A  +       +L+ +  D     K    P+H+A  + +   +  L+    ++N   ++  +P+H+A   + +      LL    N           +H+A  NG+    ++L+D   +     S       P+H A+ +GH   +E+LI +  D+E        P+  A
Sbjct:    1 MQPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLA 209          

HSP 5 Score: 54.6842 bits (130), Expect = 6.177e-8
Identity = 43/189 (22.75%), Postives = 80/189 (42.33%), Query Frame = 3
Query:  174 YFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGL-LNIVTSLIGKSCNIEAKDKNDWRPIHYACRN-NQCEIATILVKKNCDI--EACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFA 728
            ++  +   K+   R P+H A+  G +  L+LL+ +  D +         +HYA   ++      L+    N+ + D     P+H+A+   L    V  L+    N   +DK  +  +HYA  N ++  I  +L     D+   +       P+H A  +GH   L +L+    DL  +  +  +P+  A
Sbjct:   21 FYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLA 209          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO47344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMH4])

HSP 1 Score: 72.0182 bits (175), Expect = 2.057e-14
Identity = 49/166 (29.52%), Postives = 80/166 (48.19%), Query Frame = 3
Query:  201 EQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELL-----IKKKCNIEECDGDLLR----PIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENW-RPVHFACRYGHAEILNILM 668
            +  GR P+  A+ +G  E +++LLD + ++D R S+N   +HYA       VAE+L     +K    I     +  R    P+H+A+R+G +    S I +   I  +D     P+HYA R    +   ++++   D    T +N    +H A   GHAEIL  L+
Sbjct:    5 DHLGRTPIMLAAENGCFESVRVLLDHNANVDIRDSENKTVLHYAI-----GVAEILKEILKVKAGTEISRLTSNNYRLGNTPLHYAARHGYI----STIHEMFTIYLRDVQGQTPLHYAARQGSKKALELILENKPDCLNVTDKNQNTAIHMAALGGHAEILEFLL 161          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 71.633 bits (174), Expect = 9.413e-14
Identity = 53/226 (23.45%), Postives = 106/226 (46.90%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWR-PVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDI 884
            G   +H+A+R+ ++E +  L+ ++  I+  S+     +H AC++   +V  LL++K   +++ +     P+H A+  G  + +  L+ K   I+ +D +   P   A    + E A +L++K+        EN + P+H AC  G A  +  L    L  N +  +  S +H A    +  + + LL  G ++ +  S++  P+  A   G+ +    L+  G  I
Sbjct:    8 GFSALHHATRYNRVEAMAELI-RNGSIEDLST----PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKD--------ENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 2 Score: 67.781 bits (164), Expect = 1.973e-12
Identity = 52/204 (25.49%), Postives = 89/204 (43.63%), Query Frame = 3
Query:  420 IHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK 1031
            +HHA+RY  +  +  LI ++ +IE        P+H AC+    E+  +LV+K   ++    +   P+H A   G  + L  L++K + ++ +   + +P   A        A  LLEK  N +S       P+H AC  G     + L   G      +EE    +H A+  G   +V  L+    D+ A   ++  P+  A K
Sbjct:   12 LHHATRYNRVEAMAELI-RNGSIEDLST----PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDENQKS-------PLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAK 203          

HSP 3 Score: 63.929 bits (154), Expect = 4.136e-11
Identity = 57/244 (23.36%), Postives = 98/244 (40.16%), Query Frame = 3
Query:  684 LNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHR-------LLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            LN      +S +H A  Y      + L+  G        D   P+H AC  G+ ++ +LL++KG  ++  N++   P+H A+  G F  ++ L++    ++        P          S       E A LL+E+       +E+++SPL LA   G      L  E L    ++   R       L  A+  G  K    ++R   DIN  D +   P+  A   G ++    LL++   +
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNG-----SIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPF--------LSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRA----LHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 4 Score: 62.003 bits (149), Expect = 1.630e-10
Identity = 49/222 (22.07%), Postives = 87/222 (39.19%), Query Frame = 3
Query:  120 LELFHQAIRTGNVDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNV 785
            +E   + IR G+++D +                P+H A + G +E+ +LL++K   +D ++      +H A      D  + L+ K   I+E D     P   A   G       L+        KD+N   P+H AC   +      L +         +E    +H A   G  +++  L+    D+NA+ S  W+P+  A           LL+ G ++
Sbjct:   21 VEAMAELIRNGSIEDLST---------------PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLL-------EKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 74.7146 bits (182), Expect = 1.108e-13
Identity = 43/171 (25.15%), Postives = 85/171 (49.71%), Query Frame = 3
Query:  261 KLLLDKHCDIDARSSDNWRAIHYACRESH-SDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLE 770
            +LLLD    ID+++ ++   IHYA +      V  LL +    I + DG    P+H A+ +G   +V  L+ +   I+A++   W P+  A      E+A IL+ ++  ++   K    P+H A R GH E++ +L+++  ++    S   + +  A    ++ +A  +++
Sbjct:  267 QLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 2 Score: 74.3294 bits (181), Expect = 1.641e-13
Identity = 95/452 (21.02%), Postives = 169/452 (37.39%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKK----------KCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNI----EAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVES----------------------GTSDKMRPIHF----ACLNG-----NFQI------AQLLIDKGCDIESCNEENWRPIHFASRYGHF-TLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNR 1418
            P+H A  HG + + K L++   D+ +   +    +H+AC E +  VA+LL                + + D +    +H A   G  ++    + K  N+    E+K+K   + I  A    +C    I V K   +  C  E  +       +    I+  ++     +  +     +P+  A    + +   TLL+ G ++ +                         +  +P+       CLNG     N  I      +QLL+D G  I+S N+E+  PIH+A+++G   T+  +L      +         P+H A  H  A+        +   L+ R   I+ +N +  +PLD A   G  EV N                              +++     ++  DK    P+H A  +GH+E+VKLLL     + + D   R
Sbjct:    7 PLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVA---RECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAA--------VVKELLYRGGAIDARNATLWTPLDCAAARGMVEVAN------------------------------ILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGR 417          

HSP 3 Score: 59.3066 bits (142), Expect = 8.814e-9
Identity = 55/223 (24.66%), Postives = 93/223 (41.70%), Query Frame = 3
Query:  804 KMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAK------CDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVM------------IRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNR 1418
            +M P+H AC +G   +A+ L++ G D+ S +EE   P+HFA   G+  + ++L  A         +     DQ R    A         GD    +A L +E+   +N   ESK       +    E +  +IK         +  + LS  +   IK+  ++            IR +  I   DKD   P+  A  K H++ V+ LL++  ++   D  +R
Sbjct:    4 QMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGD----LAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIK--------VSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDR 214          

HSP 4 Score: 58.9214 bits (141), Expect = 1.038e-8
Identity = 38/155 (24.52%), Postives = 70/155 (45.16%), Query Frame = 3
Query:  114 DDLELFHQAIRTGNVDDFNKYFKEEFL---EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILV 569
            +D+   H A + G V       K +     +++     P+H A+ HG   ++K LL +   IDAR++  W  +  A      +VA +L+ +   ++  D     P+H ASR G + +V  L+ +  NI   D      +  A  ++  E+A  ++
Sbjct:  282 EDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAII 436          

HSP 5 Score: 55.0694 bits (131), Expect = 1.757e-7
Identity = 37/172 (21.51%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  357 AELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGK-SCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLID 869
            ++LL+     I+  + + + PIH+A+++G +  V +L+ +    I  +D     P+H A  +    +   L+ +   I+A     W P+  A   G  E+ NIL+ +   ++       +P+H A    +  +   LL +  N+    S     +  A  + + ++A  +ID
Sbjct:  266 SQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 6 Score: 54.6842 bits (130), Expect = 2.052e-7
Identity = 71/320 (22.19%), Postives = 130/320 (40.62%), Query Frame = 3
Query:  501 KNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPI---------------HFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFA------CLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAG---DNYVEIAALLI-ERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNN 1385
            K    P+H AC +    +A  LV+   D+ +  +E   P+HFAC  G     N+ +AK L + A+    WS +               H A    + ++A   LEKG NV +    K +  H        C+    ++++L     C  E    E    ++F   +    ++  +I  +  +E    D+  P+  A + N          +  +IAA  I +RN       E     L+ ALE+  + V  +  +   N  +   ++L+   +      +++++     I+  + +D+ PIH+A   G +  V  LLK +
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEG-----NLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREIL--LYF---FDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEH-QKPVWTICDDVCLNGLVGGSNKLILVLR----ISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRD 306          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 191.045 bits (484), Expect = 2.533e-48
Identity = 102/396 (25.76%), Postives = 201/396 (50.76%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G   + K+LLDK    +AR+ + +  +H AC+++H    +LL+K   ++E      L P+H A+  G LNIV +L+ +  +  A +     P+H A R   CE+A  L++    ++A  K++  P+H A R GH E++ +L+    + ++ T+   +P+H A    + +    LL+ G      T     P+H A   G   +A+LL+++G +  +  +    P+H A  + +  +V++L++      +   +   P+H A K N         +E+A++L++     N ++    +PL LA + G  +++ ++  K  N N+ N + L      +QEG++  A+ ++++   +    +    P+H AC  G+I++VK LL+    ++
Sbjct:  339 PLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQ--------IEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN 726          

HSP 2 Score: 177.178 bits (448), Expect = 4.865e-44
Identity = 108/428 (25.23%), Postives = 195/428 (45.56%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+R+G + I+++LL+    I A++ +    IH A +  H D    L++    I++   D L P+H A+  G   +   L+ K     A+  N + P+H AC+ N      +L+K +  +EA T+    P+H A   GH  I+  L+ +    NA   +  +P+H A    +  +A  LL+    V++   D   P+H A   G+ ++ +LL+D   + +S       P+H A+R GH   + +L++A       T     P+H A K+          V++A LL+ER    N   ++  +PL +A+ + N +V+ L+  K  + + T  NG+  L                                   ASQEG      ++I ++ ++N+ +K+ + P+H    +GH+ I   L+K    +
Sbjct:  273 PLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGK--------VDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASV 692          

HSP 3 Score: 166.777 bits (421), Expect = 6.269e-41
Identity = 102/392 (26.02%), Postives = 188/392 (47.96%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            +H A+R+       +LL    + D  S   +  +H A    +  VA+LL+ +  N+     + + P+H ASR G + +V  L+ +   I+A+ K++  P+H A RN    I  IL++    I+A TK    P+H A +  H + +  L+    +++  T  + +P+H A +  +  +A  LL+KG    +   +   P+H AC   + +   LL+     +E+  E    P+H A+  GH  +V+ L+       A  +    P+H       AS+AG  + E+A  L++   Q++ + +  Q+PL  A   G++E++ L+ +   NP+   T GH  L  A++EG+I    +++          K    P+H A   G +++ +LLL+   
Sbjct:  175 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHM------ASRAG--HCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGA 558          

HSP 4 Score: 166.007 bits (419), Expect = 1.043e-40
Identity = 99/395 (25.06%), Postives = 188/395 (47.59%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE------KLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            G  P+H A+ +  + + +LLL++  +++    +    +H A R  +  +  LL+ +   I+    D L P+H A+R G + I+  L+     I+AK KN   PIH A + +  +    L++ N +I+  T ++  P+H A   GH  +  +L+ K    NA+    ++P+H AC   +      LL+   ++E+ T   + P+H A   G+  I + L+ +G    + N +   P+H ASR GH  + + L+     ++A   D   P+H A +          + E+  LL++     +    +  +PL +A   G+   I ++ +      K+     T  H    AS+ G +  AE+++ R  + N   K+ + P+H A    ++++VKLL+
Sbjct:  204 GFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARM--------GHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLH---VASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 587          

HSP 5 Score: 160.229 bits (404), Expect = 6.931e-39
Identity = 137/599 (22.87%), Postives = 263/599 (43.91%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSK--KENKCRFYLNNFYFPNEGVGKTQSEANCNAVEKFLNTFVNISKISSTTDYILNNHDVRFEVVSKAETQKITNQNGNLPL 1811
            Q+ L   H A + G+V    +      E     + G   +H A+  GQ +++  L++   +++A+S   +  ++ A +E+H +V + L++   N      D   P+  A + G  N+V  LI    N   K K     +H A RN+    A +L++ + + +  +K  + P+H A  Y +  +  +L+ +  ++N       +P+H A       +   LL++G  +++ T D++ P+H A  NG+ +I ++L++ G  I++  +    PIH A++  H   V  L+    +++  TLD + P+H A  C H+  +K                          N++    LL++ +  +    ES  +PL +A   G+  ++  + ++  +PN +N      L  AS+ G+ + A+ +++    ++   KDD  P+H A   GH E+VKLLL +    D       +   + +        +  +  +RI  +   Q++ +  K       P+ ++SK  K +     L             +  AN NA  K   T ++++          NN DV   +VSK  +   T +NG  PL
Sbjct:   41 QNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAA-------REGHIHTIRILLDAGAQQVKMTKKG----FTPLHVASKYGKVDVAELLL-------------ERGANPNAAGKNGLTPLHVAVHH-------NNLDVVKLLVSKGGSAHSTARNGYTPL 604          

HSP 6 Score: 137.502 bits (345), Expect = 5.273e-32
Identity = 64/252 (25.40%), Postives = 130/252 (51.59%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLI 965
            G  P+H A+R G +  +++LLD        +   +  +H A +    DVAELL+++  N      + L P+H A  +  L++V  L+ K  +  +  +N + P+H A + NQ E+A++L++        + +   P+H A + G  +++ +L++K  ++N       +P+H      +  IA TL+++G +V + +     P+H AC  GN ++ + L+ +   + +     + P+H A++ GH  +V +L+
Sbjct:  501 GHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLL 752          

HSP 7 Score: 120.553 bits (301), Expect = 8.095e-27
Identity = 90/390 (23.08%), Postives = 175/390 (44.87%), Query Frame = 3
Query:  330 ACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGV-----------------------------NVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEE-VINLIKEKLENPNMTNGH--RLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDII 1403
            A R  + D A   IK   NI   + + L  +H AS+ G + +V  L+     +EA  K     +H A    Q ++   LV    ++ A + + + P++ A +  H E++  L+    + +  T   ++P+  A    +EN+ + L+  G                              N +  +     P+H A    N  +AQLL+++G ++    +    P+H ASR G+  +V +L++    ++A T D++ P+H A +        + +V I  +L+E    I  + ++  SP+ +A +  + + V  L++   E  ++T  H   L  A+  G+ + A+V++ +    N    +   P+H AC K H+  + LLLK++  L+ +
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAAR--------NGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV 398          

HSP 8 Score: 106.301 bits (264), Expect = 1.746e-22
Identity = 85/379 (22.43%), Postives = 166/379 (43.80%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE-ILRINGN--NNWQKLNLVCKAMHIK 1547
            A+R G L+     I    NI   ++N    +H A +    ++   L+    ++EA TK+    +H A   G  +++  L+    ++NAQ+ + +SP++ A    +  +   LLE G N    T D   P+  A   G+  +  LLI+ G       +     +H A+R        +L+    + +  +     P+H A  + + S        +A LL+ R   +N   ++  +PL +A   GN  ++ L+ ++    +      L     A++ G+++  E+++     I    K+ + PIH A    H++ V+ LL+ N E+D I   + +   V +      + K+ L+   + N    N +  L++ CK  H++
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMS--------VAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMR 383          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 189.119 bits (479), Expect = 8.932e-48
Identity = 106/396 (26.77%), Postives = 196/396 (49.49%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            P+H A+  G   + K+LLDK    ++R+ + +  +H AC+++H  V +LL+K   +IE      L P+H AS  G LNIV  L+ K  +  A +     P+H A R+   E+A  L++    ++A  K++  P+H A R GH E++ +L+    + N+ T+   SP+H A    +      LL+        T     P+H A   G   +A+LL+++G +  +  +    P+H A  + +  +V +L++      +   +    +H A K N         VE+A  L++     N ++    +PL LA + G  ++++L+  K  N N+ N   L      +QEG++  A++++++   +    +    P+H AC  G+I++VK LL+    ++
Sbjct:  279 PLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQ--------VEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVN 666          

HSP 2 Score: 185.652 bits (470), Expect = 1.050e-46
Identity = 110/428 (25.70%), Postives = 197/428 (46.03%), Query Frame = 3
Query:  219 PVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS----------------------------------ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCEL 1394
            P+H A+R+G   I+++LLD    I A++ +    IH A +  H D  + L++    I++   D L P+H A+  G   +   L+ K     ++  N + P+H AC+ N   +  +L+K +  IEA T+    P+H A   GH  I+ IL+ K    +A   +  +P+H A    +  +A  LL+    V++   D   P+H A   G+ ++ +LL++   +  S       P+H A+R GH   V +L++ +      T     P+H A K+          V++A LL+ER    N   ++  +PL +A+ + N +V+NL+  K  +P+    NG+  L                                   ASQEG      ++I ++ ++N+ +K  + P+H    +GH+ I  +L+K    +
Sbjct:  213 PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGK--------VDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASV 632          

HSP 3 Score: 166.777 bits (421), Expect = 6.081e-41
Identity = 108/437 (24.71%), Postives = 193/437 (44.16%), Query Frame = 3
Query:  198 KEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLI----KKKCNIEECD----------------------------------GDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLI------KEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            + Q G  P++ A++   LE++K LL+   +    + D +  +  A ++ H +V  LLI    K K  +                                       D L P+H A+R G   I+  L+     I+AK KN   PIH A + +  +    L++ N +I+  T ++  P+H A   GH  +  +L+ K    N++    ++P+H AC   +  +   LL+   ++E+ T   + P+H A   G+  I ++L+ KG    + N +   P+H ASR GHF + E L+     ++A   D   P+H A +          + E+  LL+E     N    +  SPL +A   G+ + + L+      + K+     T  H    AS+ G +  AE+++ R  + N   K+ + P+H A    ++++V LL+
Sbjct:  102 QSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARM--------GHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLH---VASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLV 527          

HSP 4 Score: 150.984 bits (380), Expect = 3.936e-36
Identity = 108/475 (22.74%), Postives = 203/475 (42.74%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKEEFL--EKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCN--IEECDG------------------------------------------DLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN--GHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            Q+ L   H A + G+V    +      +     + G   +H A+  GQ +++  L++   +++A+S   +  ++ A +E+H +V + L++   N  I   DG                                              P+H A+ Y  LN+   L+ +  N      ++  P+H A RN    I  IL+     I+A TK    P+H A +  H + +  L+    +++  T  + +P+H A +  +  +A  LL+KG    S   +   P+H AC   + ++  LL+     IE+  E    P+H AS  GH  +V++L+       A  +    P+H A +          + E+A  L++    ++ + +  Q+PL  A   G++E++ L+ E   NPN T   GH  L  A++EG+++   +++  +       K    P+H A   G +++ +LLL+   
Sbjct:   38 QNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASR--------SGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGA 498          

HSP 5 Score: 146.362 bits (368), Expect = 1.215e-34
Identity = 102/432 (23.61%), Postives = 205/432 (47.45%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMA----KPLDLNAQTS-------QNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLI---KEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE 1478
            A+R G L+     +    DI+  + +   A+H A +E H  +   L+     +E         +H A+  G   +VT L+    N+ A+ +  + P++ A + N  E+   L++   +    T++ + P+  A + GH  ++ +L++      + L A T          ++P+H A +YE  N+A  LL +G N      D++ P+H A  NG+F+I ++L+D G  I++  +    PIH A++  H   V+ L+    +++  TLD + P+H A  C H+           +A +L+++  + N +  +  +PL +A +  +  V++L+      +E    +    L  AS  G++   ++++++    +  +     P+H A   GH E+ + LL+N   +D   K +++     + +  +EL K+ LE
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHH----------RMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLE 429          

HSP 6 Score: 143.28 bits (360), Expect = 1.071e-33
Identity = 75/291 (25.77%), Postives = 137/291 (47.08%), Query Frame = 3
Query:  129 FHQAIRTGN--VDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPT 995
             H A R+G+  V +F          K +  + P+H A+R G  E++KLLL+   + ++ ++     +H A RE H     LL+  +    +       P+H AS+YG +++   L+ +  N  A  KN   P+H A  +N  ++  +LV K     +  +  +  +H A +    E+ N L+      NA++ Q  +P+H A      +I S L+ K  NV  G    + P+H     G+  IA +L+ +G  + +     + P+H A  YG+  +V+ L+  + ++ + T
Sbjct:  379 LHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKT 669          

HSP 7 Score: 142.895 bits (359), Expect = 1.136e-33
Identity = 107/435 (24.60%), Postives = 197/435 (45.29%), Query Frame = 3
Query:  300 SSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYG-------LLN--------------------------IVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMA----KPLDLNAQTS-------QNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA--CKHNDASKA-----------------------GDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN---GHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNC 1388
            S+D   +   A R  + D A   IK   +I   + + L  +H AS+ G       LL+                          +VT L+    N+ A+ +  + P++ A + N  E+   L++   +    T++ + P+  A + GH  ++ +L++      + L A T          ++P+H A +YE  N+A  LL +G N      D++ P+H A  NG+F+I ++L+D G  I++  +    PIH A++  H   V+ L+    +++  TLD + P+H A  C H+  +K                          N++ +  LL++ +  I    ES  +PL +A   G+  ++ ++ +K  +P+ +N      L  AS+ G+ + AE +++    ++   KDD  P+H A   GH E+VKLLL++  
Sbjct:    4 SADAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKA 432          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 175.252 bits (443), Expect = 1.906e-43
Identity = 103/395 (26.08%), Postives = 189/395 (47.85%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G   + KLLLDK  + +AR+ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G LNIV  L+    + +  +      +H A R  Q E+   L++    ++A  +E+  P+H A R G  EI+ +L+      +A T+  ++P+H +        AS LLE G +    T     P+H     G+  +A+LL+ +    +S  +    P+H A+ Y +  +  +L++          +   P+H A K N         ++IA +L++   + N   +   +PL LA + G+ ++  L+  K    N+     L +   A+QE  +  AE+++R   +++   K    P+  AC  G+ ++V  LL+N   ++
Sbjct:  377 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQ--------MDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVN 763          

HSP 2 Score: 170.244 bits (430), Expect = 6.164e-42
Identity = 124/513 (24.17%), Postives = 222/513 (43.27%), Query Frame = 3
Query:  102 DVQ-QDDLELFHQAIRTGNVDD----FNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKK---------------------------------KCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEEL----NKIAL-EILRINGNN 1502
            DVQ +      H A   GNV+      N+    +F  +   G  P+H AS+ G   +++LLLD+   IDA++ D    +H A R  H    E+L++K                                 K  +++   D L  +H A+  G   +   L+ K  N  A+  N + P+H AC+ N+ ++  +LVK    I+A T+    P+H A   GH  I+ +L+      +    +  + +H A       +   LL  G  V++   +   P+H A   G  +I QLL+      ++     + P+H ++R G      +L+ A       T     P+H   K+          +++A LL++R    +   ++  +PL +A    N++V  L+ +K  +P+ T  NG+  L  A+++  +  A V+++   + N   K  + P+H A  +GH ++  LL+    ++++  K         SGL    L    +++A+ EIL  NG N
Sbjct:  235 DVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN--GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGS--------LDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTK---------SGLTALHLAAQEDRVAVAEILVRNGAN 728          

HSP 3 Score: 166.007 bits (419), Expect = 1.054e-40
Identity = 107/429 (24.94%), Postives = 206/429 (48.02%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            F +A R GN+D   +Y K   +     Q G   +H A++ G +++++ LLD+   +D+ +     A+H +     ++V + L+K+  +I     +   P++ A++   L++V  L+    N     ++ + P+  A +    ++ +IL++ +       K     +H A R    +   +L+    + + Q+   ++P+H A +Y   N+A+ LL +G  V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H A+R GH   VE+L+     + A T + + P+H A +       GD +VE    L++    ++       + L +A   G+  V  L+ +K  NPN    NG   L  A ++  +K  E++++    I    +  + PIH A   GH+ IV LLL+N    D+
Sbjct:   51 FLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQ-------GD-HVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDV 467          

HSP 4 Score: 158.688 bits (400), Expect = 2.305e-38
Identity = 92/391 (23.53%), Postives = 180/391 (46.04%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLE--NPNMTNGHRLL-SASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            G  P+H A+  G L I+ LLL      D  +     ++H A R   ++V   L++    ++    +   P+H ASR G   IV  L+    + +A   N + P+H + R  Q E A++L++        TK+ + P+H   +YG  ++  +L+ +    ++      +P+H A +Y+ + +A  LL+KG +  +   +   P+H A       IA +L+  G +  +  ++   P+H AS+ GH  +  +L++    +  PT   +  +H A +        ++ V +A +L+     ++ Q +   +PL +A   GN ++++ + +     N    NG+  L  A+Q+GN     V+++     N    +    +  A   G+I +V  L
Sbjct:  439 GLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQ--------EDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 5 Score: 157.147 bits (396), Expect = 6.105e-38
Identity = 111/492 (22.56%), Postives = 216/492 (43.90%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK-----AGDNYVEIAAL---------LIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEIL------RINGNNNWQKLNLVCKAMHIKLNPIFISSKKEN 1583
            G  P+  A + G  +++ +LL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ +   ++   +N   P+H A +     +  +L+ +   I+A T++   P+H A R GH   + +L+ K   L A+T    SP+H A   ++      LL+    V+  T D +  +H A   G++++ +LL+DK  +  +     + P+H A +     ++E+L+     ++A T   + PIH A              N AS       G+  + +AA          L+     ++ +    Q+PL +A   G  E++ L+ + + +P+   TNG+  L  +++EG ++ A V++      ++  K    P+H     G +++ KLLL+     D   K   +   V +    +   K+AL +L           N +  L++  K   + +  + +    E 
Sbjct:  179 GFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQ---KVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAET 663          

HSP 6 Score: 111.694 bits (278), Expect = 4.554e-24
Identity = 79/386 (20.47%), Postives = 172/386 (44.56%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGN----NNWQKLNLVCKAMHIKLNPIFI 1565
            A+R G ++ V   +    +I   ++N    +H A +    ++   L+ +   +++ TK+    +H +   G AE++  L+ +  D+NAQ+   ++P++ A    + ++   LLE G N  + T D   P+  A   G+ Q+  +L++     ++  +     +H A+R        +L+    + +  +     P+H A  + +        V +A LL+ R   ++    +  +PL +A + GN  ++ L+ ++    +      L     A++ G+    EV++ +   +    K+ + P+H A    H+E VK LL++   +D +     +   V +      + K+ L+  R N N    N +  L++ CK   +K+  + +
Sbjct:   54 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGN--------VNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK-RANPNARALNGFTPLHIACKKNRVKVMELLV 426          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 174.866 bits (442), Expect = 2.343e-43
Identity = 103/395 (26.08%), Postives = 189/395 (47.85%), Query Frame = 3
Query:  222 VHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            +H A+  G   + KLLLDK  + +AR+ + +  +H AC+++   V ELL+K   +I+      L PIH A+  G LNIV  L+    + +  +      +H A R  Q E+   L++    ++A  +E+  P+H A R G  EI+ +L+      +A T+  ++P+H +        AS LLE G +    T     P+H     G+  +A+LL+ +    +S  +    P+H A+ Y +  +  +L++          +   P+H A K N         ++IA +L++   + N   +   +PL LA + G+ ++  L+  K    N+     L +   A+QE  +  AE+++R   +++   K    P+  AC  G+ ++V  LL+N   ++
Sbjct:  362 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQ--------MDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVN 748          

HSP 2 Score: 169.859 bits (429), Expect = 8.111e-42
Identity = 124/513 (24.17%), Postives = 222/513 (43.27%), Query Frame = 3
Query:  102 DVQ-QDDLELFHQAIRTGNVDD----FNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKK---------------------------------KCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEEL----NKIAL-EILRINGNN 1502
            DVQ +      H A   GNV+      N+    +F  +   G  P+H AS+ G   +++LLLD+   IDA++ D    +H A R  H    E+L++K                                 K  +++   D L  +H A+  G   +   L+ K  N  A+  N + P+H AC+ N+ ++  +LVK    I+A T+    P+H A   GH  I+ +L+      +    +  + +H A       +   LL  G  V++   +   P+H A   G  +I QLL+      ++     + P+H ++R G      +L+ A       T     P+H   K+          +++A LL++R    +   ++  +PL +A    N++V  L+ +K  +P+ T  NG+  L  A+++  +  A V+++   + N   K  + P+H A  +GH ++  LL+    ++++  K         SGL    L    +++A+ EIL  NG N
Sbjct:  220 DVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN--GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGS--------LDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTK---------SGLTALHLAAQEDRVAVAEILVRNGAN 713          

HSP 3 Score: 166.007 bits (419), Expect = 1.296e-40
Identity = 107/429 (24.94%), Postives = 206/429 (48.02%), Query Frame = 3
Query:  129 FHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDI 1400
            F +A R GN+D   +Y K   +     Q G   +H A++ G +++++ LLD+   +D+ +     A+H +     ++V + L+K+  +I     +   P++ A++   L++V  L+    N     ++ + P+  A +    ++ +IL++ +       K     +H A R    +   +L+    + + Q+   ++P+H A +Y   N+A+ LL +G  V+    + + P+H A   GN  + +LL+D+G  I++   +   P+H A+R GH   VE+L+     + A T + + P+H A +       GD +VE    L++    ++       + L +A   G+  V  L+ +K  NPN    NG   L  A ++  +K  E++++    I    +  + PIH A   GH+ IV LLL+N    D+
Sbjct:   36 FLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQ-------GD-HVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDV 452          

HSP 4 Score: 158.303 bits (399), Expect = 2.860e-38
Identity = 92/391 (23.53%), Postives = 180/391 (46.04%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLE--NPNMTNGHRLL-SASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLL 1373
            G  P+H A+  G L I+ LLL      D  +     ++H A R   ++V   L++    ++    +   P+H ASR G   IV  L+    + +A   N + P+H + R  Q E A++L++        TK+ + P+H   +YG  ++  +L+ +    ++      +P+H A +Y+ + +A  LL+KG +  +   +   P+H A       IA +L+  G +  +  ++   P+H AS+ GH  +  +L++    +  PT   +  +H A +        ++ V +A +L+     ++ Q +   +PL +A   GN ++++ + +     N    NG+  L  A+Q+GN     V+++     N    +    +  A   G+I +V  L
Sbjct:  424 GLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQ--------EDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 5 Score: 156.762 bits (395), Expect = 7.077e-38
Identity = 111/492 (22.56%), Postives = 216/492 (43.90%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC-----------KHNDASK-----AGDNYVEIAAL---------LIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPN--MTNGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEIL------RINGNNNWQKLNLVCKAMHIKLNPIFISSKKEN 1583
            G  P+  A + G  +++ +LL+     D +      A+H A R+  +  A LL++   N +        P+H A+ YG +N+ T L+ +   ++   +N   P+H A +     +  +L+ +   I+A T++   P+H A R GH   + +L+ K   L A+T    SP+H A   ++      LL+    V+  T D +  +H A   G++++ +LL+DK  +  +     + P+H A +     ++E+L+     ++A T   + PIH A              N AS       G+  + +AA          L+     ++ +    Q+PL +A   G  E++ L+ + + +P+   TNG+  L  +++EG ++ A V++      ++  K    P+H     G +++ KLLL+     D   K   +   V +    +   K+AL +L           N +  L++  K   + +  + +    E 
Sbjct:  164 GFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQ---KVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAET 648          

HSP 6 Score: 111.309 bits (277), Expect = 5.242e-24
Identity = 79/386 (20.47%), Postives = 172/386 (44.56%), Query Frame = 3
Query:  429 ASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS---ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEILRINGN----NNWQKLNLVCKAMHIKLNPIFI 1565
            A+R G ++ V   +    +I   ++N    +H A +    ++   L+ +   +++ TK+    +H +   G AE++  L+ +  D+NAQ+   ++P++ A    + ++   LLE G N  + T D   P+  A   G+ Q+  +L++     ++  +     +H A+R        +L+    + +  +     P+H A  + +        V +A LL+ R   ++    +  +PL +A + GN  ++ L+ ++    +      L     A++ G+    EV++ +   +    K+ + P+H A    H+E VK LL++   +D +     +   V +      + K+ L+  R N N    N +  L++ CK   +K+  + +
Sbjct:   39 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGN--------VNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK-RANPNARALNGFTPLHIACKKNRVKVMELLV 411          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 1.041e-39
Identity = 103/414 (24.88%), Postives = 194/414 (46.86%), Query Frame = 3
Query:  231 ASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILM----------------AKPLDLNA-------------QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMT--NGHRLLS-ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLL 1376
            A+R G LE     L    DI+  + +   A+H A +E H +V   LIK+  N++         +H AS  G   +V  L+    N+ A+ +N + P++ A + N  ++  +L++        T++ + P+  A + GH +++++L+                A+  D  A             ++   ++P+H A +Y   N+A+ LL +G  V+    + + P+H A   GN  + +LL+++G  I++  ++   P+H A+R GH  +VEML+N    + + T + + P+H A +       GD ++    LL+  +  ++       + L +A   G+ +V  +I +K  NPN    NG   L  A ++  +K  E++++    I    +  + PIH A   GH  IV  L+
Sbjct:   24 AARAGNLEKALDYLQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQ-------GD-HLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLI 429          

HSP 2 Score: 143.28 bits (360), Expect = 7.426e-36
Identity = 91/404 (22.52%), Postives = 188/404 (46.53%), Query Frame = 3
Query:  111 QDDLELFHQAIRTGNVDDFNKYFKE--EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRY---------------------------------GHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTN 1217
            Q+ L   H A + G+V+   +  K+        + G   +H AS  GQ E++K L+    +++A+S + +  ++ A +E+H DV +LL++   +      D   P+  A + G   +V+ L+      + K K     +H A R +  + A +L++ + + +  +K  + P+H A  YG+  +  +L+ +   ++ +   + +P+H A      N+   LLE+G  +++ T D + P+H A  +G+ Q+ ++L+++G  I S  +    P+H A++                                  GH+ + +++++ K +  A  L+   P+H ACK         N V++  LL++    I    ES  +P+ +A   G+E +++ +     +PN +N
Sbjct:   48 QNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACK--------KNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGASPNTSN 439          

HSP 3 Score: 70.0922 bits (170), Expect = 8.876e-12
Identity = 54/220 (24.55%), Postives = 97/220 (44.09%), Query Frame = 3
Query:  825 ACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFA----------------CKHNDASKAG---------DNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLS----ASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELD 1397
            A   GN + A   +  G DI  CN+     +H AS+ GH  +V  LI    +++A T      +H A                   N  S+ G         +N++++  LL+E     ++  E   +PL +AL+ G+++V++L+ E     N T G   L     A+++ + K A ++++   + ++  K    P+H A   G+I +  LLL     +D
Sbjct:   24 AARAGNLEKALDYLQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD 238          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000059823.1 (SMESG000059823.1)

HSP 1 Score: 1647.87 bits (4266), Expect = 0.000e+0
Identity = 808/812 (99.51%), Postives = 810/812 (99.75%), Query Frame = 3
Query: 1536 MHIKLNPIFISSKKENKCRFYLNNFYFPNEGVGKTQSEANCNAVEKFLNTFVNISKISSTTDYILNNHDVRFEVVSKAETQKITNQNGNLPLKDKKIVNLADMILSKFTRDLWKVLNECCAITKINFIPKFIRCDDQFCCSFLFDEIKFEQHIESYCRIESGRKLAEAFIKEYASSYDEYLDKIDRLFTLVAAECKQSKRVNINDILSKQCEDLNIEVYKQFSQISNVFHCKINLNHKPCQITGVGVTEEAALNSAIEILFVKFFSPQMFAKIQNWKNFNKIAKFCSSNKFSDEWKSLCNSCLLLGFKRHERFTESDGIFSLAFFIENENCEIIGSGTSRNEAGIRLSKLFVEKYLDLKKLFIEFIANLDDKEFYFFVITLCVDKFWLNNWQVLSEVCSKFKINLTKHMQSVNFNRFRCSMNIGIHHYDNSITLADQDLAFNLLANQFFSKYSDKQLSGDEVKKILKEINSANSSTAINDKSLIGDVSLSRLEIFHKIATFCRFNQKSDDWKTLCNACKSLNYNIYERFINLDSKILCEIYIDNESINITEISSTRKQAACSLARKFVDRYQHGNTTVKASKDVILKNITETYLKSPVKGDEWKTLCNTCKSLNYKLVAYFISHENHLFECNISIEDFPFGFGGKFPTRKEAGIFTAKSFIEKYNCSNTGVAIESSGDTGEENAAIYKKIAIFSKKYPYQNYWEALSSACRMLDYKIQKTVTEENDDFCCRFSIKNDVINLTGRGKSDKKASINAARQFIDKYYETKDSPFNPSASQQLDQKLLPKIFVCEPDFVNQKIHNDAYKGVYFLTY 3971
            MHIKLNPIFISSKKENKCRFYLNNFYFPNEGVGKTQSEANCNAVEKFLNTF+NISKISSTTD ILNNHDVRFEVVSKAETQKITNQNGNLPLKDKKIVNLADMILSKFTRDLWKVLNECCAITKINFIPKFIRCDDQFCCSFLFDEIKFEQHIESYCRIESGRKLAEAFIKEYASSYDEYLDKIDRLFTLVAAECKQSKRVNINDILSKQCEDLNIEVYKQFSQISNVFHCKINLNHKPCQITGVGVTEEAALNSAIEILFVKFFSPQMFAKIQNWKNFNKIAKFCSSNKFSDEWKSLCNSCLLLGFKRHERFTESDGIFSLAFFIENENCEIIGSGTSRNEAGIRLSKLFVEKYLDLKKLFIEFIANLDDKEFYFFVITLCVDKFWLNNWQVLSEVCSKFKINLTKHMQSVNFNRFRCSMNIGIHHYDNSITLADQDLAFNLLANQFFSKYSDKQLSGDEVKKILKEINSANSSTAINDKSLIGDVSLSRLEIFHKIATFC+FNQKSDDWKTLCNACKSLNYNIYERFINLDSKILCEIYIDNESINITEISSTRKQAACSLARKFVDRYQHGNTTVKASKDVILKNITETYLKSPVK DEWKTLCNTCKSLNYKLVAYFISHENHLFECNISIEDFPFGFGGKFPTRKEAGIFTAKSFIEKYNCSNTGVAIESSGDTGEENAAIYKKIAIFSKKYPYQNYWEALSSACRMLDYKIQKTVTEENDDFCCRFSIKNDVINLTGRGKSDKKASINAARQFIDKYYETKDSPFNPSASQQLDQKLLPKIFVCEPDFVNQKIHNDAYKGVYFLTY
Sbjct:    1 MHIKLNPIFISSKKENKCRFYLNNFYFPNEGVGKTQSEANCNAVEKFLNTFINISKISSTTDCILNNHDVRFEVVSKAETQKITNQNGNLPLKDKKIVNLADMILSKFTRDLWKVLNECCAITKINFIPKFIRCDDQFCCSFLFDEIKFEQHIESYCRIESGRKLAEAFIKEYASSYDEYLDKIDRLFTLVAAECKQSKRVNINDILSKQCEDLNIEVYKQFSQISNVFHCKINLNHKPCQITGVGVTEEAALNSAIEILFVKFFSPQMFAKIQNWKNFNKIAKFCSSNKFSDEWKSLCNSCLLLGFKRHERFTESDGIFSLAFFIENENCEIIGSGTSRNEAGIRLSKLFVEKYLDLKKLFIEFIANLDDKEFYFFVITLCVDKFWLNNWQVLSEVCSKFKINLTKHMQSVNFNRFRCSMNIGIHHYDNSITLADQDLAFNLLANQFFSKYSDKQLSGDEVKKILKEINSANSSTAINDKSLIGDVSLSRLEIFHKIATFCKFNQKSDDWKTLCNACKSLNYNIYERFINLDSKILCEIYIDNESINITEISSTRKQAACSLARKFVDRYQHGNTTVKASKDVILKNITETYLKSPVKSDEWKTLCNTCKSLNYKLVAYFISHENHLFECNISIEDFPFGFGGKFPTRKEAGIFTAKSFIEKYNCSNTGVAIESSGDTGEENAAIYKKIAIFSKKYPYQNYWEALSSACRMLDYKIQKTVTEENDDFCCRFSIKNDVINLTGRGKSDKKASINAARQFIDKYYETKDSPFNPSASQQLDQKLLPKIFVCEPDFVNQKIHNDAYKGVYFLTY 812          

HSP 2 Score: 61.6178 bits (148), Expect = 4.161e-9
Identity = 90/401 (22.44%), Postives = 150/401 (37.41%), Query Frame = 3
Query: 1500 NNWQKLNLVCKAMHIKLNPIFISSKKENKCRFYLNNFYFPNEGVGKTQSEANCNAVEKFLNTFVNISKISSTTDYILNNHDVRFEVVSKAETQKITNQNGNLPLKDKKIVNLADMILSKF--------------TRDLWKVLNECCAITKINFIPKFIRCDDQFCCSFLFDEIKFEQHIESYCRIESGRKLAEAFIKEYA-------SSYDEYLDKIDRLFTLVAAECKQSKRVNINDILSKQCEDLNIEVYKQF-SQISNVFHCKINLNHKPCQITGVGVTEEAALNSAIEILFVKFFSPQMFAKI--------QNWKNFNKIAKFCSSNKFSDEWKSLCNSCLLLGFKRHERFTESDGIFSLAFFIENENCEIIGSGTSRNEAGIRLSKLFVEKYLDLK 2612
            NNWQ L+ VC    I L    + S   N+ R  +      N G+    +       +   N   N    S  +D  L+  +V      K   ++I + N +  + DK ++   D+ LS+                 D WK L   C     N   +FI  D +  C    D         S  R ++   LA  F+  Y        +S D  L  I   +     +  + K       L   C+ LN ++   F S  +++F C I++   P    G   T + A     +    K+        I        +N   + KIA F     + + W++L ++C +L +K  +  TE +  F   F I+N+   + G G S  +A I  ++ F++KY + K
Sbjct:  389 NNWQVLSEVCSKFKINLTK-HMQSVNFNRFRCSM------NIGIHHYDNSITLADQDLAFNLLAN-QFFSKYSDKQLSGDEV------KKILKEINSANSSTAINDKSLI--GDVSLSRLEIFHKIATFCKFNQKSDDWKTLCNACKSLNYNIYERFINLDSKILCEIYIDNESINITEISSTRKQAACSLARKFVDRYQHGNTTVKASKDVILKNITETYLKSPVKSDEWK------TLCNTCKSLNYKLVAYFISHENHLFECNISIEDFPFGFGGKFPTRKEAGIFTAKSFIEKYNCSNTGVAIESSGDTGEENAAIYKKIAIFSKKYPYQNYWEALSSACRMLDYKIQKTVTEENDDFCCRFSIKNDVINLTGRGKSDKKASINAARQFIDKYYETK 767          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000016741.1 (SMESG000016741.1)

HSP 1 Score: 958.362 bits (2476), Expect = 0.000e+0
Identity = 481/547 (87.93%), Postives = 488/547 (89.21%), Query Frame = 3
Query:   93 MSQDVQQDDLELFHQAIRTGNVDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALE--ILRINGNNNWQKLNLVC--KAMHIKLNPIFISSKKENKCRFYLNNFYFPNEGVGKTQSEANCNAV---EKFLNTFVNISKISS 1712
            MSQDVQQDDLELFHQAIRTGNVDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKI  E   LR         +NL C  +  H K  P  + SK   K  F          G GK      C +    +KF   F+  S I +
Sbjct:    1 MSQDVQQDDLELFHQAIRTGNVDDFNKYFKEEFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIFREEISLRKLIEEMASSMNLKCSLRCTH-KFCPFSLHSKTFEKGTFI---------GKGKFGKVYRCQSSQTEQKFAVKFIKSSFIPT 537          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000017196.1 (SMESG000017196.1)

HSP 1 Score: 330.487 bits (846), Expect = 1.010e-96
Identity = 183/465 (39.35%), Postives = 274/465 (58.92%), Query Frame = 3
Query:  114 DDLELFHQAIRTGNVDDFNKYFKEEFLEKEQFGR-RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENW---RPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACK--HNDASK----------AGDNY-------------VEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS 1421
            ++ +LF ++IR+G+ + F+KYFKEEFLE+E   R RP+H+A   G ++I+KLL+D +CDI+A  +   R IH+ACR  H+++ +LLI   C+IE  D   LRPIHHA R G   IV  LI   C+IEA D++ WRPIH+A    Q  I  +L+  +CDIE  +++NW    P+H AC  GH EI+ +L+    D+ A+ +  W PIH AC  ++ +I   L++   ++E+G   K RPIH+AC     ++ +LLID  C+IE+ +   WRPIH+A    H  +V++LI+  CD+EA    + RPIH+AC   H +A K          A D +             +E   LLI+ +C I   ++S  SP+++A+  GNEE+I+++           G  LL A   G+++K    +     I  CDK   RPIHWAC  G+IE+VKLL+K+ C++ I DK + S
Sbjct:    3 EEFQLFTESIRSGSAELFHKYFKEEFLEREGIERVRPIHHACSAGHIDIVKLLIDHNCDIEAIDALGLRPIHHACRIGHTEIVKLLIDHFCDIEALDALGLRPIHHACRIGHTEIVKLLIDHYCDIEACDESGWRPIHHATNKGQTGIVKLLIDCHCDIE--SRDNWWNRMPIHHACSVGHIEIVKLLIDHHCDVEARDNSGWRPIHHACKEKFIDIIKLLIDHHCDIEAGDEWKRRPIHYACREEYIELVKLLIDHHCNIEASDRSGWRPIHYACMARHIEIVKLLIDYHCDIEALDRWKRRPIHYACSADHKEAVKLLITHHCDIEAFDEWGWRPIHHACHLGSIETVNLLIDYHCDIGALDKSGNSPIEIAVRYGNEEIIHVLI----------GPCLLLACTNGDLEKVSKFLNGS-TIEYCDKVQRRPIHWACESGNIELVKLLIKSKCKITIKDKSDLS 454          

HSP 2 Score: 202.986 bits (515), Expect = 1.337e-53
Identity = 115/349 (32.95%), Postives = 172/349 (49.28%), Query Frame = 3
Query:  207 FGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDK-------------------GCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEKL 1196
            + R P+H+A   G +EI+KLL+D HCD++AR +  WR IH+AC+E   D+ +LLI   C+IE  D    RPIH+A R   + +V  LI   CNIEA D++ WRPIHYAC     EI  +L+  +CDIEA  +   RP+H+AC   H E + +L+    D+ A     W PIH AC+       + L++   ++ +       PI  A   GN +I  +LI                     G  IE C++   RPIH+A   G+  LV++LI +KC                                         +I ++++S  SPLD+A  N N+E++ +IK+ +
Sbjct:  168 WNRMPIHHACSVGHIEIVKLLIDHHCDVEARDNSGWRPIHHACKEKFIDIIKLLIDHHCDIEAGDEWKRRPIHYACREEYIELVKLLIDHHCNIEASDRSGWRPIHYACMARHIEIVKLLIDYHCDIEALDRWKRRPIHYACSADHKEAVKLLITHHCDIEAFDEWGWRPIHHACHLGSIETVNLLIDYHCDIGALDKSGNSPIEIAVRYGNEEIIHVLIGPCLLLACTNGDLEKVSKFLNGSTIEYCDKVQRRPIHWACESGNIELVKLLIKSKC-----------------------------------------KITIKDKSDLSPLDIARRNDNKELVQVIKDAI 475          

HSP 3 Score: 135.191 bits (339), Expect = 7.580e-32
Identity = 83/264 (31.44%), Postives = 140/264 (53.03%), Query Frame = 3
Query:  801 DKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE---KLEN-PNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKIALEI-----LRINGNNNWQKLNLVCKAMHIKLNPIFI 1565
            +++RPIH AC  G+  I +LLID  CDIE+ +    RPIH A R GH  +V++LI+  CD+EA     +RPIH AC+          + EI  LLI+  C I   +ES   P+  A   G   ++ L+ +    +E+  N  N   +  A   G+I+  +++I   CD+   D    RPIH AC +  I+I+KLL+ ++C+++  D++ R  + +    ++E +  + L I     +  +  + W+ ++  C A HI++  + I
Sbjct:   35 ERVRPIHHACSAGHIDIVKLLIDHNCDIEAIDALGLRPIHHACRIGHTEIVKLLIDHFCDIEALDALGLRPIHHACR--------IGHTEIVKLLIDHYCDIEACDESGWRPIHHATNKGQTGIVKLLIDCHCDIESRDNWWNRMPIHHACSVGHIEIVKLLIDHHCDVEARDNSGWRPIHHACKEKFIDIIKLLIDHHCDIEAGDEWKR--RPIHYACREEYIELVKLLIDHHCNIEASDRSGWRPIHYACMARHIEIVKLLI 288          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000017260.1 (SMESG000017260.1)

HSP 1 Score: 328.561 bits (841), Expect = 9.506e-96
Identity = 180/488 (36.89%), Postives = 270/488 (55.33%), Query Frame = 3
Query:  114 DDLELFHQAIRTGNVDDFNKYFKEEFLEKE------------------------------------QFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKEK---LENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEEL 1460
            D+ ELF  A++ G+ + FNKYFKE++LE+                                      F R P+H   + GQ + +KLL+D  CDI+A    NWRAIH+AC E H+D+ ++LI +KCN E C     RPIH A   G   IV  LI + C+ EA D+N+ RPIH+AC+    E+  +L+ + C++EAC K N RP+H AC  GH +I+ +L+ +  +++A    +  PIH AC+  +  I   L  +  N+E+      RPIHFAC  G  +I  +LI K CDIE+  ++N RPIH A   GH  +VE+LIN KCD+EA   D  R IH AC+          Y +IA LLI+ NC I V ++  + P+  A E G+ E++ L+ +    +E  +  N   +  AS+ G+++  ++++ +KCDI  C +++ R IH AC KGH EIVKLL++ +C  + +     S   +    KK+E+
Sbjct:    2 DEFELFISAVKAGSKELFNKYFKEKYLEQRFGIFQWLPIHLACEEGQAEIAEMLLTRKCNVDALAGLFNRCPIHLVCQKGQADFVKLLIDYKCDIEACDLKNWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACE--------KGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEI 481          

HSP 2 Score: 267.314 bits (682), Expect = 9.609e-75
Identity = 134/325 (41.23%), Postives = 195/325 (60.00%), Query Frame = 3
Query:  216 RPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE 1190
            RP+H+A + G  E++KLL+++ C+++A   +N R +H AC + H+D+  LLI +KCNI+  D +  RPIH A   G L IV +L  + CNIEA ++ +WRPIH+AC   Q EI  IL+ K CDIEA  K+N RP+H AC  GH EI+ +L+    D+ A     W  IH AC   Y +IA  L++   ++E       RPIH+AC  G+ +I QLLID  C+IE+C++ N RPIH+AS  GH    ++L+  KCD+EA   ++ R IH AC+   A        EI  LL+  +C          SP+ LA ++  +E+I L+K+
Sbjct:  171 RPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHA--------EIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQ 487          

HSP 3 Score: 182.956 bits (463), Expect = 5.911e-47
Identity = 93/254 (36.61%), Postives = 142/254 (55.91%), Query Frame = 3
Query:  201 EQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEML 962
            +Q   RP+H A   G L+I+K L ++ C+I+A +  NWR IH+AC +   ++  +LI KKC+IE  +   LRPIH A   G   IV  LI   C+IEA D + WR IH AC     +IA +L+  NCDIE C + + RP+H+AC  GH EI+ +L+    ++ A    N  PIH+A    +      L+ K  ++E+   ++ R IH AC  G+ +I +LL+   C+ E+   +   PI  A +     ++E+L
Sbjct:  232 DQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEAPEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELL 485          

HSP 4 Score: 118.627 bits (296), Expect = 1.338e-26
Identity = 63/169 (37.28%), Postives = 91/169 (53.85%), Query Frame = 3
Query:  210 GRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSP 716
            G R +H A   G  +I +LL+D +CDI+     + R IHYAC   H+++ +LLI   CNIE CD    RPIH+AS  G +     L+ K C+IEA  +N+ R IH AC     EI  +LV+ +C+ EA T +   P+  A +    EI+ +L   P    +   Q+  P
Sbjct:  334 GWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSDVMQDEIP 502          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 327.405 bits (838), Expect = 7.621e-95
Identity = 191/502 (38.05%), Postives = 276/502 (54.98%), Query Frame = 3
Query:  114 DDLELFHQAIRTGNVDDFNKYFKEEFLEKEQFG-RRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE---KLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRS------LQSVVSGLKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKENKC 1589
            ++ +LF  AI++G+ + F +YFKEEFLE++    RRP+H+A   G  EI+KLL++  CDI+A   DNWR IH AC + HS+  +LLI+ KC+IE  D    RPIH A   G    V  LI   C+IEA DK + RPIH +C     E   +L++  CDIEA  K NWRP+H +C  GH+E + +L+    D+ A   +N  PIH AC   +      L+E   ++E+      RPIH AC  G+ +  +LLI+  CDIE+ +++  RPIH A   GH   V++LI  KCD+EA    + RPIH AC           + E   LLIE  C I V +E  + P+ LA + G+ E + L+ E    +E  +  N   +  A  +G+    +++I  KCDI   D+   RPIH ACI+GH E VKLL++N C+++ +DK+N+        Q     +K    NK  +E L      N + ++L C   H +   + I    ENKC
Sbjct:    3 EEFKLFINAIKSGSAELFRRYFKEEFLERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQ--------GHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEAL---DERNQRPIHLACDQGHSEAVKLLI----ENKC 489          

HSP 2 Score: 276.559 bits (706), Expect = 1.636e-77
Identity = 159/422 (37.68%), Postives = 220/422 (52.13%), Query Frame = 3
Query:  213 RRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE---KLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCDINICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSGLKKEELNKI 1469
            RRP+H A   G  E +KLL++  CDI+A    N R IH AC + HS+  +LLI+ KC+IE  D    RPIH A   G    V  LI   C+IEA DK   RPIH AC     E   +L++  CDIE   + N RP+H AC  GH+E + +L+    D+ A    N  PIH AC+  +      L+E   ++E+    K RPIH AC+ G+ +  +LLI+  CDIE+ ++ N RPIH A   GH   V++LI  KCD+EA      RPIH AC           + E   LLIE  C I   ++  Q P+ LA + G+ E + L+ E    +E  +  N   +  A   G  +  +++I  KC I   DK + RPIH AC  GH +  KLL+++ CE+D  D+   S           E+ KI
Sbjct:  202 RRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQG--------HSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKI 615          

HSP 3 Score: 241.891 bits (616), Expect = 6.471e-66
Identity = 135/337 (40.06%), Postives = 189/337 (56.08%), Query Frame = 3
Query:  186 EFLEKEQFGRRPVHYASRHGQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIEECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNNQCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNAQTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGNFQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAPTLDQMRPIHFAC--KHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLDLALENGNEEVINLIKE 1190
            E L+K++  +RP+H A   G  E +KLL++  CDI+     N R IH AC + HS+  +LLI+ KC+IE  D    RPIH A   G    V  LI   C+IEA D+   RPIH+AC     E   +L++  CDIEA  K N RP+H AC  GH+E + +L+    D+ A   +N  PIH AC+  +      L+E   ++E+      RPIH AC  G+ +  +LLI+  CDIE+ +E N RPIH A  YG    V++LI  KC +EA      RPIH AC   H+ A K          LLIE  C+I+ ++ES  SP++ A++ GN E+I ++ E
Sbjct:  294 EALDKQK--QRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFK----------LLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNE 618          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK32.271e-4726.33ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK32.317e-4726.33ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK11.272e-4626.73ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK11.629e-4626.73ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK11.964e-4626.73ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.173e-4826.84AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.173e-4826.84AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.219e-4826.84AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.219e-4826.84AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.396e-4826.84AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank3.611e-5129.37gene:FBgn0011747 transcript:FBtr0089172[more]
Ank3.611e-5129.37gene:FBgn0011747 transcript:FBtr0300497[more]
Ank3.611e-5129.37gene:FBgn0011747 transcript:FBtr0089171[more]
Ank3.611e-5129.37gene:FBgn0011747 transcript:FBtr0089173[more]
Ank23.762e-4826.33gene:FBgn0261788 transcript:FBtr0303119[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX640476.14.061e-5026.52ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.14.550e-5026.52ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
ank1b5.577e-5026.26ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.044e-4926.26ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.156e-4926.26ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK12.917e-4828.11ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK14.138e-4828.11ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK14.181e-4828.11ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK15.080e-4828.11ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK15.189e-4828.11ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank34.952e-4826.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank36.017e-4826.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank37.702e-4826.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank39.052e-4826.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank39.866e-4826.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5E8K5|ANK3_MOUSE7.440e-4726.58Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|P16157|ANK1_HUMAN9.432e-4626.73Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|Q02357|ANK1_MOUSE1.905e-4426.98Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
sp|O70511|ANK3_RAT5.493e-4426.33Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q12955|ANK3_HUMAN2.400e-4326.33Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182GGY85.348e-6833.50ANK_REP_REGION domain-containing protein OS=Aedes ... [more]
Q16FI98.552e-6426.61AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
B3EU243.413e-6329.28Uncharacterized protein OS=Amoebophilus asiaticus ... [more]
A0A4Q4V3431.082e-6228.81Uncharacterized protein OS=Monosporascus sp. mg162... [more]
Q16FR12.568e-6225.64AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a4.961e-4927.87ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b3.730e-4827.05ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3b7.935e-4726.60ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a4.662e-4626.58ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ENSAMXT00000037173.18.213e-4625.41pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.11.322e-5328.24pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.386e-5328.35pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007446.12.229e-4526.33pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.16.698e-4426.32pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000003991.13.850e-3924.72pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAS68.277e-1325.79Evolutionarily conserved 19S regulatory particle a... [more]
AKR15.442e-823.11Palmitoyl transferase involved in protein palmitoy... [more]
PHO816.489e-826.99Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
AVO21.376e-726.20Component of a complex containing the Tor2p kinase... [more]
GDE11.595e-623.28Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460995.200e-1830.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494854.560e-1523.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473442.057e-1429.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387259.413e-1423.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387021.108e-1325.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b2.533e-4825.76ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a8.932e-4826.77ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000031565.11.906e-4326.08ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000039458.12.343e-4326.08ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000040233.11.041e-3924.88pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059823.14.161e-999.51SMESG000059823.1[more]
SMESG000016741.10.000e+087.93SMESG000016741.1[more]
SMESG000017196.11.010e-9639.35SMESG000017196.1[more]
SMESG000017260.19.506e-9636.89SMESG000017260.1[more]
SMESG000017277.17.621e-9538.05SMESG000017277.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029509 ID=SMED30029509|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4486bp
TTTTGGTGCTTTAATAAAATATATTGGAATATTTTTTATATGCTTACAGA
TTTATTTGAAATATAAATTTGATTTTTTATGACAAATTTGAAATGAGCCA
GGATGTTCAACAAGACGATTTGGAACTTTTCCATCAAGCAATTAGAACCG
GGAATGTAGATGATTTCAATAAATACTTCAAGGAAGAGTTTTTGGAAAAA
GAGCAGTTTGGTCGCCGTCCAGTTCATTATGCTAGCCGCCATGGGCAATT
AGAAATTCTTAAGTTATTGCTTGACAAGCATTGCGACATTGATGCCCGAT
CTTCGGACAATTGGAGAGCAATTCATTACGCGTGCAGAGAATCGCACAGT
GATGTTGCAGAGTTGTTGATCAAAAAGAAGTGCAACATTGAAGAATGTGA
TGGAGATCTCTTGCGTCCAATTCATCATGCAAGTCGTTATGGTCTTTTGA
ATATTGTAACGTCATTAATTGGCAAAAGTTGTAATATAGAAGCGAAGGAT
AAGAATGATTGGCGTCCTATACATTATGCTTGCCGTAACAATCAGTGCGA
AATAGCAACAATACTTGTAAAAAAGAACTGTGATATTGAGGCATGCACCA
AAGAAAACTGGCGTCCAGTCCATTTTGCGTGCCGATATGGTCACGCGGAA
ATCCTTAATATACTAATGGCTAAACCCTTAGATTTGAATGCTCAAACCTC
GCAAAATTGGTCTCCGATTCATTTTGCGTGCAATTATGAATATGAGAATA
TTGCCAGCACATTACTTGAAAAAGGAGTCAACGTTGAATCCGGAACTTCT
GATAAAATGCGGCCTATTCATTTTGCTTGTTTAAACGGTAACTTTCAAAT
TGCGCAACTTTTAATTGATAAAGGCTGCGACATTGAGTCCTGTAATGAAG
AAAATTGGCGCCCAATTCATTTTGCCTCCCGTTACGGCCATTTCACTCTA
GTAGAAATGTTAATAAATGCCAAATGTGACATGGAAGCACCCACATTGGA
TCAAATGAGACCGATACACTTTGCTTGCAAGCATAATGATGCCTCCAAGG
CGGGGGATAATTATGTTGAAATTGCTGCTTTACTAATCGAGAGAAACTGT
CAAATCAACGTACAAAATGAGTCAAAACAATCGCCGTTGGATCTTGCCCT
TGAAAATGGAAACGAGGAGGTGATCAATCTCATTAAAGAAAAACTTGAAA
ATCCGAATATGACGAATGGCCATCGACTTCTTTCAGCAAGTCAAGAAGGA
AATATAAAGAAAGCAGAGGTAATGATTCGGAGAAAATGTGATATTAATAT
TTGTGATAAAGATGACATGAGGCCCATCCACTGGGCATGTATAAAAGGTC
ATATTGAAATCGTGAAGTTGCTGCTAAAAAATAACTGTGAACTTGATATA
ATAGATAAATTTAACAGATCTCTCCAGTCAGTTGTCAGTGGATTGAAAAA
AGAAGAATTAAATAAAATTGCTCTGGAAATTTTAAGAATTAATGGCAATA
ATAATTGGCAAAAATTAAATCTAGTCTGTAAAGCAATGCACATTAAACTG
AATCCAATTTTTATTTCTTCTAAAAAAGAAAATAAATGTCGGTTTTATTT
GAATAATTTTTATTTCCCTAATGAAGGTGTTGGTAAAACTCAATCCGAAG
CTAATTGCAATGCTGTGGAAAAGTTTTTAAATACATTTGTTAATATTTCA
AAAATTTCTTCTACGACTGATTATATTTTGAATAATCATGATGTGCGTTT
TGAAGTGGTTTCTAAAGCAGAAACTCAGAAAATTACTAATCAAAACGGAA
ATCTTCCTTTGAAGGATAAAAAAATAGTGAATCTTGCTGATATGATTCTA
TCCAAGTTTACTAGAGATTTGTGGAAGGTTTTGAATGAATGCTGCGCCAT
CACTAAGATCAATTTCATTCCTAAATTTATCAGATGTGATGACCAATTTT
GTTGCTCATTTTTGTTTGATGAAATTAAATTTGAGCAGCATATTGAAAGT
TATTGTCGAATCGAGTCCGGTAGAAAGTTAGCTGAAGCTTTTATTAAAGA
ATATGCATCGAGTTATGACGAGTACCTCGACAAAATAGATCGGCTATTTA
CTTTAGTAGCTGCTGAGTGCAAACAATCGAAACGTGTTAATATCAACGAC
ATATTGTCAAAACAGTGTGAAGATTTGAACATTGAAGTTTACAAACAATT
CAGTCAAATTTCAAATGTATTCCATTGTAAAATAAATTTGAATCATAAAC
CGTGCCAGATTACCGGAGTTGGGGTCACTGAAGAGGCGGCACTCAATTCG
GCAATTGAAATTTTATTTGTAAAATTCTTTTCACCACAGATGTTTGCAAA
AATCCAAAACTGGAAAAATTTCAATAAGATCGCAAAATTTTGCTCGTCTA
ATAAATTTTCTGATGAATGGAAATCTTTATGCAATTCGTGCTTGCTATTG
GGTTTCAAACGCCATGAACGTTTTACTGAATCTGATGGCATTTTTTCGCT
GGCATTTTTCATTGAAAATGAAAATTGTGAAATAATCGGTTCTGGCACGT
CGAGGAATGAAGCGGGTATTCGTCTGAGCAAATTGTTTGTTGAAAAATAT
CTCGATTTAAAAAAATTATTTATCGAGTTTATTGCTAATCTGGACGATAA
AGAATTCTATTTCTTCGTGATAACTTTATGTGTGGATAAATTTTGGTTAA
ATAACTGGCAGGTTTTGTCGGAGGTTTGTTCCAAATTTAAGATCAATCTT
ACGAAACATATGCAAAGTGTGAATTTTAACCGATTTCGATGTTCTATGAA
TATTGGCATTCACCATTATGATAACTCTATTACTTTAGCTGATCAAGATT
TAGCTTTCAATCTCTTAGCCAATCAATTTTTTTCTAAATATAGTGATAAA
CAGCTTTCTGGAGATGAAGTGAAGAAAATTTTGAAGGAAATCAATTCTGC
TAATTCTTCTACTGCAATTAATGATAAGTCACTTATTGGCGATGTTTCTC
TATCAAGACTGGAAATTTTTCATAAAATTGCCACATTTTGCAGGTTTAAC
CAGAAAAGTGATGATTGGAAAACTCTTTGCAACGCCTGTAAATCTTTAAA
CTATAATATCTATGAGCGATTTATAAATCTTGATTCCAAAATTCTGTGTG
AAATCTACATTGATAATGAATCTATTAATATCACTGAAATATCTTCCACC
CGTAAGCAAGCTGCCTGTTCACTAGCGAGAAAATTTGTTGACCGCTATCA
GCATGGCAATACAACTGTCAAAGCCAGTAAAGATGTAATATTGAAAAATA
TTACGGAAACTTATTTGAAAAGTCCAGTGAAAGGTGATGAATGGAAAACA
TTATGTAATACTTGCAAATCATTGAATTATAAGCTGGTTGCATACTTTAT
ATCGCACGAGAATCATCTATTCGAATGTAATATATCAATTGAGGATTTCC
CATTCGGATTCGGAGGGAAATTTCCAACTCGTAAAGAAGCGGGAATATTT
ACTGCAAAATCATTTATCGAAAAATATAATTGCTCCAATACTGGTGTCGC
TATTGAATCGAGTGGTGATACAGGCGAAGAGAATGCAGCAATTTATAAGA
AAATCGCAATTTTTTCTAAAAAATATCCTTATCAAAACTATTGGGAAGCC
CTATCTAGTGCTTGTCGAATGCTTGATTATAAAATCCAAAAAACTGTCAC
AGAAGAAAATGACGATTTTTGTTGTCGTTTCTCAATTAAAAATGATGTTA
TTAATTTGACTGGGCGTGGGAAATCAGATAAGAAAGCTTCAATAAATGCT
GCTCGTCAATTTATTGACAAATACTATGAGACGAAAGATTCTCCCTTCAA
CCCAAGTGCATCTCAACAATTAGACCAAAAATTACTTCCTAAAATCTTTG
TGTGCGAACCGGATTTTGTTAATCAGAAAATTCATAATGATGCATATAAA
GGAGTGTATTTTTTGACTTACTAAAATTTTATGTGTATTTAAATGAAATA
AATGCTATTTGTCTTATTTTGTTTAAATAATCCTATTATTTTGATCAATT
GATTTTAAAAATGTTGTCTTCTAAAGATGAAGTTGACTATGAGTATGAAG
CTGAACTTGTTTGGTGTATAAAGTATTTAGAAAAAGAATTAATTTACGAT
ATGTCTAAAGTTCGAGAAAAAACTGCAAATAATAATGCTGAAAAAAGAAT
AAAATCTATTCAAAATGCCATAAAAATTTTATCTAATCCAAAGTTAACAA
AAATCAAAAAACGGGCGACAATGAAATCTATGTGTTCGGATTATCGAGAC
AAGATGAGAAGTGAAATTAATAAGAAGTCGATTAAAAATGAAATATCTAA
TGCTGTTATTATACCGAAAAGTAAAGCTATCAGAAAATCAACTAAGATTA
ATTCTCAATCAAAAGAAGATATTGACACCAAAGAATTCAAATTTATATTT
TGATTCTAATATATACTGCTTTCATTTGAAAAAAAA
back to top

protein sequence of SMED30029509-orf-1

>SMED30029509-orf-1 ID=SMED30029509-orf-1|Name=SMED30029509-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1294bp
MSQDVQQDDLELFHQAIRTGNVDDFNKYFKEEFLEKEQFGRRPVHYASRH
GQLEILKLLLDKHCDIDARSSDNWRAIHYACRESHSDVAELLIKKKCNIE
ECDGDLLRPIHHASRYGLLNIVTSLIGKSCNIEAKDKNDWRPIHYACRNN
QCEIATILVKKNCDIEACTKENWRPVHFACRYGHAEILNILMAKPLDLNA
QTSQNWSPIHFACNYEYENIASTLLEKGVNVESGTSDKMRPIHFACLNGN
FQIAQLLIDKGCDIESCNEENWRPIHFASRYGHFTLVEMLINAKCDMEAP
TLDQMRPIHFACKHNDASKAGDNYVEIAALLIERNCQINVQNESKQSPLD
LALENGNEEVINLIKEKLENPNMTNGHRLLSASQEGNIKKAEVMIRRKCD
INICDKDDMRPIHWACIKGHIEIVKLLLKNNCELDIIDKFNRSLQSVVSG
LKKEELNKIALEILRINGNNNWQKLNLVCKAMHIKLNPIFISSKKENKCR
FYLNNFYFPNEGVGKTQSEANCNAVEKFLNTFVNISKISSTTDYILNNHD
VRFEVVSKAETQKITNQNGNLPLKDKKIVNLADMILSKFTRDLWKVLNEC
CAITKINFIPKFIRCDDQFCCSFLFDEIKFEQHIESYCRIESGRKLAEAF
IKEYASSYDEYLDKIDRLFTLVAAECKQSKRVNINDILSKQCEDLNIEVY
KQFSQISNVFHCKINLNHKPCQITGVGVTEEAALNSAIEILFVKFFSPQM
FAKIQNWKNFNKIAKFCSSNKFSDEWKSLCNSCLLLGFKRHERFTESDGI
FSLAFFIENENCEIIGSGTSRNEAGIRLSKLFVEKYLDLKKLFIEFIANL
DDKEFYFFVITLCVDKFWLNNWQVLSEVCSKFKINLTKHMQSVNFNRFRC
SMNIGIHHYDNSITLADQDLAFNLLANQFFSKYSDKQLSGDEVKKILKEI
NSANSSTAINDKSLIGDVSLSRLEIFHKIATFCRFNQKSDDWKTLCNACK
SLNYNIYERFINLDSKILCEIYIDNESINITEISSTRKQAACSLARKFVD
RYQHGNTTVKASKDVILKNITETYLKSPVKGDEWKTLCNTCKSLNYKLVA
YFISHENHLFECNISIEDFPFGFGGKFPTRKEAGIFTAKSFIEKYNCSNT
GVAIESSGDTGEENAAIYKKIAIFSKKYPYQNYWEALSSACRMLDYKIQK
TVTEENDDFCCRFSIKNDVINLTGRGKSDKKASINAARQFIDKYYETKDS
PFNPSASQQLDQKLLPKIFVCEPDFVNQKIHNDAYKGVYFLTY*
back to top

protein sequence of SMED30029509-orf-2

>SMED30029509-orf-2 ID=SMED30029509-orf-2|Name=SMED30029509-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MLSSKDEVDYEYEAELVWCIKYLEKELIYDMSKVREKTANNNAEKRIKSI
QNAIKILSNPKLTKIKKRATMKSMCSDYRDKMRSEINKKSIKNEISNAVI
IPKSKAIRKSTKINSQSKEDIDTKEFKFIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR029274DUF4615
IPR002110Ankyrin_rpt
IPR014720dsRBD_dom
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 204..233
e-value: 0.12
score: 21.5
coord: 303..340
e-value: 5.5
score: 16.0
coord: 407..436
e-value: 1.9E-4
score: 30.7
coord: 270..299
e-value: 0.94
score: 18.5
coord: 39..68
e-value: 3.4E-4
score: 29.9
coord: 105..134
e-value: 78.0
score: 12.1
coord: 171..200
e-value: 0.14
score: 21.2
coord: 138..167
e-value: 0.094
score: 21.8
coord: 344..373
e-value: 0.97
score: 18.5
coord: 72..101
e-value: 0.054
score: 22.6
coord: 237..266
e-value: 0.02
score: 24.1
coord: 374..403
e-value: 1100.0
score: 4.8
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 204..236
score: 9.19
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 39..71
score: 12.182
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 407..439
score: 11.434
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 171..203
score: 9.698
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 237..269
score: 11.06
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 270..302
score: 8.71
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 365..449
e-value: 2.4E-15
score: 58.3
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 2..320
e-value: 1.4E-82
score: 279.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 37..366
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 378..442
NoneNo IPR availableGENE3DG3DSA:1.25.40.960coord: 321..364
e-value: 4.6E-8
score: 34.9
NoneNo IPR availablePFAMPF13637Ank_4coord: 379..428
e-value: 8.4E-7
score: 29.4
NoneNo IPR availablePANTHERPTHR24126FAMILY NOT NAMEDcoord: 379..441
coord: 134..233
coord: 167..264
coord: 236..364
coord: 10..169
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 143..232
e-value: 2.0E-14
score: 53.9
coord: 242..342
e-value: 1.8E-12
score: 47.7
coord: 13..100
e-value: 1.0E-12
score: 48.4
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 39..439
score: 85.184