60S ribosomal protein L12

Overview
Name60S ribosomal protein L12
Smed IDSMED30029507
Length (bp)620
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L12 (SMED30029507) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L12 (SMED30029507) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L12 (SMED30029507) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L12 (SMED30029507) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029507

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029507SMESG000006898.1 SmedASXL_004160SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30029507SMESG000006898.1 dd_Smed_v4_259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029507SMESG000006898.1 Contig47679newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029507SMESG000006898.1 Contig47679uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029507SMESG000006898.1 Contig32697newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029507SMESG000006898.1 Contig32697uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30029507SMESG000006898.1 dd_Smed_v6_259_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L12 vs. Ensembl Human
Match: RPL12 (ribosomal protein L12 [Source:HGNC Symbol;Acc:HGNC:10302])

HSP 1 Score: 222.631 bits (566), Expect = 3.986e-74
Identity = 103/160 (64.38%), Postives = 126/160 (78.75%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            M PK DP  I  VYLR  GGEVGA ++LAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA++ VVP+A++L++K LKEP RDRKK KNIKH GN+ FD ++ IA+ MR RS  + L  T+KEILGTA+S+GC +D   P  II+ +N G +
Sbjct:    1 MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAV 160          
BLAST of 60S ribosomal protein L12 vs. Ensembl Human
Match: RPL12 (ribosomal protein L12 [Source:HGNC Symbol;Acc:HGNC:10302])

HSP 1 Score: 145.206 bits (365), Expect = 3.825e-44
Identity = 73/160 (45.62%), Postives = 94/160 (58.75%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            M PK DP  I  VYLR  GGEVGA ++LAPK+GPLGL                                 + VVP+A++L++K LKEP RDRKK KNIKH GN+ FD ++ IA+ MR RS  + L  T+KEILGTA+S+GC +D   P  II+ +N G +
Sbjct:    1 MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGL---------------------------------IEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAV 127          
BLAST of 60S ribosomal protein L12 vs. Ensembl Celegans
Match: rpl-12 (60S ribosomal protein L12 [Source:UniProtKB/Swiss-Prot;Acc:P61866])

HSP 1 Score: 230.335 bits (586), Expect = 1.008e-77
Identity = 108/162 (66.67%), Postives = 135/162 (83.33%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DPT I  VYLR VGGEVGA ++LAPK+GPLGLSPKK+G+DIAKAT +WKGL++T KLTIQNR A++ VVP+AASL+VKELKEP RDRKKVKN+KH+G++  D +I+IA++MRPRS  K L+ TVKEILGTA+S+GCTID + P  IIE +  G+I +
Sbjct:    1 MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKATQDWKGLKVTCKLTIQNRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVKHNGDLTVDTIIKIARIMRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEI 162          
BLAST of 60S ribosomal protein L12 vs. Ensembl Celegans
Match: rpl-12 (60S ribosomal protein L12 [Source:UniProtKB/Swiss-Prot;Acc:P61866])

HSP 1 Score: 62.003 bits (149), Expect = 3.749e-13
Identity = 28/47 (59.57%), Postives = 35/47 (74.47%), Query Frame = 1
Query:  433 MRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            MRPRS  K L+ TVKEILGTA+S+GCTID + P  IIE +  G+I +
Sbjct:    1 MRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEI 47          
BLAST of 60S ribosomal protein L12 vs. Ensembl Celegans
Match: rpl-12 (60S ribosomal protein L12 [Source:UniProtKB/Swiss-Prot;Acc:P61866])

HSP 1 Score: 62.003 bits (149), Expect = 3.749e-13
Identity = 28/47 (59.57%), Postives = 35/47 (74.47%), Query Frame = 1
Query:  433 MRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            MRPRS  K L+ TVKEILGTA+S+GCTID + P  IIE +  G+I +
Sbjct:    1 MRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEI 47          
BLAST of 60S ribosomal protein L12 vs. Ensembl Celegans
Match: rpl-12 (60S ribosomal protein L12 [Source:UniProtKB/Swiss-Prot;Acc:P61866])

HSP 1 Score: 62.003 bits (149), Expect = 3.749e-13
Identity = 28/47 (59.57%), Postives = 35/47 (74.47%), Query Frame = 1
Query:  433 MRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            MRPRS  K L+ TVKEILGTA+S+GCTID + P  IIE +  G+I +
Sbjct:    1 MRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEI 47          
BLAST of 60S ribosomal protein L12 vs. Ensembl Celegans
Match: rpl-12 (60S ribosomal protein L12 [Source:UniProtKB/Swiss-Prot;Acc:P61866])

HSP 1 Score: 62.003 bits (149), Expect = 3.749e-13
Identity = 28/47 (59.57%), Postives = 35/47 (74.47%), Query Frame = 1
Query:  433 MRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            MRPRS  K L+ TVKEILGTA+S+GCTID + P  IIE +  G+I +
Sbjct:    1 MRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEI 47          
BLAST of 60S ribosomal protein L12 vs. Ensembl Fly
Match: RpL12 (gene:FBgn0034968 transcript:FBtr0072175)

HSP 1 Score: 235.343 bits (599), Expect = 1.425e-79
Identity = 109/162 (67.28%), Postives = 135/162 (83.33%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DPT +  VYLR VGGEVGA +SLAPK+GPLGLSPKK+GDDIAKAT++WKGL+ITV LTIQNRQA +SVVP+AASL++K LKEP RDRKK KNIKH GN+ F+ ++ IA+VMRPRS  + L+ T KE+LGTA+S+GCT+D + P  +I++LNEG I V
Sbjct:    1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEV 162          
BLAST of 60S ribosomal protein L12 vs. Ensembl Fly
Match: RpL12 (gene:FBgn0034968 transcript:FBtr0072176)

HSP 1 Score: 235.343 bits (599), Expect = 1.425e-79
Identity = 109/162 (67.28%), Postives = 135/162 (83.33%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DPT +  VYLR VGGEVGA +SLAPK+GPLGLSPKK+GDDIAKAT++WKGL+ITV LTIQNRQA +SVVP+AASL++K LKEP RDRKK KNIKH GN+ F+ ++ IA+VMRPRS  + L+ T KE+LGTA+S+GCT+D + P  +I++LNEG I V
Sbjct:    1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEV 162          
BLAST of 60S ribosomal protein L12 vs. Ensembl Fly
Match: RpL12 (gene:FBgn0034968 transcript:FBtr0072174)

HSP 1 Score: 235.343 bits (599), Expect = 1.425e-79
Identity = 109/162 (67.28%), Postives = 135/162 (83.33%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DPT +  VYLR VGGEVGA +SLAPK+GPLGLSPKK+GDDIAKAT++WKGL+ITV LTIQNRQA +SVVP+AASL++K LKEP RDRKK KNIKH GN+ F+ ++ IA+VMRPRS  + L+ T KE+LGTA+S+GCT+D + P  +I++LNEG I V
Sbjct:    1 MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEV 162          
BLAST of 60S ribosomal protein L12 vs. Ensembl Zebrafish
Match: rpl12 (ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-030131-5297])

HSP 1 Score: 225.328 bits (573), Expect = 2.070e-75
Identity = 105/159 (66.04%), Postives = 127/159 (79.87%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQ 564
            M PK DP  I  V++R  GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L  T+KEILGTA+S+GCTID   P  +I+ +N G 
Sbjct:    1 MPPKFDPNEIKVVFMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVAFDEIVNIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGRLPHDVIDDINSGH 159          
BLAST of 60S ribosomal protein L12 vs. Ensembl Zebrafish
Match: rpl12 (ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-030131-5297])

HSP 1 Score: 224.942 bits (572), Expect = 2.784e-75
Identity = 105/160 (65.62%), Postives = 128/160 (80.00%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            M PK DP  I  V++R  GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L  T+KEILGTA+S+GCTID   P  +I+ +N G +
Sbjct:    1 MPPKFDPNEIKVVFMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVAFDEIVNIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGRLPHDVIDDINSGAV 160          
BLAST of 60S ribosomal protein L12 vs. Ensembl Zebrafish
Match: rpl12 (ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-030131-5297])

HSP 1 Score: 224.557 bits (571), Expect = 3.618e-75
Identity = 105/160 (65.62%), Postives = 128/160 (80.00%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            M PK DP  I  V++R  GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L  T+KEILGTA+S+GCTID   P  +I+ +N G +
Sbjct:    1 MPPKFDPNEIKVVFMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVAFDEIVNIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGRLPHDVIDDINSGAV 160          
BLAST of 60S ribosomal protein L12 vs. Ensembl Zebrafish
Match: rpl12 (ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-030131-5297])

HSP 1 Score: 224.172 bits (570), Expect = 8.627e-75
Identity = 107/172 (62.21%), Postives = 132/172 (76.74%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV*YFNIIYWIF 603
            M PK DP  I  V++R  GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L  T+KEILGTA+S+GCTID   P  +I+ +N G +     +I+  I 
Sbjct:    1 MPPKFDPNEIKVVFMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVAFDEIVNIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGRLPHDVIDDINSGAVECPTVSIVPLIL 172          
BLAST of 60S ribosomal protein L12 vs. Ensembl Zebrafish
Match: rpl12 (ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-030131-5297])

HSP 1 Score: 224.172 bits (570), Expect = 8.627e-75
Identity = 107/172 (62.21%), Postives = 132/172 (76.74%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV*YFNIIYWIF 603
            M PK DP  I  V++R  GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L  T+KEILGTA+S+GCTID   P  +I+ +N G +     +I+  I 
Sbjct:    1 MPPKFDPNEIKVVFMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVAFDEIVNIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGRLPHDVIDDINSGAVECPTVSIVPLIL 172          
BLAST of 60S ribosomal protein L12 vs. Ensembl Xenopus
Match: RPL12 (ribosomal protein L12 [Source:HGNC Symbol;Acc:HGNC:10302])

HSP 1 Score: 133.265 bits (334), Expect = 1.241e-39
Identity = 68/123 (55.28%), Postives = 87/123 (70.73%), Query Frame = 1
Query:  199 SPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            SPKKVGDDIAKAT +WKGLRITVKLTIQNRQA+V++  N   LLV  +  P  D   +  +KH+GN++ D VI IA+ MR RS  + L  T+KEILGTA+S+GC +D   P  II+ +N G +
Sbjct:    1 SPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQVTLRGNLYGLLVG-IFTPDNDASYLP-VKHNGNISMDEVISIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAV 121          
BLAST of 60S ribosomal protein L12 vs. Ensembl Mouse
Match: Rpl12 (ribosomal protein L12 [Source:MGI Symbol;Acc:MGI:98002])

HSP 1 Score: 221.861 bits (564), Expect = 4.940e-74
Identity = 102/160 (63.75%), Postives = 126/160 (78.75%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            M PK DP  +  VYLR  GGEVGA ++LAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA++ VVP+A++L++K LKEP RDRKK KNIKH GN+ FD ++ IA+ MR RS  + L  T+KEILGTA+S+GC +D   P  II+ +N G +
Sbjct:    1 MPPKFDPNEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAV 160          
BLAST of 60S ribosomal protein L12 vs. UniProt/SwissProt
Match: sp|P61866|RL12_CAEEL (60S ribosomal protein L12 OS=Caenorhabditis elegans OX=6239 GN=rpl-12 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.283e-76
Identity = 108/162 (66.67%), Postives = 135/162 (83.33%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DPT I  VYLR VGGEVGA ++LAPK+GPLGLSPKK+G+DIAKAT +WKGL++T KLTIQNR A++ VVP+AASL+VKELKEP RDRKKVKN+KH+G++  D +I+IA++MRPRS  K L+ TVKEILGTA+S+GCTID + P  IIE +  G+I +
Sbjct:    1 MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKATQDWKGLKVTCKLTIQNRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVKHNGDLTVDTIIKIARIMRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEI 162          
BLAST of 60S ribosomal protein L12 vs. UniProt/SwissProt
Match: sp|P61865|RL12_CAEBR (60S ribosomal protein L12 OS=Caenorhabditis briggsae OX=6238 GN=rpl-12 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.283e-76
Identity = 108/162 (66.67%), Postives = 135/162 (83.33%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DPT I  VYLR VGGEVGA ++LAPK+GPLGLSPKK+G+DIAKAT +WKGL++T KLTIQNR A++ VVP+AASL+VKELKEP RDRKKVKN+KH+G++  D +I+IA++MRPRS  K L+ TVKEILGTA+S+GCTID + P  IIE +  G+I +
Sbjct:    1 MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKATQDWKGLKVTCKLTIQNRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVKHNGDLTVDTIIKIARIMRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEI 162          
BLAST of 60S ribosomal protein L12 vs. UniProt/SwissProt
Match: sp|Q9FF52|RL123_ARATH (60S ribosomal protein L12-3 OS=Arabidopsis thaliana OX=3702 GN=RPL12C PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 3.013e-76
Identity = 110/163 (67.48%), Postives = 137/163 (84.05%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATT-EWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PKLDP+ I  VY+RV GGEVGA +SLAPK+GPLGL+PKK+G+DIAK T  EWKGLR+TVKLT+QNRQA+V+VVP+AA+L++K LKEP RDRKKVKNIKH+GN++FD VIEIAK+MRPRS  K L  TVKEILGT  S+GCT+D + P+ + E++N G I +
Sbjct:    1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVIEIAKIMRPRSIAKELSGTVKEILGTCVSVGCTVDGKDPKDLQEEINSGDIDI 163          
BLAST of 60S ribosomal protein L12 vs. UniProt/SwissProt
Match: sp|Q9LFH5|RL122_ARATH (60S ribosomal protein L12-2 OS=Arabidopsis thaliana OX=3702 GN=RPL12B PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.433e-74
Identity = 106/163 (65.03%), Postives = 137/163 (84.05%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATT-EWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PKLDP+ I  VY+RV GGEVGA +SLAPK+GPLGL+PKK+G+DIAK T  EWKGLR+TVKLT+QNRQA+V+VVP+AA+L++K LKEP RDRKKVKNIKH+GN++FD V EIA++MRPRS  K L  TV+EILGT  S+GCT+D + P+ + +++ EG+I +
Sbjct:    1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPRSIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIEI 163          
BLAST of 60S ribosomal protein L12 vs. UniProt/SwissProt
Match: sp|Q6QMZ7|RL12_CHILA (60S ribosomal protein L12 OS=Chinchilla lanigera OX=34839 GN=RPL12 PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 3.326e-74
Identity = 104/158 (65.82%), Postives = 126/158 (79.75%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEG 561
            M PK DP  I  VYLR  GGEVGA ++LAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA++ VVP+A++L++K LKEP RDRKK KNIKH GN+ FD ++ IA+ MR RS  + L  T+KEILGTA+S+GC +DN  P  II+ +N G
Sbjct:    1 MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDNRHPHDIIDDINNG 158          
BLAST of 60S ribosomal protein L12 vs. TrEMBL
Match: A0A5J4NXG9 (Large subunit ribosomal protein L12e OS=Paragonimus westermani OX=34504 GN=DEA37_0005990 PE=3 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 5.060e-87
Identity = 123/162 (75.93%), Postives = 142/162 (87.65%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PKLDP+A+TY YLRV GGEVGA ASLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA++SVVP A+SLL+K LKEP RDRKK KNIKH GN++FD V+E+A++MRPRS    L  TVKEILGTARS+GCT+D EAPQTIIE++N G+I V
Sbjct:    1 MPPKLDPSAVTYTYLRVTGGEVGATASLAPKIGPLGLSPKKVGDDIAKATQDWKGLRITVKLTIQNRQAQISVVPTASSLLIKALKEPPRDRKKTKNIKHSGNISFDDVLEVARIMRPRSMACELSGTVKEILGTARSVGCTVDGEAPQTIIERVNSGEIAV 162          
BLAST of 60S ribosomal protein L12 vs. TrEMBL
Match: A0A504Y6I7 (Large subunit ribosomal protein L12.e OS=Fasciola gigantica OX=46835 GN=FGIG_10027 PE=3 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 7.842e-87
Identity = 121/162 (74.69%), Postives = 145/162 (89.51%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PKLDPTA+TY YLRV GGEVGA ASLAPK+GPLGLSPKKVG+DIAKAT +WKGLRITVKLTIQNRQA++SVVP A+SL+++ LKEP RD+KKVKNIKH GN++FD V+E+A++MRPRS  + L  TVKEILGTARS+GCT+D EAPQTIIE++N+G+I V
Sbjct:    1 MPPKLDPTAVTYTYLRVTGGEVGATASLAPKIGPLGLSPKKVGEDIAKATQDWKGLRITVKLTIQNRQAQISVVPTASSLVIRALKEPPRDKKKVKNIKHSGNISFDDVLEVARIMRPRSMARELSGTVKEILGTARSVGCTVDGEAPQTIIERVNKGEIAV 162          
BLAST of 60S ribosomal protein L12 vs. TrEMBL
Match: A0A4E0QV55 (Large subunit ribosomal protein L12.e OS=Fasciola hepatica OX=6192 GN=D915_009939 PE=3 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 7.842e-87
Identity = 121/162 (74.69%), Postives = 145/162 (89.51%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PKLDPTA+TY YLRV GGEVGA ASLAPK+GPLGLSPKKVG+DIAKAT +WKGLRITVKLTIQNRQA++SVVP A+SL+++ LKEP RD+KKVKNIKH GN++FD V+E+A++MRPRS  + L  TVKEILGTARS+GCT+D EAPQTIIE++N+G+I V
Sbjct:    1 MPPKLDPTAVTYTYLRVTGGEVGATASLAPKIGPLGLSPKKVGEDIAKATQDWKGLRITVKLTIQNRQAQISVVPTASSLVIRALKEPPRDKKKVKNIKHSGNISFDDVLEVARIMRPRSMARELSGTVKEILGTARSVGCTVDGEAPQTIIERVNKGEIAV 162          
BLAST of 60S ribosomal protein L12 vs. TrEMBL
Match: A0A1S8X533 (Ribosomal protein L11, RNA binding domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_02325 PE=3 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.215e-86
Identity = 121/162 (74.69%), Postives = 143/162 (88.27%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            MAPKLDPTA+TY YLRV GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA +SVVP A+SL+++ LKEP RDRKK KNIKH GN++FD V+E+A++MRPRS  + L  TVKEILGTARS+GCT+D EAPQTII+++N G+I V
Sbjct:    1 MAPKLDPTAVTYTYLRVTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATQDWKGLRITVKLTIQNRQAAISVVPTASSLIIRALKEPPRDRKKNKNIKHSGNISFDDVLEVARIMRPRSMARELSGTVKEILGTARSVGCTVDGEAPQTIIDRVNSGEIAV 162          
BLAST of 60S ribosomal protein L12 vs. TrEMBL
Match: A0A4V3SC22 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010527 PE=3 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.215e-86
Identity = 121/162 (74.69%), Postives = 143/162 (88.27%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            MAPKLDPTA+TY YLRV GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA +SVVP A+SL+++ LKEP RDRKK KNIKH GN++FD V+E+A++MRPRS  + L  TVKEILGTARS+GCT+D EAPQTII+++N G+I V
Sbjct:    1 MAPKLDPTAVTYTYLRVTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATQDWKGLRITVKLTIQNRQAAISVVPTASSLIIRALKEPPRDRKKNKNIKHSGNISFDDVLEVARIMRPRSMARELSGTVKEILGTARSVGCTVDGEAPQTIIDRVNSGEIAV 162          
BLAST of 60S ribosomal protein L12 vs. Ensembl Cavefish
Match: rpl12 (ribosomal protein L12 [Source:NCBI gene;Acc:103025222])

HSP 1 Score: 227.254 bits (578), Expect = 3.022e-76
Identity = 106/160 (66.25%), Postives = 130/160 (81.25%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            M PK DP+ I  VY+R  GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L  T+KEILGTA+S+GCTID   P  +I+ +N G++
Sbjct:    1 MPPKFDPSEIKIVYMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVPFDDIVNIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGRPPHDVIDDINSGKV 160          
BLAST of 60S ribosomal protein L12 vs. Ensembl Cavefish
Match: rpl12 (ribosomal protein L12 [Source:NCBI gene;Acc:103025222])

HSP 1 Score: 227.254 bits (578), Expect = 3.220e-76
Identity = 106/160 (66.25%), Postives = 130/160 (81.25%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            M PK DP+ I  VY+R  GGEVGA +SLAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L  T+KEILGTA+S+GCTID   P  +I+ +N G++
Sbjct:    1 MPPKFDPSEIKIVYMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVPFDDIVNIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGRPPHDVIDDINSGKV 160          
BLAST of 60S ribosomal protein L12 vs. Ensembl Sea Lamprey
Match: rpl12 (ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-030131-5297])

HSP 1 Score: 137.887 bits (346), Expect = 1.037e-42
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQ-AEVSVVPNAASLLVKELKEPARDRKKVK 375
            MAPK DP  I  V LR  GGEVGA ++LAPK+GPLGLSPKKVGDDIAKAT +WKGLRITV+LTIQNRQ A++ VVP+A++L++K +K P RDRKK K
Sbjct:    3 MAPKFDPNEIKIVCLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVRLTIQNRQAAQIEVVPSASALIIKAVKAPPRDRKKQK 99          
BLAST of 60S ribosomal protein L12 vs. Ensembl Yeast
Match: RPL12A (Ribosomal 60S subunit protein L12A; rpl12a rpl12b double mutant exhibits slow growth and slow translation; homologous to mammalian ribosomal protein L12 and bacterial L11; RPL12A has a paralog, RPL12B, that arose from the whole genome duplication [Source:SGD;Acc:S000000780])

HSP 1 Score: 217.238 bits (552), Expect = 3.428e-73
Identity = 101/162 (62.35%), Postives = 128/162 (79.01%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DP  + Y+YLR VGGEVGA A+LAPK+GPLGLSPKKVG+DIAKAT E+KG+++TV+L IQNRQA  SVVP+A+SL++  LKEP RDRKK KN+KH GN+  D +IEIA+ MR +S G+TL    KEILGTA+S+GC +D + P  IIE +N G+I +
Sbjct:    1 MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTVQLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLDEIIEIARQMRDKSFGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINAGEIEI 162          
BLAST of 60S ribosomal protein L12 vs. Ensembl Yeast
Match: RPL12B (Ribosomal 60S subunit protein L12B; rpl12a rpl12b double mutant exhibits slow growth and slow translation; homologous to mammalian ribosomal protein L12 and bacterial L11; RPL12B has a paralog, RPL12A, that arose from the whole genome duplication [Source:SGD;Acc:S000002826])

HSP 1 Score: 217.238 bits (552), Expect = 3.428e-73
Identity = 101/162 (62.35%), Postives = 128/162 (79.01%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DP  + Y+YLR VGGEVGA A+LAPK+GPLGLSPKKVG+DIAKAT E+KG+++TV+L IQNRQA  SVVP+A+SL++  LKEP RDRKK KN+KH GN+  D +IEIA+ MR +S G+TL    KEILGTA+S+GC +D + P  IIE +N G+I +
Sbjct:    1 MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTVQLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLDEIIEIARQMRDKSFGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINAGEIEI 162          
BLAST of 60S ribosomal protein L12 vs. Ensembl Yeast
Match: YEL053W-A_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; partially overlaps the verified gene RPL12A/YEL054C [Source:SGD;Acc:S000028744])

HSP 1 Score: 100.138 bits (248), Expect = 7.647e-28
Identity = 62/104 (59.62%), Postives = 72/104 (69.23%), Query Frame = -1
Query:   84 LPSCLIFLTFFLSRAGSFNSFTNNEAAFGTTETSACLF*IVNLTVILRPFHSVVAFAISSPTFLGERPNGPNLGANEAXXXXXXXXXXXXX*VIAVGSNFGAIF 395
            LP CL FL+FFLS  GSF +    E A GTTE +ACLF I N TV L P +S+VA AISSPTF G+RP GP  GA  A APTSPPT L+   + ++GSNFG IF
Sbjct:    2 LPLCLTFLSFFLSLGGSFKAVMTKEEADGTTEAAACLFWIFNWTVTLIPLNSLVALAISSPTFFGDRPKGPIFGAKAAEAPTSPPTALRYKYLTSLGSNFGGIF 105          
BLAST of 60S ribosomal protein L12 vs. Ensembl Yeast
Match: YDR417C_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF RPL12B/YDR418W [Source:SGD;Acc:S000002825])

HSP 1 Score: 98.9821 bits (245), Expect = 2.720e-27
Identity = 62/105 (59.05%), Postives = 72/105 (68.57%), Query Frame = -1
Query:   81 LPSCLIFLTFFLSRAGSFNSFTNNEAAFGTTETSACLF*IVNLTVILRPFHSVVAFAISSPTFLGERPNGPNLGANEAXXXXXXXXXXXXX*VIAVGSNFGAIFS 395
            LP CL FL+FFLS  GSF +    E A GTTE +ACLF I N TV L P +S+VA AISSPTF G++PNGP  GA  A APTSPPT LK   + + GSNFG I +
Sbjct:    2 LPLCLTFLSFFLSLGGSFKAVMTKEEADGTTEAAACLFWIFNWTVTLIPLNSLVALAISSPTFFGDKPNGPIFGAKAAEAPTSPPTALKYKYLTSFGSNFGGILT 106          
BLAST of 60S ribosomal protein L12 vs. Ensembl Nematostella
Match: EDO49984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REW3])

HSP 1 Score: 238.81 bits (608), Expect = 2.451e-81
Identity = 113/162 (69.75%), Postives = 133/162 (82.10%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK DP  I YVYLR  GGEVGA ASLAPK+GPLGLSPKKVGDDIAKAT +WKGL+ITV LTIQNRQA+VSVVP+A+SL++K LKEP RDRKKVKNIKH+GN+  D V  +AKVMRPRS  + L  TVKEILGT +S+GCT+D  AP  +I+K+N G+I +
Sbjct:    1 MPPKFDPNEIQYVYLRCTGGEVGATASLAPKIGPLGLSPKKVGDDIAKATQDWKGLKITVCLTIQNRQAKVSVVPSASSLIIKALKEPPRDRKKVKNIKHNGNITLDDVTNVAKVMRPRSMARHLSGTVKEILGTCQSVGCTVDGMAPHDVIDKINSGEIEI 162          
BLAST of 60S ribosomal protein L12 vs. Ensembl Nematostella
Match: EDO26321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCB3])

HSP 1 Score: 119.783 bits (299), Expect = 6.562e-35
Identity = 68/162 (41.98%), Postives = 90/162 (55.56%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            M PK +   I YVYLR  GGEVGA ASLAPK+GPLGL              +W  +R       Q+   E S    + +L+V              ++KH+GN+  D V  +AKVMRPRS  + L  TVKEILGT +S+GCT+D  AP  +I+K+N G+I +
Sbjct:    1 MPPKFELNEIQYVYLRCTGGEVGATASLAPKIGPLGL--------------DW-CIRTNFLYYPQSLYHEQS----SFNLIVCFF-----------SVKHNGNITLDDVTNVAKVMRPRSMARHLSGTVKEILGTCQSVGCTVDGMAPHDVIDKINSGEIEI 132          
BLAST of 60S ribosomal protein L12 vs. Ensembl Medaka
Match: rpl12 (ribosomal protein L12 [Source:NCBI gene;Acc:101155584])

HSP 1 Score: 182.956 bits (463), Expect = 5.945e-58
Identity = 87/125 (69.60%), Postives = 103/125 (82.40%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTL 462
            M PK DP  I  VY+R  GGEVGA ++LAPK+GPLGLSPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L
Sbjct:    1 MPPKFDPNEIKIVYMRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVTFDEIVGIARVMRHRSIAREL 125          
BLAST of 60S ribosomal protein L12 vs. Ensembl Medaka
Match: rpl12 (ribosomal protein L12 [Source:NCBI gene;Acc:101155584])

HSP 1 Score: 174.866 bits (442), Expect = 7.493e-55
Identity = 81/123 (65.85%), Postives = 101/123 (82.11%), Query Frame = 1
Query:  199 SPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQI 567
            SPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L  T+KEILGTA+S+GCTID   P  +I+ +N G++
Sbjct:   91 SPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVTFDEIVGIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGRHPHDVIDDINSGKV 213          
BLAST of 60S ribosomal protein L12 vs. Ensembl Medaka
Match: rpl12 (ribosomal protein L12 [Source:NCBI gene;Acc:101155584])

HSP 1 Score: 131.724 bits (330), Expect = 2.009e-37
Identity = 63/88 (71.59%), Postives = 75/88 (85.23%), Query Frame = 1
Query:  199 SPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTL 462
            SPKKVGDDIAKAT +WKGLRITVKLTIQNRQA + VVP+A++L++K LKEP RDRKKVKNIKH G+V FD ++ IA+VMR RS  + L
Sbjct:   91 SPKKVGDDIAKATGDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIKHSGSVTFDEIVGIARVMRHRSIAREL 178          
BLAST of 60S ribosomal protein L12 vs. Planmine SMEST
Match: SMESG000006898.1 (SMESG000006898.1)

HSP 1 Score: 325.865 bits (834), Expect = 1.716e-115
Identity = 162/162 (100.00%), Postives = 162/162 (100.00%), Query Frame = 1
Query:   88 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 573
            MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV
Sbjct:    1 MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKATTEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKHDGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQTIIEKLNEGQITV 162          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RPL123.986e-7464.38ribosomal protein L12 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL123.825e-4445.63ribosomal protein L12 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl-121.008e-7766.6760S ribosomal protein L12 [Source:UniProtKB/Swiss... [more]
rpl-123.749e-1359.5760S ribosomal protein L12 [Source:UniProtKB/Swiss... [more]
rpl-123.749e-1359.5760S ribosomal protein L12 [Source:UniProtKB/Swiss... [more]
rpl-123.749e-1359.5760S ribosomal protein L12 [Source:UniProtKB/Swiss... [more]
rpl-123.749e-1359.5760S ribosomal protein L12 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RpL121.425e-7967.28gene:FBgn0034968 transcript:FBtr0072175[more]
RpL121.425e-7967.28gene:FBgn0034968 transcript:FBtr0072176[more]
RpL121.425e-7967.28gene:FBgn0034968 transcript:FBtr0072174[more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl122.070e-7566.04ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl122.784e-7565.63ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl123.618e-7565.63ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl128.627e-7562.21ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl128.627e-7562.21ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RPL121.241e-3955.28ribosomal protein L12 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rpl124.940e-7463.75ribosomal protein L12 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P61866|RL12_CAEEL1.283e-7666.6760S ribosomal protein L12 OS=Caenorhabditis elegan... [more]
sp|P61865|RL12_CAEBR1.283e-7666.6760S ribosomal protein L12 OS=Caenorhabditis briggs... [more]
sp|Q9FF52|RL123_ARATH3.013e-7667.4860S ribosomal protein L12-3 OS=Arabidopsis thalian... [more]
sp|Q9LFH5|RL122_ARATH1.433e-7465.0360S ribosomal protein L12-2 OS=Arabidopsis thalian... [more]
sp|Q6QMZ7|RL12_CHILA3.326e-7465.8260S ribosomal protein L12 OS=Chinchilla lanigera O... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NXG95.060e-8775.93Large subunit ribosomal protein L12e OS=Paragonimu... [more]
A0A504Y6I77.842e-8774.69Large subunit ribosomal protein L12.e OS=Fasciola ... [more]
A0A4E0QV557.842e-8774.69Large subunit ribosomal protein L12.e OS=Fasciola ... [more]
A0A1S8X5331.215e-8674.69Ribosomal protein L11, RNA binding domain protein ... [more]
A0A4V3SC221.215e-8674.69Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl123.022e-7666.25ribosomal protein L12 [Source:NCBI gene;Acc:103025... [more]
rpl123.220e-7666.25ribosomal protein L12 [Source:NCBI gene;Acc:103025... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl121.037e-4270.10ribosomal protein L12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RPL12A3.428e-7362.35Ribosomal 60S subunit protein L12A; rpl12a rpl12b ... [more]
RPL12B3.428e-7362.35Ribosomal 60S subunit protein L12B; rpl12a rpl12b ... [more]
YEL053W-A_mRNA7.647e-2859.62Dubious open reading frame; unlikely to encode a f... [more]
YDR417C_mRNA2.720e-2759.05Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO499842.451e-8169.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263216.562e-3541.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl125.945e-5869.60ribosomal protein L12 [Source:NCBI gene;Acc:101155... [more]
rpl127.493e-5565.85ribosomal protein L12 [Source:NCBI gene;Acc:101155... [more]
rpl122.009e-3771.59ribosomal protein L12 [Source:NCBI gene;Acc:101155... [more]
back to top
BLAST of 60S ribosomal protein L12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000006898.11.716e-115100.00SMESG000006898.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029507 ID=SMED30029507|Name=60S ribosomal protein L12|organism=Schmidtea mediterranea sexual|type=transcript|length=620bp
TAATTTTAATAATCTTAATTATTTCTAACAAATTAATATAAATTGTTTTA
ATATTTGATAAATCAAATTTTAAAATAATTTGAAAAAATGGCTCCGAAAT
TAGATCCAACAGCAATTACTTATGTTTATTTGAGAGTAGTCGGTGGAGAA
GTTGGTGCTGTTGCTTCATTGGCTCCTAAATTGGGTCCATTGGGTCTTTC
ACCTAAAAAAGTTGGTGATGATATTGCAAAAGCAACAACTGAATGGAAAG
GTCTTAGAATCACAGTTAAGTTGACAATTCAAAACAGACAAGCCGAAGTT
TCAGTTGTTCCGAATGCTGCTTCATTATTGGTAAAAGAATTAAAAGAACC
AGCCCGTGACAGAAAGAAGGTTAAAAATATCAAACACGATGGTAACGTTA
ACTTCGACGCCGTTATTGAAATTGCAAAGGTTATGAGACCAAGATCATGC
GGTAAAACTTTACAAGATACCGTTAAAGAAATTTTGGGAACTGCCAGGTC
AATTGGTTGCACTATTGATAATGAAGCACCACAAACCATTATTGAAAAAT
TAAATGAAGGACAAATTACCGTTTAATATTTTAATATAATTTATTGGATC
TTTAAAAAAAAAGATCGGAA
back to top

protein sequence of SMED30029507-orf-1

>SMED30029507-orf-1 ID=SMED30029507-orf-1|Name=SMED30029507-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=163bp
MAPKLDPTAITYVYLRVVGGEVGAVASLAPKLGPLGLSPKKVGDDIAKAT
TEWKGLRITVKLTIQNRQAEVSVVPNAASLLVKELKEPARDRKKVKNIKH
DGNVNFDAVIEIAKVMRPRSCGKTLQDTVKEILGTARSIGCTIDNEAPQT
IIEKLNEGQITV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036769Ribosomal_L11_C_sf
IPR000911Ribosomal_L11/L12
IPR020783Ribosomal_L11_C
IPR020784Ribosomal_L11_N
IPR020785Ribosomal_L11_CS
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036769Ribosomal protein L11, C-terminal domain superfamilyGENE3DG3DSA:1.10.10.250coord: 1..47
e-value: 3.1E-15
score: 58.3
IPR036769Ribosomal protein L11, C-terminal domain superfamilySUPERFAMILYSSF46906Ribosomal protein L11, C-terminal domaincoord: 2..32
IPR020783Ribosomal protein L11, C-terminalPFAMPF00298Ribosomal_L11coord: 4..28
e-value: 1.7E-5
score: 25.2
NoneNo IPR availablePANTHERPTHR11661:SF2RIBOSOMAL PROTEIN L12coord: 1..46
IPR000911Ribosomal protein L11/L12PANTHERPTHR1166160S RIBOSOMAL PROTEIN L12coord: 1..46
IPR020785Ribosomal protein L11, conserved sitePROSITEPS00359RIBOSOMAL_L11coord: 15..30