60S acidic ribosomal protein P1

Overview
Name60S acidic ribosomal protein P1
Smed IDSMED30029501
Length (bp)444
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S acidic ribosomal protein P1 (SMED30029501) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S acidic ribosomal protein P1 (SMED30029501) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S acidic ribosomal protein P1 (SMED30029501) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S acidic ribosomal protein P1 (SMED30029501) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029501

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30029501SMESG000062259.1 dd_Smed_v4_224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029501SMESG000062259.1 dd_Smed_v4_224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029501SMESG000062259.1 dd_Smed_v4_224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029501SMESG000062259.1 dd_Smed_v4_224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029501SMESG000062259.1 dd_Smed_v6_224_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Human
Match: RPLP1 (ribosomal protein lateral stalk subunit P1 [Source:HGNC Symbol;Acc:HGNC:10372])

HSP 1 Score: 58.151 bits (139), Expect = 2.791e-11
Identity = 31/64 (48.44%), Postives = 43/64 (67.19%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            M   S  AC Y++LIL DD + +T DKINA++KAA V+  P F PG+F+K L+N N   L+ N+
Sbjct:    1 MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEP-FWPGLFAKALANVNIGSLICNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Celegans
Match: rla-1 (60S acidic ribosomal protein P1 [Source:UniProtKB/Swiss-Prot;Acc:P91913])

HSP 1 Score: 53.9138 bits (128), Expect = 4.771e-10
Identity = 25/47 (53.19%), Postives = 34/47 (72.34%), Query Frame = 3
Query:   96 ACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN 236
            AC YA+LIL DD + IT +KI  +LKAA+V+F P + PG+F+K L  
Sbjct:    8 ACVYAALILQDDEVAITGEKIATLLKAANVEFEP-YWPGLFAKALEG 53          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Celegans
Match: rla-1 (60S acidic ribosomal protein P1 [Source:UniProtKB/Swiss-Prot;Acc:P91913])

HSP 1 Score: 53.9138 bits (128), Expect = 4.771e-10
Identity = 25/47 (53.19%), Postives = 34/47 (72.34%), Query Frame = 3
Query:   96 ACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN 236
            AC YA+LIL DD + IT +KI  +LKAA+V+F P + PG+F+K L  
Sbjct:    8 ACVYAALILQDDEVAITGEKIATLLKAANVEFEP-YWPGLFAKALEG 53          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Celegans
Match: rla-1 (60S acidic ribosomal protein P1 [Source:UniProtKB/Swiss-Prot;Acc:P91913])

HSP 1 Score: 53.9138 bits (128), Expect = 4.771e-10
Identity = 25/47 (53.19%), Postives = 34/47 (72.34%), Query Frame = 3
Query:   96 ACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN 236
            AC YA+LIL DD + IT +KI  +LKAA+V+F P + PG+F+K L  
Sbjct:    8 ACVYAALILQDDEVAITGEKIATLLKAANVEFEP-YWPGLFAKALEG 53          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Fly
Match: RpLP1 (gene:FBgn0002593 transcript:FBtr0078056)

HSP 1 Score: 63.5438 bits (153), Expect = 1.066e-13
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNIGN 269
            M  K+  AC YASLIL+DD + +T +KIN ILKAA+V+  P + PG+F+K L   N + L+ NIG+
Sbjct:    1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEP-YWPGLFAKALEGINVKDLITNIGS 65          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Fly
Match: RpLP1 (gene:FBgn0002593 transcript:FBtr0331932)

HSP 1 Score: 63.5438 bits (153), Expect = 1.066e-13
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNIGN 269
            M  K+  AC YASLIL+DD + +T +KIN ILKAA+V+  P + PG+F+K L   N + L+ NIG+
Sbjct:    1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEP-YWPGLFAKALEGINVKDLITNIGS 65          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Zebrafish
Match: rplp1 (ribosomal protein, large, P1 [Source:ZFIN;Acc:ZDB-GENE-030131-8663])

HSP 1 Score: 52.7582 bits (125), Expect = 6.002e-10
Identity = 25/50 (50.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSK 224
            M   S  AC Y++LIL DD + +T DK+NA++KAA V   P F PG+F+K
Sbjct:    1 MASVSELACIYSALILHDDEVTVTEDKLNALIKAAGVTIEP-FWPGLFAK 49          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Zebrafish
Match: rplp1 (ribosomal protein, large, P1 [Source:ZFIN;Acc:ZDB-GENE-030131-8663])

HSP 1 Score: 53.1434 bits (126), Expect = 1.813e-9
Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN 236
            M   S  AC Y++LIL DD + +T DK+NA++KAA V   P F PG+F+K L++
Sbjct:    1 MASVSELACIYSALILHDDEVTVTEDKLNALIKAAGVTIEP-FWPGLFAKALAS 53          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Xenopus
Match: rplp1 (ribosomal protein, large, P1 [Source:NCBI gene;Acc:549958])

HSP 1 Score: 50.8322 bits (120), Expect = 1.833e-8
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSNNPRQLLMNIGN 269
            M   S  AC Y++LIL DD + IT DKI+ ++K A V   P F P +F+K L+N      +NIG+
Sbjct:    1 MASVSELACIYSALILHDDEVSITEDKISTLIKTAGVTIEP-FWPSLFAKALAN------INIGS 58          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Xenopus
Match: rplp1 (ribosomal protein, large, P1 [Source:NCBI gene;Acc:549958])

HSP 1 Score: 49.6766 bits (117), Expect = 5.066e-8
Identity = 28/64 (43.75%), Postives = 39/64 (60.94%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            M   S  AC Y++LIL DD + IT DKI+ ++K A V   P F P +F+K L+N N   L+ N+
Sbjct:    1 MASVSELACIYSALILHDDEVSITEDKISTLIKTAGVTIEP-FWPSLFAKALANINIGSLISNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Mouse
Match: Rplp1 (ribosomal protein, large, P1 [Source:MGI Symbol;Acc:MGI:1927099])

HSP 1 Score: 58.151 bits (139), Expect = 2.525e-11
Identity = 31/64 (48.44%), Postives = 42/64 (65.62%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            M   S  AC Y++LIL DD + +T DKINA++KAA V   P F PG+F+K L+N N   L+ N+
Sbjct:    1 MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVSVEP-FWPGLFAKALANVNIGSLICNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Mouse
Match: LO018689.5 (60S acidic ribosomal protein P1-like [Source:NCBI gene;Acc:102637947])

HSP 1 Score: 49.2914 bits (116), Expect = 5.472e-8
Identity = 27/60 (45.00%), Postives = 37/60 (61.67%), Query Frame = 3
Query:   87 SRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            S+  C Y++LIL D  + +T  KINA +KAA V   P F PG F+K L+N N   L+ N+
Sbjct:    5 SKLTCIYSALILQDKEVMVTEVKINAFIKAAGVSIEP-FWPGSFAKALANVNTGSLICNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Mouse
Match: LO018689.5 (60S acidic ribosomal protein P1-like [Source:NCBI gene;Acc:102637947])

HSP 1 Score: 49.2914 bits (116), Expect = 5.472e-8
Identity = 27/60 (45.00%), Postives = 37/60 (61.67%), Query Frame = 3
Query:   87 SRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            S+  C Y++LIL D  + +T  KINA +KAA V   P F PG F+K L+N N   L+ N+
Sbjct:    5 SKLTCIYSALILQDKEVMVTEVKINAFIKAAGVSIEP-FWPGSFAKALANVNTGSLICNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Mouse
Match: Gm5244 (predicted pseudogene 5244 [Source:MGI Symbol;Acc:MGI:3646958])

HSP 1 Score: 45.0542 bits (105), Expect = 2.288e-6
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILM-DDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSNNPRQLLMNIGN 269
            M   S  AC Y++LIL  DD + +T DKINA++KAA    +  F P +F+K L+N      +NIG+
Sbjct:    1 MASASELACIYSALILHEDDEVMVTEDKINALIKAA---LIKPFWPSLFAKALAN------VNIGS 57          
BLAST of 60S acidic ribosomal protein P1 vs. UniProt/SwissProt
Match: sp|P08570|RLA1_DROME (60S acidic ribosomal protein P1 OS=Drosophila melanogaster OX=7227 GN=RpLP1 PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 1.068e-12
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNIGN 269
            M  K+  AC YASLIL+DD + +T +KIN ILKAA+V+  P + PG+F+K L   N + L+ NIG+
Sbjct:    1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEP-YWPGLFAKALEGINVKDLITNIGS 65          
BLAST of 60S acidic ribosomal protein P1 vs. UniProt/SwissProt
Match: sp|P19944|RLA1_RAT (60S acidic ribosomal protein P1 OS=Rattus norvegicus OX=10116 GN=Rplp1 PE=3 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.084e-10
Identity = 31/64 (48.44%), Postives = 43/64 (67.19%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            M   S  AC Y++LIL DD + +T DKINA++KAA V+  P F PG+F+K L+N N   L+ N+
Sbjct:    1 MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEP-FWPGLFAKALANVNIGSLICNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. UniProt/SwissProt
Match: sp|P05386|RLA1_HUMAN (60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.340e-10
Identity = 31/64 (48.44%), Postives = 43/64 (67.19%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            M   S  AC Y++LIL DD + +T DKINA++KAA V+  P F PG+F+K L+N N   L+ N+
Sbjct:    1 MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEP-FWPGLFAKALANVNIGSLICNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. UniProt/SwissProt
Match: sp|Q56K14|RLA1_BOVIN (60S acidic ribosomal protein P1 OS=Bos taurus OX=9913 GN=RPLP1 PE=3 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.340e-10
Identity = 31/64 (48.44%), Postives = 43/64 (67.19%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            M   S  AC Y++LIL DD + +T DKINA++KAA V+  P F PG+F+K L+N N   L+ N+
Sbjct:    1 MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEP-FWPGLFAKALANVNIGSLICNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. UniProt/SwissProt
Match: sp|P47955|RLA1_MOUSE (60S acidic ribosomal protein P1 OS=Mus musculus OX=10090 GN=Rplp1 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.766e-10
Identity = 31/64 (48.44%), Postives = 42/64 (65.62%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNI 263
            M   S  AC Y++LIL DD + +T DKINA++KAA V   P F PG+F+K L+N N   L+ N+
Sbjct:    1 MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVSVEP-FWPGLFAKALANVNIGSLICNV 63          
BLAST of 60S acidic ribosomal protein P1 vs. TrEMBL
Match: G4VJS1 (Putative 60s acidic ribosomal protein P1 OS=Schistosoma mansoni OX=6183 GN=Smp_041980 PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.298e-11
Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 3
Query:   84 KSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNIG 266
            KS  AC YA+L+L DD +D+T+DKIN +LKAA++ FV ++LP +F+  L+  N R LLM++G
Sbjct:    3 KSELACVYAALMLADDDIDVTADKINTVLKAANIKFVESYLPNLFATALNGKNVRDLLMSMG 64          
BLAST of 60S acidic ribosomal protein P1 vs. TrEMBL
Match: A0A1E1WDA7 (Uncharacterized protein OS=Pectinophora gossypiella OX=13191 GN=g.1780 PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.699e-11
Identity = 33/66 (50.00%), Postives = 47/66 (71.21%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNIGN 269
            M  K+  AC YA+LIL+DD + +T +KI+ ILKAA+VD  P + PG+F+K L   N R+L+ NIG+
Sbjct:    1 MASKAELACVYAALILVDDEVAVTGEKISTILKAAAVDVEP-YWPGLFAKALEGVNVRELITNIGS 65          
BLAST of 60S acidic ribosomal protein P1 vs. TrEMBL
Match: A0A183W1W5 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS6723 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.538e-11
Identity = 33/63 (52.38%), Postives = 47/63 (74.60%), Query Frame = 3
Query:   84 KSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNIGN 269
            KS  AC YA+L+L DD +D+T+DKIN ILKAA++ FV  +LP +F+  LS  N + LLM++G+
Sbjct:    4 KSELACVYAALMLADDDIDVTADKINTILKAANIKFVEPYLPNLFATALSGKNIKDLLMSMGS 66          
BLAST of 60S acidic ribosomal protein P1 vs. TrEMBL
Match: A0A094ZI98 (60S acidic ribosomal protein P1 OS=Schistosoma haematobium OX=6185 GN=MS3_00784 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.585e-11
Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 3
Query:   84 KSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNIG 266
            KS  AC YA+L+L DD +D+T+DKIN ILKAA++ FV ++LP +F+  L+  N + LLM++G
Sbjct:    3 KSELACVYAALMLADDDIDVTADKINTILKAANIKFVESYLPNLFATALNGKNVKDLLMSLG 64          
BLAST of 60S acidic ribosomal protein P1 vs. TrEMBL
Match: A0A183MT24 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS19199 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.624e-11
Identity = 32/62 (51.61%), Postives = 47/62 (75.81%), Query Frame = 3
Query:   84 KSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN-NPRQLLMNIG 266
            KS  AC YA+L+L DD +D+T+DKIN ILKAA++ FV ++LP +F+  L+  N + LLM++G
Sbjct:    3 KSELACVYAALMLADDDIDVTADKINTILKAANIKFVESYLPNLFATALNGKNVKDLLMSMG 64          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Cavefish
Match: rplp1 (ribosomal protein lateral stalk subunit P1 [Source:NCBI gene;Acc:103034431])

HSP 1 Score: 51.9878 bits (123), Expect = 3.842e-9
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN 236
            M   S  AC Y++LIL DD + +T DK+NA++KAA V   P F PG+F+K L +
Sbjct:    1 MASVSELACIYSALILHDDDVTVTEDKLNALIKAAGVTIEP-FWPGLFAKALGS 53          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Sea Lamprey
Match: RPLP1 (ribosomal protein lateral stalk subunit P1 [Source:HGNC Symbol;Acc:HGNC:10372])

HSP 1 Score: 55.0694 bits (131), Expect = 6.131e-11
Identity = 28/54 (51.85%), Postives = 35/54 (64.81%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSN 236
            M   S  AC Y++LIL DD + IT DKINA++KAA V   P F PG+F+K L  
Sbjct:    9 MASVSELACIYSALILHDDEVAITEDKINALIKAAGVTVEP-FWPGLFAKALGT 61          
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Nematostella
Match: EDO40097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S837])

HSP 1 Score: 51.2174 bits (121), Expect = 2.874e-9
Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSNN 239
            M   S  AC Y++LIL DD + IT+DKI  ++KAA ++  P F PG+F+K L  +
Sbjct:    1 MASTSELACVYSALILHDDDVAITADKIETLVKAAKINVEP-FWPGLFAKALQGH 54          
BLAST of 60S acidic ribosomal protein P1 vs. Planmine SMEST
Match: SMESG000062259.1 (SMESG000062259.1)

HSP 1 Score: 141.354 bits (355), Expect = 3.203e-44
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 3
Query:   75 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSNNPRQLLMNIGNXXXXXXXXXXXXXLTVXXXXXXXXXXXXXXXXXXXXDMGFGLFD 401
            MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSNNPRQLLMNIGNSPAPVASVSSDSALTVEKKEEAKEEKKAESSSESEADMGFGLFD
Sbjct:    1 MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSKILSNNPRQLLMNIGNSPAPVASVSSDSALTVEKKEEAKEEKKAESSSESEADMGFGLFD 109          
The following BLAST results are available for this feature:
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RPLP12.791e-1148.44ribosomal protein lateral stalk subunit P1 [Source... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rla-14.771e-1053.1960S acidic ribosomal protein P1 [Source:UniProtKB... [more]
rla-14.771e-1053.1960S acidic ribosomal protein P1 [Source:UniProtKB... [more]
rla-14.771e-1053.1960S acidic ribosomal protein P1 [Source:UniProtKB... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RpLP11.066e-1350.00gene:FBgn0002593 transcript:FBtr0078056[more]
RpLP11.066e-1350.00gene:FBgn0002593 transcript:FBtr0331932[more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rplp16.002e-1050.00ribosomal protein, large, P1 [Source:ZFIN;Acc:ZDB-... [more]
rplp11.813e-948.15ribosomal protein, large, P1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rplp11.833e-843.08ribosomal protein, large, P1 [Source:NCBI gene;Acc... [more]
rplp15.066e-843.75ribosomal protein, large, P1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rplp12.525e-1148.44ribosomal protein, large, P1 [Source:MGI Symbol;Ac... [more]
LO018689.55.472e-845.0060S acidic ribosomal protein P1-like [Source:NCBI ... [more]
LO018689.55.472e-845.0060S acidic ribosomal protein P1-like [Source:NCBI ... [more]
Gm52442.288e-642.42predicted pseudogene 5244 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08570|RLA1_DROME1.068e-1250.0060S acidic ribosomal protein P1 OS=Drosophila mela... [more]
sp|P19944|RLA1_RAT1.084e-1048.4460S acidic ribosomal protein P1 OS=Rattus norvegic... [more]
sp|P05386|RLA1_HUMAN1.340e-1048.4460S acidic ribosomal protein P1 OS=Homo sapiens OX... [more]
sp|Q56K14|RLA1_BOVIN1.340e-1048.4460S acidic ribosomal protein P1 OS=Bos taurus OX=9... [more]
sp|P47955|RLA1_MOUSE1.766e-1048.4460S acidic ribosomal protein P1 OS=Mus musculus OX... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VJS12.298e-1151.61Putative 60s acidic ribosomal protein P1 OS=Schist... [more]
A0A1E1WDA72.699e-1150.00Uncharacterized protein OS=Pectinophora gossypiell... [more]
A0A183W1W53.538e-1152.38Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A094ZI983.585e-1151.6160S acidic ribosomal protein P1 OS=Schistosoma hae... [more]
A0A183MT243.624e-1151.61Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rplp13.842e-948.15ribosomal protein lateral stalk subunit P1 [Source... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RPLP16.131e-1151.85ribosomal protein lateral stalk subunit P1 [Source... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO400972.874e-945.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S acidic ribosomal protein P1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000062259.13.203e-44100.00SMESG000062259.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029501 ID=SMED30029501|Name=60S acidic ribosomal protein P1|organism=Schmidtea mediterranea sexual|type=transcript|length=444bp
TTTTAATATTAATTATAAATTATATAAATGTTGTTTTAATATATAATTAA
TAGTATTTTAAAATTTTTTGAAAAATGGATGAAAAATCAAGAGATGCATG
TACATATGCTAGTTTAATTTTAATGGACGATTCTTTGGACATCACAAGCG
ATAAAATAAACGCTATTTTAAAGGCTGCTAGTGTTGACTTTGTTCCTGCT
TTCTTACCTGGAATGTTTTCAAAAATCTTGTCAAACAATCCCAGACAATT
ATTAATGAACATTGGAAATTCACCTGCTCCAGTTGCATCAGTATCATCTG
ATTCAGCCTTAACAGTTGAAAAGAAAGAAGAAGCTAAAGAAGAAAAGAAA
GCCGAGTCCTCATCAGAATCTGAAGCTGATATGGGCTTTGGTCTATTTGA
TTAATTTTGAATAAAATATTGGATTTATGTCTAAAAAAAAAGAT
back to top

protein sequence of SMED30029501-orf-1

>SMED30029501-orf-1 ID=SMED30029501-orf-1|Name=SMED30029501-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MDEKSRDACTYASLILMDDSLDITSDKINAILKAASVDFVPAFLPGMFSK
ILSNNPRQLLMNIGNSPAPVASVSSDSALTVEKKEEAKEEKKAESSSESE
ADMGFGLFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038716P1/P2_N_sf
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006414translational elongation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038716Ribosomal protein P1/P2, N-terminal domainGENE3DG3DSA:1.10.10.1410coord: 1..64
e-value: 2.2E-17
score: 64.6
NoneNo IPR availablePFAMPF00428Ribosomal_60scoord: 23..108
e-value: 8.8E-13
score: 48.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 71..109
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 79..98
NoneNo IPR availablePANTHERPTHR45696FAMILY NOT NAMEDcoord: 5..109
NoneNo IPR availablePANTHERPTHR45696:SF1060S ACIDIC RIBOSOMAL PROTEIN P1coord: 5..109
NoneNo IPR availableCDDcd05831Ribosomal_P1coord: 8..108
e-value: 3.99087E-20
score: 76.2063