Phosphoserine aminotransferase

Overview
NamePhosphoserine aminotransferase
Smed IDSMED30029500
Length (bp)1435
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoserine aminotransferase (SMED30029500) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoserine aminotransferase (SMED30029500) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoserine aminotransferase (SMED30029500) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoserine aminotransferase (SMED30029500) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029500

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029500SMESG000056365.1 Contig3471GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029500SMESG000019836.1 Contig3471GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30029500SMESG000019836.1 SmedASXL_002739SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30029500SMESG000019836.1 dd_Smed_v4_1653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30029500SMESG000019836.1 dd_Smed_v6_1653_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoserine aminotransferase vs. Ensembl Human
Match: PSAT1 (phosphoserine aminotransferase 1 [Source:HGNC Symbol;Acc:HGNC:19129])

HSP 1 Score: 406.371 bits (1043), Expect = 2.967e-139
Identity = 199/360 (55.28%), Postives = 263/360 (73.06%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LP  VL  +Q ELL Y GVG S+LEMSHRS  F+KI N TENL+R+LL +P NYKV+FLQGG  GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G +  V P++ S+T IPD ++W ++PDASY+YYCANETVHGVEF  IPDV   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+VIVRDDLL +AL E PSV  YK   G +SLYNTPP FSIYV  L+L+W+K+ GG   +  L++ K++ +Y  I+ S+GFY CPV+ ++RS +N+  RI N + D  LE   +  A  + N++ +KGHR+VGG+R SLYN++++E VQ L   MK++
Sbjct:    7 VVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKA-LELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKF 364          
BLAST of Phosphoserine aminotransferase vs. Ensembl Human
Match: PSAT1 (phosphoserine aminotransferase 1 [Source:HGNC Symbol;Acc:HGNC:19129])

HSP 1 Score: 356.681 bits (914), Expect = 2.155e-120
Identity = 181/358 (50.56%), Postives = 234/358 (65.36%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LP  VL  +Q ELL Y GVG S+LEMSHRS  F+KI N TENL+R+LL +P NYKV+FLQGG  GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G +  V P++ S+T IPD ++W ++PDASY+YYCANETVHGVEF  IPDV   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+VIVRDDLL +AL E PSV  YK   G +SLYNTPP FSIYV  L+L+W+K+ GG   +  L++ K++ +Y  I+ S+GFY                                              +VGG+R SLYN++++E VQ L   MK++
Sbjct:    7 VVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFY---------------------------------------------VSVGGIRASLYNAVTIEDVQKLAAFMKKF 318          
BLAST of Phosphoserine aminotransferase vs. Ensembl Celegans
Match: F26H9.5 (Probable phosphoserine aminotransferase [Source:UniProtKB/Swiss-Prot;Acc:P91856])

HSP 1 Score: 372.089 bits (954), Expect = 3.048e-126
Identity = 180/360 (50.00%), Postives = 253/360 (70.28%), Query Frame = 2
Query:  194 INFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIR--NKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYR 1267
            INF+AGP+ LP EVL  +Q E L+++ +G S++EMSHRS+ F  + NET +L+R+L+ +P N+++LF+QGG TGQFAA+P+NL  +   + A+YIVTG WS+KAA EA KY NVK+VF   K + T+PD+ +W  D  A+Y+YYCANETVHG+EF        N+PLV+D+SSN +++       G++F  AQKN+G AGLT+VIVR DL+      TPSVF+YK +   NSLYNTPPT  IY   L+LKW+KS GGL  +  LN  K+ ++Y+ I+ S GFY+C VDK+ RS +NV  RI   +  ++LE   +K    + N+I +KGHR+VGG+R SLYN+IS+E+ Q+L   M E++
Sbjct:    8 INFAAGPAKLPEEVLLKMQEEQLNFNNLGVSVIEMSHRSKEFGALLNETISLIRELMNVPDNFEILFMQGGGTGQFAAIPLNL--KGDHEHADYIVTGAWSSKAADEAGKYINVKKVFQPSKPYVTVPDQENWVHDEKAAYLYYCANETVHGIEFTPTAPESHNVPLVADVSSNFMARPFDFKDHGVVFGGAQKNLGAAGLTIVIVRKDLIGKQQAITPSVFSYKEMIANNSLYNTPPTGGIYTTNLVLKWIKSKGGLQAIYELNLQKSGMIYDIIDNSNGFYHCAVDKRYRSIMNVCFRIGGPSGNDELEEKFLK-GSIERNMISLKGHRSVGGIRASLYNAISVEETQVLATWMNEFQ 364          
BLAST of Phosphoserine aminotransferase vs. Ensembl Fly
Match: CG11899 (gene:FBgn0014427 transcript:FBtr0085390)

HSP 1 Score: 385.185 bits (988), Expect = 2.354e-131
Identity = 185/357 (51.82%), Postives = 257/357 (71.99%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCM 1255
            +INF+AGP+ LP EVLK VQ  L++ +G G S++EMSHRS +++KI + T + LR+LL +P NYK+L +QGG TGQFAAV +NLI +     A+Y++TG WS KAA EAA+YG V  V P++  +TT+P + +W++DP+ASY+YYC NETV GVEF  +P+VP  +PLV+DMSSN LS+   VSKFG+I+A AQKNIG AG T++IVRDDL+   L  TPS+ N++ +D  NSL NTPPTF IYV  L+ KW+K  GG+  ++ L  AK++L+Y+ I +S GFY CPVD   RS +NV  RI +   D  LE   +  A+ +  +I++KGHR+VGG+R SLYN++++ + Q L   M
Sbjct:    2 VINFAAGPAKLPEEVLKEVQENLVNCNGSGISVMEMSHRSSNYAKIHDATISDLRELLNVPSNYKILLMQGGGTGQFAAVALNLIGK--TGTADYVITGSWSAKAAKEAAQYGTVNAVLPKLAKYTTVPRQETWKLDPNASYVYYCDNETVEGVEFDFVPEVPAGVPLVADMSSNFLSRPFDVSKFGVIYAGAQKNIGPAGTTVIIVRDDLIGKHLKITPSILNFEQMDKNNSLLNTPPTFGIYVMGLVFKWIKRNGGVAGMAKLAAAKSKLIYDTINQSNGFYYCPVDVNVRSRMNVPFRIGSASGDDALEKEFLSKAEAE-GMIQLKGHRSVGGIRASLYNAVTLAETQQLANLM 355          
BLAST of Phosphoserine aminotransferase vs. Ensembl Zebrafish
Match: psat1 (phosphoserine aminotransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5723])

HSP 1 Score: 406.757 bits (1044), Expect = 1.417e-139
Identity = 196/359 (54.60%), Postives = 261/359 (72.70%), Query Frame = 2
Query:  194 INFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKE--EDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            +NF AGP+ LP+ VL   Q ELL Y G G S+LEMSHRS  F+KI N TENL+R+LL +P+NYK+LFLQGG +GQF+AVP+NLI     + A+Y+VTG WS +AA EA KYG V  + P++ S+T IPD ++W ++P ASY+YYC NETVHGVEF  IPD    + LVSDMSSN LS+ + VSKFGLIFA AQKN+G AG+T+VIVR+DL+  AL E P + +Y+   G NSLYNTPP FSIY+  L+L+W+++ GG + +  LN  K+ LVY+ I  S GFY+CPVD   RS +N+  RI  KE  E LE + +  A +K  +I +KGHR+VGG+R SLYN++++E V+IL   M+++
Sbjct:    7 VNFGAGPAKLPQSVLLQAQKELLDYSGTGISILEMSHRSSDFTKIINTTENLIRELLNVPENYKILFLQGGGSGQFSAVPLNLIGLKEERCADYLVTGTWSARAAKEAEKYGKVNVIHPKLDSYTKIPDSSTWSLNPSASYVYYCCNETVHGVEFNFIPDT-KGVILVSDMSSNFLSRPVDVSKFGLIFAGAQKNVGCAGVTVVIVREDLIGKALKECPIILDYQVQAGNNSLYNTPPCFSIYIMGLVLEWIRNNGGADAMERLNKQKSALVYDIINRSNGFYSCPVDAACRSRMNIPFRIGKKEGDESLEKSFLDGA-SKLGMISLKGHRSVGGIRASLYNAVTVEDVKILAAYMEDF 363          
BLAST of Phosphoserine aminotransferase vs. Ensembl Zebrafish
Match: psat1 (phosphoserine aminotransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5723])

HSP 1 Score: 406.757 bits (1044), Expect = 1.417e-139
Identity = 196/359 (54.60%), Postives = 261/359 (72.70%), Query Frame = 2
Query:  194 INFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKE--EDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            +NF AGP+ LP+ VL   Q ELL Y G G S+LEMSHRS  F+KI N TENL+R+LL +P+NYK+LFLQGG +GQF+AVP+NLI     + A+Y+VTG WS +AA EA KYG V  + P++ S+T IPD ++W ++P ASY+YYC NETVHGVEF  IPD    + LVSDMSSN LS+ + VSKFGLIFA AQKN+G AG+T+VIVR+DL+  AL E P + +Y+   G NSLYNTPP FSIY+  L+L+W+++ GG + +  LN  K+ LVY+ I  S GFY+CPVD   RS +N+  RI  KE  E LE + +  A +K  +I +KGHR+VGG+R SLYN++++E V+IL   M+++
Sbjct:    7 VNFGAGPAKLPQSVLLQAQKELLDYSGTGISILEMSHRSSDFTKIINTTENLIRELLNVPENYKILFLQGGGSGQFSAVPLNLIGLKEERCADYLVTGTWSARAAKEAEKYGKVNVIHPKLDSYTKIPDSSTWSLNPSASYVYYCCNETVHGVEFNFIPDT-KGVILVSDMSSNFLSRPVDVSKFGLIFAGAQKNVGCAGVTVVIVREDLIGKALKECPIILDYQVQAGNNSLYNTPPCFSIYIMGLVLEWIRNNGGADAMERLNKQKSALVYDIINRSNGFYSCPVDAACRSRMNIPFRIGKKEGDESLEKSFLDGA-SKLGMISLKGHRSVGGIRASLYNAVTVEDVKILAAYMEDF 363          
BLAST of Phosphoserine aminotransferase vs. Ensembl Xenopus
Match: tmco3 (transmembrane and coiled-coil domains 3 [Source:Xenbase;Acc:XB-GENE-480794])

HSP 1 Score: 396.741 bits (1018), Expect = 1.791e-135
Identity = 194/361 (53.74%), Postives = 259/361 (71.75%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIR--NKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYR 1267
            ++NF AGP+ LP  VL   Q EL+ Y G+G S+LEMSHRS  F+KI N TE  LR+LL+IP  YKVLFLQGG +GQF+AVP+NLI     K A+Y+VTG WS KAA EA KYG V  V P++ S+T IPD  SW ++P+ASY+YYCANETVHGVEFQ +P+V   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+ IVR+DLL ++L E P+V +YK   G  SLYNTPP FSIY+  L+L+W+K+ GG   +  L+  K+ ++Y+ I+ES G + CPV++K RS +N+  RI   N + DLE   +  A  +  ++ +KGHR+VGG+R SLYN++++E VQ L   MK ++
Sbjct:    7 VLNFGAGPAKLPPSVLLEAQKELIDYRGLGISVLEMSHRSSDFTKIMNTTEVCLRELLDIPDTYKVLFLQGGGSGQFSAVPLNLIGLKDAKCADYVVTGAWSAKAAKEAEKYGKVNIVHPKLGSYTGIPDPCSWNLNPEASYVYYCANETVHGVEFQFVPEVKGTV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGCAGVTVAIVREDLLGHSLKECPTVLDYKIQAGNGSLYNTPPCFSIYIMGLVLEWIKNNGGAAAMEKLSIIKSNMIYSIIDESNGLFVCPVEEKSRSKMNIPFRIGNINGDSDLEKQFLAKA-VERGMMSLKGHRSVGGIRASLYNAVTVEDVQKLADFMKSFQ 365          
BLAST of Phosphoserine aminotransferase vs. Ensembl Xenopus
Match: tmco3 (transmembrane and coiled-coil domains 3 [Source:Xenbase;Acc:XB-GENE-480794])

HSP 1 Score: 380.563 bits (976), Expect = 3.685e-129
Identity = 189/356 (53.09%), Postives = 252/356 (70.79%), Query Frame = 2
Query:  206 AGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIR--NKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYR 1267
            A P     +VL   Q EL+ Y G+G S+LEMSHRS  F+KI N TE  LR+LL+IP  YKVLFLQGG +GQF+AVP+NLI     K A+Y+VTG WS KAA EA KYG V  V P++ S+T IPD  SW ++P+ASY+YYCANETVHGVEFQ +P+V   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+ IVR+DLL ++L E P+V +YK   G  SLYNTPP FSIY+  L+L+W+K+ GG   +  L+  K+ ++Y+ I+ES G + CPV++K RS +N+  RI   N + DLE   +  A  +  ++ +KGHR+VGG+R SLYN++++E VQ L   MK ++
Sbjct:   16 ATPCESCFKVLLEAQKELIDYRGLGISVLEMSHRSSDFTKIMNTTEVCLRELLDIPDTYKVLFLQGGGSGQFSAVPLNLIGLKDAKCADYVVTGAWSAKAAKEAEKYGKVNIVHPKLGSYTGIPDPCSWNLNPEASYVYYCANETVHGVEFQFVPEVKGTV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGCAGVTVAIVREDLLGHSLKECPTVLDYKIQAGNGSLYNTPPCFSIYIMGLVLEWIKNNGGAAAMEKLSIIKSNMIYSIIDESNGLFVCPVEEKSRSKMNIPFRIGNINGDSDLEKQFLAKA-VERGMMSLKGHRSVGGIRASLYNAVTVEDVQKLADFMKSFQ 369          
BLAST of Phosphoserine aminotransferase vs. Ensembl Xenopus
Match: tmco3 (transmembrane and coiled-coil domains 3 [Source:Xenbase;Acc:XB-GENE-480794])

HSP 1 Score: 379.793 bits (974), Expect = 3.774e-129
Identity = 186/347 (53.60%), Postives = 249/347 (71.76%), Query Frame = 2
Query:  233 VLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIR--NKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYR 1267
            +L   Q EL+ Y G+G S+LEMSHRS  F+KI N TE  LR+LL+IP  YKVLFLQGG +GQF+AVP+NLI     K A+Y+VTG WS KAA EA KYG V  V P++ S+T IPD  SW ++P+ASY+YYCANETVHGVEFQ +P+V   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+ IVR+DLL ++L E P+V +YK   G  SLYNTPP FSIY+  L+L+W+K+ GG   +  L+  K+ ++Y+ I+ES G + CPV++K RS +N+  RI   N + DLE   +  A  +  ++ +KGHR+VGG+R SLYN++++E VQ L   MK ++
Sbjct:    2 LLNSTQKELIDYRGLGISVLEMSHRSSDFTKIMNTTEVCLRELLDIPDTYKVLFLQGGGSGQFSAVPLNLIGLKDAKCADYVVTGAWSAKAAKEAEKYGKVNIVHPKLGSYTGIPDPCSWNLNPEASYVYYCANETVHGVEFQFVPEVKGTV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGCAGVTVAIVREDLLGHSLKECPTVLDYKIQAGNGSLYNTPPCFSIYIMGLVLEWIKNNGGAAAMEKLSIIKSNMIYSIIDESNGLFVCPVEEKSRSKMNIPFRIGNINGDSDLEKQFLAKA-VERGMMSLKGHRSVGGIRASLYNAVTVEDVQKLADFMKSFQ 346          
BLAST of Phosphoserine aminotransferase vs. Ensembl Xenopus
Match: tmco3 (transmembrane and coiled-coil domains 3 [Source:Xenbase;Acc:XB-GENE-480794])

HSP 1 Score: 379.407 bits (973), Expect = 1.271e-128
Identity = 187/347 (53.89%), Postives = 249/347 (71.76%), Query Frame = 2
Query:  233 VLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIR--NKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYR 1267
            VL   Q EL+ Y G+G S+LEMSHRS  F+KI N TE  LR+LL+IP  YKVLFLQGG +GQF+AVP+NLI     K A+Y+VTG WS KAA EA KYG V  V P++ S+T IPD  SW ++P+ASY+YYCANETVHGVEFQ +P+V   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+ IVR+DLL ++L E P+V +YK   G  SLYNTPP FSIY+  L+L+W+K+ GG   +  L+  K+ ++Y+ I+ES G + CPV++K RS +N+  RI   N + DLE   +  A  +  ++ +KGHR+VGG+R SLYN++++E VQ L   MK ++
Sbjct:   24 VLLEAQKELIDYRGLGISVLEMSHRSSDFTKIMNTTEVCLRELLDIPDTYKVLFLQGGGSGQFSAVPLNLIGLKDAKCADYVVTGAWSAKAAKEAEKYGKVNIVHPKLGSYTGIPDPCSWNLNPEASYVYYCANETVHGVEFQFVPEVKGTV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGCAGVTVAIVREDLLGHSLKECPTVLDYKIQAGNGSLYNTPPCFSIYIMGLVLEWIKNNGGAAAMEKLSIIKSNMIYSIIDESNGLFVCPVEEKSRSKMNIPFRIGNINGDSDLEKQFLAKA-VERGMMSLKGHRSVGGIRASLYNAVTVEDVQKLADFMKSFQ 368          
BLAST of Phosphoserine aminotransferase vs. Ensembl Xenopus
Match: tmco3 (transmembrane and coiled-coil domains 3 [Source:Xenbase;Acc:XB-GENE-480794])

HSP 1 Score: 332.028 bits (850), Expect = 7.125e-110
Identity = 161/303 (53.14%), Postives = 218/303 (71.95%), Query Frame = 2
Query:  365 EIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIR--NKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYR 1267
            +IP  YKVLFLQGG +GQF+AVP+NLI     K A+Y+VTG WS KAA EA KYG V  V P++ S+T IPD  SW ++P+ASY+YYCANETVHGVEFQ +P+V   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+ IVR+DLL ++L E P+V +YK   G  SLYNTPP FSIY+  L+L+W+K+ GG   +  L+  K+ ++Y+ I+ES G + CPV++K RS +N+  RI   N + DLE   +  A  +  ++ +KGHR+VGG+R SLYN++++E VQ L   MK ++
Sbjct:   88 DIPDTYKVLFLQGGGSGQFSAVPLNLIGLKDAKCADYVVTGAWSAKAAKEAEKYGKVNIVHPKLGSYTGIPDPCSWNLNPEASYVYYCANETVHGVEFQFVPEVKGTV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGCAGVTVAIVREDLLGHSLKECPTVLDYKIQAGNGSLYNTPPCFSIYIMGLVLEWIKNNGGAAAMEKLSIIKSNMIYSIIDESNGLFVCPVEEKSRSKMNIPFRIGNINGDSDLEKQFLAKA-VERGMMSLKGHRSVGGIRASLYNAVTVEDVQKLADFMKSFQ 388          
BLAST of Phosphoserine aminotransferase vs. Ensembl Mouse
Match: Psat1 (phosphoserine aminotransferase 1 [Source:MGI Symbol;Acc:MGI:2183441])

HSP 1 Score: 403.29 bits (1035), Expect = 3.097e-138
Identity = 192/360 (53.33%), Postives = 264/360 (73.33%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LP  VL  +Q +LL Y G+G S+LEMSHRS  F+KI   TENL+R+LL +P NYKV+F+QGG +GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W ++PDASY+Y+CANETVHGVEF  +PDV   + LV DMSSN LS+ + VSKFG+IFA AQKN+G AG+T+VIVRDDLL ++L E PSV +YK   G NSLYNTPP FSIYV  ++L+W+K+ GG   +  L++ K++++Y  I+ S+GFY CPV++++RS +N+  RI N + D  LE   +  A  + N+I +KGHR+VGG+R SLYN+++ E V+ L   MK +
Sbjct:    7 VVNFGPGPAKLPHSVLLEIQKQLLDYRGLGISVLEMSHRSSDFAKIIGNTENLVRELLAVPNNYKVIFVQGGGSGQFSAVPLNLIGLKAGRSADYVVTGAWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLNPDASYVYFCANETVHGVEFDFVPDVKGAV-LVCDMSSNFLSRPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFSLRECPSVLDYKVQAGNNSLYNTPPCFSIYVMGMVLEWIKNNGGAAAMEKLSSIKSQMIYEIIDNSQGFYVCPVERQNRSRMNIPFRIGNAKGDEALEKRFLDKA-VELNMISLKGHRSVGGIRASLYNAVTTEDVEKLAAFMKNF 364          
BLAST of Phosphoserine aminotransferase vs. Ensembl Mouse
Match: Psat1 (phosphoserine aminotransferase 1 [Source:MGI Symbol;Acc:MGI:2183441])

HSP 1 Score: 386.341 bits (991), Expect = 1.482e-131
Identity = 186/346 (53.76%), Postives = 255/346 (73.70%), Query Frame = 2
Query:  233 VLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            VL  +Q +LL Y G+G S+LEMSHRS  F+KI   TENL+R+LL +P NYKV+F+QGG +GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W ++PDASY+Y+CANETVHGVEF  +PDV   + LV DMSSN LS+ + VSKFG+IFA AQKN+G AG+T+VIVRDDLL ++L E PSV +YK   G NSLYNTPP FSIYV  ++L+W+K+ GG   +  L++ K++++Y  I+ S+GFY CPV++++RS +N+  RI N + D  LE   +  A  + N+I +KGHR+VGG+R SLYN+++ E V+ L   MK +
Sbjct:   18 VLLEIQKQLLDYRGLGISVLEMSHRSSDFAKIIGNTENLVRELLAVPNNYKVIFVQGGGSGQFSAVPLNLIGLKAGRSADYVVTGAWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLNPDASYVYFCANETVHGVEFDFVPDVKGAV-LVCDMSSNFLSRPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFSLRECPSVLDYKVQAGNNSLYNTPPCFSIYVMGMVLEWIKNNGGAAAMEKLSSIKSQMIYEIIDNSQGFYVCPVERQNRSRMNIPFRIGNAKGDEALEKRFLDKA-VELNMISLKGHRSVGGIRASLYNAVTTEDVEKLAAFMKNF 361          
BLAST of Phosphoserine aminotransferase vs. Ensembl Mouse
Match: Psat1 (phosphoserine aminotransferase 1 [Source:MGI Symbol;Acc:MGI:2183441])

HSP 1 Score: 204.142 bits (518), Expect = 1.354e-63
Identity = 94/158 (59.49%), Postives = 121/158 (76.58%), Query Frame = 2
Query:  296 MSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASA 769
            MSHRS  F+KI   TENL+R+LL +P NYKV+F+QGG +GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W ++PDASY+Y+CANETVHGVEF  +PDV   + LV DMSSN LS+ + VSKFG+IFA A
Sbjct:    1 MSHRSSDFAKIIGNTENLVRELLAVPNNYKVIFVQGGGSGQFSAVPLNLIGLKAGRSADYVVTGAWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLNPDASYVYFCANETVHGVEFDFVPDVKGAV-LVCDMSSNFLSRPVDVSKFGVIFAGA 157          
BLAST of Phosphoserine aminotransferase vs. UniProt/SwissProt
Match: sp|P10658|SERC_RABIT (Phosphoserine aminotransferase OS=Oryctolagus cuniculus OX=9986 GN=PSAT1 PE=2 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 2.454e-140
Identity = 201/360 (55.83%), Postives = 264/360 (73.33%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            I+NF  GP+ LP  VL  +Q ELL Y G+G S+LEMSHRS  F+KI N TENL+R+LL +P NYKV+FLQGG  GQF+AVP+NLI   P + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W ++PDASY+YYCANETVHGVEF  +PDV   I LV DMSSN LS+ + VSKFG+IFA AQKN+G AG+T+VIVRDDLL +AL E PSV  YK     +SLYNTPP FSIYV  L+L+W+K+ GG   +  L+T K++++Y  I+ S+GFY CPV+ ++RS +N+  RI N + D  LE   +  A  + ++I +KGHR+VGG+RVSLYN++++E VQ L   MK +
Sbjct:    7 IVNFGPGPAKLPHSVLLEIQKELLDYKGLGISVLEMSHRSSDFAKIVNNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKPGRCADYVVTGAWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFVPDVKGAI-LVCDMSSNFLSRPVDVSKFGVIFAGAQKNVGAAGVTVVIVRDDLLGFALRECPSVLEYKVQATSSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMKKLSTIKSQMIYEIIDNSQGFYVCPVEPRNRSMMNIPFRIGNAKGDEALEKRFLDKA-LELHMISLKGHRSVGGVRVSLYNAVTIEDVQKLASFMKNF 364          
BLAST of Phosphoserine aminotransferase vs. UniProt/SwissProt
Match: sp|Q9Y617|SERC_HUMAN (Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1 PE=1 SV=2)

HSP 1 Score: 406.371 bits (1043), Expect = 1.425e-138
Identity = 199/360 (55.28%), Postives = 263/360 (73.06%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LP  VL  +Q ELL Y GVG S+LEMSHRS  F+KI N TENL+R+LL +P NYKV+FLQGG  GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G +  V P++ S+T IPD ++W ++PDASY+YYCANETVHGVEF  IPDV   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+VIVRDDLL +AL E PSV  YK   G +SLYNTPP FSIYV  L+L+W+K+ GG   +  L++ K++ +Y  I+ S+GFY CPV+ ++RS +N+  RI N + D  LE   +  A  + N++ +KGHR+VGG+R SLYN++++E VQ L   MK++
Sbjct:    7 VVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKA-LELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKF 364          
BLAST of Phosphoserine aminotransferase vs. UniProt/SwissProt
Match: sp|Q99K85|SERC_MOUSE (Phosphoserine aminotransferase OS=Mus musculus OX=10090 GN=Psat1 PE=1 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 2.166e-137
Identity = 192/360 (53.33%), Postives = 264/360 (73.33%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LP  VL  +Q +LL Y G+G S+LEMSHRS  F+KI   TENL+R+LL +P NYKV+F+QGG +GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W ++PDASY+Y+CANETVHGVEF  +PDV   + LV DMSSN LS+ + VSKFG+IFA AQKN+G AG+T+VIVRDDLL ++L E PSV +YK   G NSLYNTPP FSIYV  ++L+W+K+ GG   +  L++ K++++Y  I+ S+GFY CPV++++RS +N+  RI N + D  LE   +  A  + N+I +KGHR+VGG+R SLYN+++ E V+ L   MK +
Sbjct:    7 VVNFGPGPAKLPHSVLLEIQKQLLDYRGLGISVLEMSHRSSDFAKIIGNTENLVRELLAVPNNYKVIFVQGGGSGQFSAVPLNLIGLKAGRSADYVVTGAWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLNPDASYVYFCANETVHGVEFDFVPDVKGAV-LVCDMSSNFLSRPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFSLRECPSVLDYKVQAGNNSLYNTPPCFSIYVMGMVLEWIKNNGGAAAMEKLSSIKSQMIYEIIDNSQGFYVCPVERQNRSRMNIPFRIGNAKGDEALEKRFLDKA-VELNMISLKGHRSVGGIRASLYNAVTTEDVEKLAAFMKNF 364          
BLAST of Phosphoserine aminotransferase vs. UniProt/SwissProt
Match: sp|Q9VAN0|SERC_DROME (Probable phosphoserine aminotransferase OS=Drosophila melanogaster OX=7227 GN=CG11899 PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 2.360e-130
Identity = 185/357 (51.82%), Postives = 257/357 (71.99%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCM 1255
            +INF+AGP+ LP EVLK VQ  L++ +G G S++EMSHRS +++KI + T + LR+LL +P NYK+L +QGG TGQFAAV +NLI +     A+Y++TG WS KAA EAA+YG V  V P++  +TT+P + +W++DP+ASY+YYC NETV GVEF  +P+VP  +PLV+DMSSN LS+   VSKFG+I+A AQKNIG AG T++IVRDDL+   L  TPS+ N++ +D  NSL NTPPTF IYV  L+ KW+K  GG+  ++ L  AK++L+Y+ I +S GFY CPVD   RS +NV  RI +   D  LE   +  A+ +  +I++KGHR+VGG+R SLYN++++ + Q L   M
Sbjct:    2 VINFAAGPAKLPEEVLKEVQENLVNCNGSGISVMEMSHRSSNYAKIHDATISDLRELLNVPSNYKILLMQGGGTGQFAAVALNLIGK--TGTADYVITGSWSAKAAKEAAQYGTVNAVLPKLAKYTTVPRQETWKLDPNASYVYYCDNETVEGVEFDFVPEVPAGVPLVADMSSNFLSRPFDVSKFGVIYAGAQKNIGPAGTTVIIVRDDLIGKHLKITPSILNFEQMDKNNSLLNTPPTFGIYVMGLVFKWIKRNGGVAGMAKLAAAKSKLIYDTINQSNGFYYCPVDVNVRSRMNVPFRIGSASGDDALEKEFLSKAEAE-GMIQLKGHRSVGGIRASLYNAVTLAETQQLANLM 355          
BLAST of Phosphoserine aminotransferase vs. UniProt/SwissProt
Match: sp|P91856|SERC_CAEEL (Probable phosphoserine aminotransferase OS=Caenorhabditis elegans OX=6239 GN=F26H9.5 PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 3.878e-125
Identity = 180/360 (50.00%), Postives = 253/360 (70.28%), Query Frame = 2
Query:  194 INFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIR--NKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYR 1267
            INF+AGP+ LP EVL  +Q E L+++ +G S++EMSHRS+ F  + NET +L+R+L+ +P N+++LF+QGG TGQFAA+P+NL  +   + A+YIVTG WS+KAA EA KY NVK+VF   K + T+PD+ +W  D  A+Y+YYCANETVHG+EF        N+PLV+D+SSN +++       G++F  AQKN+G AGLT+VIVR DL+      TPSVF+YK +   NSLYNTPPT  IY   L+LKW+KS GGL  +  LN  K+ ++Y+ I+ S GFY+C VDK+ RS +NV  RI   +  ++LE   +K    + N+I +KGHR+VGG+R SLYN+IS+E+ Q+L   M E++
Sbjct:    8 INFAAGPAKLPEEVLLKMQEEQLNFNNLGVSVIEMSHRSKEFGALLNETISLIRELMNVPDNFEILFMQGGGTGQFAAIPLNL--KGDHEHADYIVTGAWSSKAADEAGKYINVKKVFQPSKPYVTVPDQENWVHDEKAAYLYYCANETVHGIEFTPTAPESHNVPLVADVSSNFMARPFDFKDHGVVFGGAQKNLGAAGLTIVIVRKDLIGKQQAITPSVFSYKEMIANNSLYNTPPTGGIYTTNLVLKWIKSKGGLQAIYELNLQKSGMIYDIIDNSNGFYHCAVDKRYRSIMNVCFRIGGPSGNDELEEKFLK-GSIERNMISLKGHRSVGGIRASLYNAISVEETQVLATWMNEFQ 364          
BLAST of Phosphoserine aminotransferase vs. TrEMBL
Match: A0A452FTN4 (Phosphoserine aminotransferase OS=Capra hircus OX=9925 GN=PSAT1 PE=3 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 1.266e-139
Identity = 204/360 (56.67%), Postives = 268/360 (74.44%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LPR VL  VQ ELL+Y G+G S+LEMSHRS  FSKI N TENL+R+LL IP NYKV+F+QGG  GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W ++PDASY+YYCANETVHGVEF  IPDV   + LV DMSSN LS+ + VSKFG+IFA AQKN+G AG+T+VIVRDDLL +AL E PSV +YK   G NSLYNTPP FSIYV  L+L+W+K+ GG   +  L++ K++++Y+ I+ S+GFY CPV+ ++RS +N+  RI N + D  LE   +  A  + N+I +KGHR+VGG+RVSLYN++++E VQ L   MK +
Sbjct:    7 VVNFGPGPAKLPRSVLLEVQKELLNYKGIGISVLEMSHRSSDFSKIINNTENLVRELLAIPDNYKVIFVQGGGCGQFSAVPLNLIGLKAGRCADYVVTGSWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWTLNPDASYVYYCANETVHGVEFDFIPDVKGAV-LVCDMSSNFLSRPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALKECPSVLDYKVQAGNNSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQMIYDIIDNSQGFYVCPVEPQNRSKMNIPFRIGNTKGDDALEKRFLDKA-LELNMISLKGHRSVGGIRVSLYNAVTVEDVQKLAAFMKNF 364          
BLAST of Phosphoserine aminotransferase vs. TrEMBL
Match: A0A480X8D9 (Phosphoserine aminotransferase OS=Sus scrofa OX=9823 PE=3 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 1.515e-139
Identity = 204/368 (55.43%), Postives = 268/368 (72.83%), Query Frame = 2
Query:  167 RNQPNMNSIINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            R   ++  ++NF AGP+ LPR VL  +Q ELL Y GVG S+LEMSHRS  FSKI N TENL+R+LL IP NYKV+F+QGG  GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W + PDASY+YYCANETVHGVEF  IPDV   + LVSDMSSN LSK + VSKFG+IFA AQKN+G AG+T+VIVRDDLL +AL E PS+ +YK   G NSLYNTPP FS+YV  L+L+W+K+ GG   +  L+  K++++Y+ I+ S+GFY CPV+ ++RS +N+  RI N + D  LE   +  A  +  +I +KGHR+VGG+R SLYN++++E VQ L   MK +
Sbjct:   22 RTMDSLMQVVNFGAGPAKLPRSVLLEIQKELLDYKGVGISVLEMSHRSSDFSKIINNTENLVRELLSIPDNYKVIFVQGGGCGQFSAVPLNLIGLKAGRCADYVVTGSWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLSPDASYVYYCANETVHGVEFDFIPDVKGAV-LVSDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSILDYKVQAGNNSLYNTPPCFSVYVMGLVLEWIKNNGGAAAMEKLSCIKSQMIYDIIDNSQGFYVCPVEPQNRSKMNIPFRIGNTKGDDALEKRFLDKA-LELKMISLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKNF 387          
BLAST of Phosphoserine aminotransferase vs. TrEMBL
Match: W5PS11 (Phosphoserine aminotransferase OS=Ovis aries OX=9940 GN=PSAT1 PE=3 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 2.087e-139
Identity = 204/360 (56.67%), Postives = 267/360 (74.17%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LPR VL  VQ ELL Y G+G S+LEMSHRS  FSKI N TENL+R+LL IP NYKV+F+QGG  GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W ++PDASY+YYCANETVHGVEF  IPDV   + LV DMSSN LS+ + VSKFG+IFA AQKN+G AG+T+VIVRDDLL +AL E PSV +YK   G NSLYNTPP FSIYV  L+L+W+K+ GG   +  L++ K++++Y+ I+ S+GFY CPV+ ++RS +N+  RI N + D  LE   +  A  + N+I +KGHR+VGG+RVSLYN++++E VQ L   MK +
Sbjct:   33 VVNFGPGPAKLPRSVLLEVQKELLDYKGIGISVLEMSHRSSDFSKIINNTENLVRELLAIPDNYKVIFVQGGGCGQFSAVPLNLIGLKAGRCADYVVTGSWSAKAAEEAKKFGTVNMVHPKLGSYTKIPDPSTWTLNPDASYVYYCANETVHGVEFDFIPDVKGAV-LVCDMSSNFLSRPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALKECPSVLDYKVQAGNNSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQMIYDIIDNSQGFYVCPVEPQNRSKMNIPFRIGNTKGDDALEKRFLDKA-LELNMISLKGHRSVGGIRVSLYNAVTVEDVQKLAAFMKNF 390          
BLAST of Phosphoserine aminotransferase vs. TrEMBL
Match: A0A340XZB3 (Phosphoserine aminotransferase OS=Lipotes vexillifer OX=118797 GN=PSAT1 PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 2.381e-139
Identity = 203/360 (56.39%), Postives = 264/360 (73.33%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LPR VL  +Q ELL Y GVG S+LEMSHRS  FSKI N TENL+R+LL IP NYKV+F+QGG  GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W + PDASY+YYCANETVHGVEF  IPDV   + LV DMSSN LSK + VSKFG IFA AQKN+G AG+T+VIVRDDLL +AL E PSV +YK   G NSLYNTPP FSIYV  L+L+W+K+ GG   +  L++ K++++Y+ ++ S+GFY CPV+ ++RS +N+  RI N + D  LE   +  A  + N+I +KGHR+VGG+R SLYN++++E VQ L   MK +
Sbjct:    7 VVNFGPGPAKLPRSVLSEIQKELLDYKGVGISVLEMSHRSSDFSKIINNTENLMRELLAIPDNYKVIFVQGGGCGQFSAVPLNLIGLKAGRCADYVVTGSWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLSPDASYVYYCANETVHGVEFDFIPDVKGAV-LVCDMSSNFLSKPVDVSKFGAIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLDYKVQAGNNSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQMIYDIVDNSQGFYVCPVEPQNRSRMNIPFRIGNTKGDDALEKRFLDKA-LELNMISLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKNF 364          
BLAST of Phosphoserine aminotransferase vs. TrEMBL
Match: A0A384A4T6 (Phosphoserine aminotransferase OS=Balaenoptera acutorostrata scammoni OX=310752 GN=LOC103018486 PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 2.514e-139
Identity = 203/360 (56.39%), Postives = 265/360 (73.61%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            ++NF  GP+ LPR VL  +Q ELL Y GVG S+LEMSHRS  FSKI N TENL+R+LL IP NYKV+F+QGG  GQF+AVP+NLI     + A+Y+VTG WS KAA EA K+G V  V P++ S+T IPD ++W + PDASY+YYCANETVHGVEF  IPDV   + LV DMSSN LSK + VSKFG+IFA AQKN+G AG+T+VIVRDDLL +AL E PSV +YK   G NSLYNTPP FSIYV  L+L+W+K+ GG   +  L++ K++++Y+ ++ S+GFY CPV+ ++RS +N+  RI N + D  LE   +  A  + N+I +KGHR+VGG+R SLYN++++E VQ L   MK +
Sbjct:    7 VVNFGPGPAKLPRSVLSEIQKELLDYKGVGISVLEMSHRSSDFSKIINNTENLVRELLAIPDNYKVIFVQGGGCGQFSAVPLNLIGLKAGRCADYVVTGSWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLSPDASYVYYCANETVHGVEFDFIPDVNGAV-LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLDYKVQAGNNSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQMIYDIVDNSQGFYVCPVEPQNRSRMNIPFRIGNTKGDDALEKRFLDKA-LELNMISLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKHF 364          
BLAST of Phosphoserine aminotransferase vs. Ensembl Cavefish
Match: psat1 (phosphoserine aminotransferase 1 [Source:NCBI gene;Acc:103024605])

HSP 1 Score: 405.986 bits (1042), Expect = 2.435e-139
Identity = 202/359 (56.27%), Postives = 258/359 (71.87%), Query Frame = 2
Query:  194 INFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            INF AGP+ LP  VL   Q ELL Y+ +G S+LEMSHRS  FSKI N TENLLR+LL IP+NYKVLFLQGG +GQF+AVP+NLI     + A+Y+VTG WS KAA EA KYG +  V P++  +T+IPD + W ++P ASY+YYC NETVHGVEF  IPD   ++ LVSDMSSN LS+ + VSKFGLIFA AQKNIG AG+T+VIVR+DLL  A  E P V +Y+   G NSLYNTPP FSIYV  L+L+W+K+ GG   +  L+  K+ L+Y+ I  S GFY+CPV++  RS +N+  RI  KE D  LE   +  A +K  +I +KGHR+VGG+R SLYN++++E  QIL   MK++
Sbjct:    7 INFGAGPAKLPPSVLLQAQKELLDYNNIGISVLEMSHRSADFSKIINTTENLLRELLNIPENYKVLFLQGGGSGQFSAVPLNLIGLKEDRCADYVVTGAWSAKAAKEAEKYGQINVVHPKLDKYTSIPDNSGWSLNPSASYVYYCCNETVHGVEFNFIPD-SKDVILVSDMSSNFLSRPVDVSKFGLIFAGAQKNIGCAGVTVVIVREDLLGKACKECPVVLDYQVQAGNNSLYNTPPCFSIYVMNLVLEWIKNNGGTEAMEKLSKQKSSLIYDVINNSGGFYSCPVNEDCRSRMNIPFRIGRKEGDEALEKLFLDGA-SKLGMISLKGHRSVGGIRASLYNAVTLEDTQILTAYMKQF 363          
BLAST of Phosphoserine aminotransferase vs. Ensembl Yeast
Match: SER1 (3-phosphoserine aminotransferase; catalyzes the formation of phosphoserine from 3-phosphohydroxypyruvate, required for serine and glycine biosynthesis; regulated by the general control of amino acid biosynthesis mediated by Gcn4p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005710])

HSP 1 Score: 260.766 bits (665), Expect = 2.745e-83
Identity = 151/384 (39.32%), Postives = 229/384 (59.64%), Query Frame = 2
Query:  197 NFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLI-----NRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKS-----FTTIPDRASWE--IDPDA-SYIYYCANETVHGVEFQEIPDV---PPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVR-----------DDLLH-YALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            +F AGP+ +P  VL+    +L++++ +G  + E+SHRS+  +K+  +++  L +LL IP  ++V +LQGG T  F++V  NL             A Y+VTG WS K+  EA +     EV    K      F  IPD + WE  I   A SY+Y C NETVHGVE+ E+P      PNI +V+D+SS+ILS+ I VS++G+I A AQKNIG+AGLTL I++           D+ LH   +P TP  F+Y  +   NS YNT P F+++V  L+ + +   GG+    A N  KA+++Y  ++ +  FYN PVD K RS +NVV  +  K++ L++  +K A  ++ +  +KGHR+VGG R S+YN++S++ VQ LV  +KE+
Sbjct:   10 HFGAGPAQMPTPVLQQAAKDLINFNDIGLGIGEISHRSKDATKVIEDSKKHLIELLNIPDTHEVFYLQGGGTTGFSSVATNLAAAYVGKHGKIAPAGYLVTGSWSQKSFEEAKRLHVPAEVIFNAKDYNNGKFGKIPDESLWEDKIKGKAFSYVYLCENETVHGVEWPELPKCLVNDPNIEIVADLSSDILSRKIDVSQYGVIMAGAQKNIGLAGLTLYIIKKSILKNISGASDETLHELGVPITPIAFDYPTVVKNNSAYNTIPIFTLHVMDLVFQHILKKGGVEAQQAENEEKAKILYEALDANSDFYNVPVDPKCRSKMNVVFTL--KKDGLDDQFLKEAAARH-LTGLKGHRSVGGFRASIYNALSVKAVQNLVDFIKEF 390          
BLAST of Phosphoserine aminotransferase vs. Ensembl Nematostella
Match: EDO41466 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S471])

HSP 1 Score: 360.147 bits (923), Expect = 2.041e-122
Identity = 178/359 (49.58%), Postives = 241/359 (67.13%), Query Frame = 2
Query:  191 IINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYR 1267
            +INF+ GP+ LP  VLK  Q E L+Y  +G S++EMSHRS  F+KI N+ EN LR+LL IP NYKVLF+QGG TGQF+AVP+N++       A+YIVTG WS KA  EA KYG V  V P+  ++ +IPD + W ++PDASY+YYC NETVHGVEF  +P+    +PLV DMSSNILS+   V KFG+I+A AQKNIG AG+T+VIVR+DL+ +A    P+VF+YK   G NSLYNTPPT+ IY+  L+ KWLKSLGG+ E+   +  K+ ++Y+ ++ S GFY C                                   N+I++KGHR+VGG+R+SLYN+I +E+V+ LV+ M +++
Sbjct:    6 VINFAPGPAKLPEVVLKKAQEEFLNYGNLGISVMEMSHRSGEFAKIINDAENDLRELLHIPDNYKVLFMQGGGTGQFSAVPLNIMKEG--GSADYIVTGAWSAKAVKEAEKYGKVNLVLPKTSTYDSIPDPSQWTLNPDASYVYYCENETVHGVEFDFVPETN-GVPLVCDMSSNILSRHFDVDKFGIIYAGAQKNIGCAGVTIVIVREDLIGHASSLCPAVFDYKIQAGQNSLYNTPPTYGIYIMGLVFKWLKSLGGVEEMERRSIIKSTMIYDVMDNSNGFY-C-----------------------------------NMIQLKGHRSVGGIRISLYNAIHLEEVEKLVKFMVKFQ 325          
BLAST of Phosphoserine aminotransferase vs. Ensembl Medaka
Match: psat1 (phosphoserine aminotransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5723])

HSP 1 Score: 332.028 bits (850), Expect = 2.185e-111
Identity = 164/303 (54.13%), Postives = 215/303 (70.96%), Query Frame = 2
Query:  362 LEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEED--LENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEY 1264
            + IP NYKVLFLQGG +GQF+AVP+NLI     + A+YIVTG WS KAA EA KYG V+ V P+M S+T IP+ +SW ++P ASY+YYC NETVHGVE+   P+    + LVSDMSSN LS+ + VSKFGLIFA AQKN+G AG+T+VIVR+DLL +AL E P V +YK    MNSLYNTPP FSIY+  L+L+W+K+ GG   +  LN  K+ ++Y+ I  S GFY CPVD   RS +NV  R+  K+ D  LE   +  A +K  +I +KGHR+VGG+R SLYN++++E  + L   M+E+
Sbjct:    1 INIPDNYKVLFLQGGGSGQFSAVPLNLIGLKEDRCADYIVTGTWSAKAAKEAEKYGKVRVVHPKMDSYTKIPEPSSWTLNPSASYVYYCCNETVHGVEYHFTPETN-GVVLVSDMSSNFLSRPVDVSKFGLIFAGAQKNVGCAGVTVVIVREDLLGHALKECPIVLDYKVQVEMNSLYNTPPCFSIYIMNLVLEWIKNNGGSVAMETLNKQKSSIIYDIINASNGFYVCPVDTTCRSRMNVPFRVGKKDGDDALEKKFLDGA-SKLGMISLKGHRSVGGMRASLYNAVTLEDTEALADYMREF 301          
BLAST of Phosphoserine aminotransferase vs. Planmine SMEST
Match: SMESG000019836.1 (SMESG000019836.1)

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 366/370 (98.92%), Postives = 368/370 (99.46%), Query Frame = 2
Query:  182 MNSIINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQLMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYRMQAVKEMS 1291
            MNSIINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWS+KAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSL+NTPPTFSIYVAQLML WLK LGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYRMQAVKEMS
Sbjct:    1 MNSIINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIANETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIVTGIWSSKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCANETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNIGIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLFNTPPTFSIYVAQLMLNWLKRLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVNVVIRIRNKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQVQILVQCMKEYRMQAVKEMS 370          
The following BLAST results are available for this feature:
BLAST of Phosphoserine aminotransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PSAT12.967e-13955.28phosphoserine aminotransferase 1 [Source:HGNC Symb... [more]
PSAT12.155e-12050.56phosphoserine aminotransferase 1 [Source:HGNC Symb... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F26H9.53.048e-12650.00Probable phosphoserine aminotransferase [Source:U... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG118992.354e-13151.82gene:FBgn0014427 transcript:FBtr0085390[more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psat11.417e-13954.60phosphoserine aminotransferase 1 [Source:ZFIN;Acc:... [more]
psat11.417e-13954.60phosphoserine aminotransferase 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmco31.791e-13553.74transmembrane and coiled-coil domains 3 [Source:Xe... [more]
tmco33.685e-12953.09transmembrane and coiled-coil domains 3 [Source:Xe... [more]
tmco33.774e-12953.60transmembrane and coiled-coil domains 3 [Source:Xe... [more]
tmco31.271e-12853.89transmembrane and coiled-coil domains 3 [Source:Xe... [more]
tmco37.125e-11053.14transmembrane and coiled-coil domains 3 [Source:Xe... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Psat13.097e-13853.33phosphoserine aminotransferase 1 [Source:MGI Symbo... [more]
Psat11.482e-13153.76phosphoserine aminotransferase 1 [Source:MGI Symbo... [more]
Psat11.354e-6359.49phosphoserine aminotransferase 1 [Source:MGI Symbo... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10658|SERC_RABIT2.454e-14055.83Phosphoserine aminotransferase OS=Oryctolagus cuni... [more]
sp|Q9Y617|SERC_HUMAN1.425e-13855.28Phosphoserine aminotransferase OS=Homo sapiens OX=... [more]
sp|Q99K85|SERC_MOUSE2.166e-13753.33Phosphoserine aminotransferase OS=Mus musculus OX=... [more]
sp|Q9VAN0|SERC_DROME2.360e-13051.82Probable phosphoserine aminotransferase OS=Drosoph... [more]
sp|P91856|SERC_CAEEL3.878e-12550.00Probable phosphoserine aminotransferase OS=Caenorh... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A452FTN41.266e-13956.67Phosphoserine aminotransferase OS=Capra hircus OX=... [more]
A0A480X8D91.515e-13955.43Phosphoserine aminotransferase OS=Sus scrofa OX=98... [more]
W5PS112.087e-13956.67Phosphoserine aminotransferase OS=Ovis aries OX=99... [more]
A0A340XZB32.381e-13956.39Phosphoserine aminotransferase OS=Lipotes vexillif... [more]
A0A384A4T62.514e-13956.39Phosphoserine aminotransferase OS=Balaenoptera acu... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psat12.435e-13956.27phosphoserine aminotransferase 1 [Source:NCBI gene... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SER12.745e-8339.323-phosphoserine aminotransferase; catalyzes the fo... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO414662.041e-12249.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psat12.185e-11154.13phosphoserine aminotransferase 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Phosphoserine aminotransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000019836.10.000e+098.92SMESG000019836.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029500 ID=SMED30029500|Name=Phosphoserine aminotransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1435bp
GTAGCCTATCAGCAGATTGATTCTGATCTCGGGTGTTACAGGCACAACAA
TTAAGTAACGTAATCATTTCATGTGCCAAACCCGGTCTAGATAAGACAGA
TCAAAGTCCAGAATATGCATTCAGTAATCAGCTTACATAATCTCGGTATA
AATATATTTCACCAGTCGGAATCAACCAAACATGAATTCAATCATTAATT
TTTCTGCGGGTCCGTCCAATTTGCCTAGAGAGGTATTGAAAATAGTGCAA
GGAGAACTGCTCTCGTATGATGGTGTTGGTTACAGCCTCCTTGAAATGTC
TCACAGATCAGAACATTTCAGCAAAATTGCCAATGAGACTGAAAACCTAT
TGAGAGACCTCCTGGAAATTCCGAAAAATTATAAAGTGCTCTTCTTGCAA
GGCGGTGCAACTGGCCAGTTCGCTGCCGTGCCAATGAATTTAATCAACCG
AAATCCCTGCAAGAAAGCTAACTATATAGTCACAGGGATATGGTCAAACA
AGGCTGCCACTGAAGCGGCAAAATATGGAAATGTAAAAGAAGTCTTTCCA
AGAATGAAATCCTTCACAACGATTCCTGATCGTGCTTCGTGGGAGATTGA
TCCGGACGCTTCCTACATTTATTACTGTGCCAATGAAACTGTCCACGGAG
TGGAATTCCAAGAAATTCCTGACGTTCCTCCCAACATTCCCCTCGTGAGT
GACATGTCAAGTAACATTCTCAGTAAATCCATTCCAGTTTCAAAATTTGG
GTTGATTTTTGCTTCTGCCCAAAAAAACATTGGAATCGCCGGTTTAACAC
TCGTCATTGTCCGAGATGACCTTCTGCATTACGCTTTGCCGGAAACTCCT
TCGGTGTTCAATTACAAATGTCTGGACGGAATGAATTCTTTATACAATAC
TCCTCCAACCTTTTCAATCTATGTTGCTCAGCTCATGTTAAAATGGTTGA
AAAGTTTGGGAGGCCTCAATGAAGTTTCCGCTTTGAACACAGCAAAAGCT
GAACTAGTCTACAATTGCATTGAAGAGAGCGAAGGCTTTTATAACTGTCC
AGTTGACAAGAAAGATCGAAGCTTTGTTAATGTTGTAATCAGAATCAGAA
ATAAGGAAGAAGATCTGGAAAATGCATTAGTAAAATTTGCGAAGACCAAG
TATAACATAATTGAGATAAAAGGACATCGAGCTGTTGGAGGACTGAGAGT
ATCCCTGTACAATTCCATTTCCATGGAACAGGTCCAAATCCTAGTCCAGT
GCATGAAAGAATACCGAATGCAGGCAGTCAAAGAAATGTCAAAAAATATC
TGAATTTTCATACTTTGTGTACATTTTATTACTCATTGTCCATGATGTTA
TTGAATATGATTCAAGGGATATGATTTATGGTTTCCTATGCCCTCCCCTC
CATTATCTAGGTCGTTTCATTAGCAAATAATAAAG
back to top

protein sequence of SMED30029500-orf-1

>SMED30029500-orf-1 ID=SMED30029500-orf-1|Name=SMED30029500-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=374bp
MNSIINFSAGPSNLPREVLKIVQGELLSYDGVGYSLLEMSHRSEHFSKIA
NETENLLRDLLEIPKNYKVLFLQGGATGQFAAVPMNLINRNPCKKANYIV
TGIWSNKAATEAAKYGNVKEVFPRMKSFTTIPDRASWEIDPDASYIYYCA
NETVHGVEFQEIPDVPPNIPLVSDMSSNILSKSIPVSKFGLIFASAQKNI
GIAGLTLVIVRDDLLHYALPETPSVFNYKCLDGMNSLYNTPPTFSIYVAQ
LMLKWLKSLGGLNEVSALNTAKAELVYNCIEESEGFYNCPVDKKDRSFVN
VVIRIRNKEEDLENALVKFAKTKYNIIEIKGHRAVGGLRVSLYNSISMEQ
VQILVQCMKEYRMQAVKEMSKNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015421PyrdxlP-dep_Trfase_major
IPR000192Aminotrans_V_dom
IPR022278Pser_aminoTfrase
IPR020578Aminotrans_V_PyrdxlP_BS
IPR015424PyrdxlP-dep_Trfase
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004648O-phospho-L-serine:2-oxoglutarate aminotransferase activity
GO:0008483transaminase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006564L-serine biosynthetic process
GO:0008652cellular amino acid biosynthetic process