KN motif and ankyrin repeat domain-containing protein 4 isoform X2

Overview
NameKN motif and ankyrin repeat domain-containing protein 4 isoform X2
Smed IDSMED30029492
Length (bp)4723
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 (SMED30029492) t-SNE clustered cells

Violin plots show distribution of expression levels for KN motif and ankyrin repeat domain-containing protein 4 isoform X2 (SMED30029492) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 (SMED30029492) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for KN motif and ankyrin repeat domain-containing protein 4 isoform X2 (SMED30029492) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029492

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029492SMESG000059500.1 dd_Smed_v4_7499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029492SMESG000059500.1 dd_Smed_v4_7499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30029492SMESG000059500.1 dd_Smed_v4_7499_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029492SMESG000059500.1 dd_Smed_v4_7499_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029492SMESG000059500.1 dd_Smed_v4_7499_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Human
Match: KANK4 (KN motif and ankyrin repeat domains 4 [Source:HGNC Symbol;Acc:HGNC:27263])

HSP 1 Score: 93.9745 bits (232), Expect = 1.738e-19
Identity = 64/248 (25.81%), Postives = 127/248 (51.21%), Query Frame = 3
Query: 3717 WLNTSKLVSMNNIEHMPQ------EMIKPCLMLI--DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLA-EQNNFSEISALFTQRRSIRRS 4427
            +LN  + +S    +H+P+      ++++  L  I  +W+     K SS  ++ +  + +   + +F+K LV   D  GNT +HY + H  +    ++  TG+ + +  N  G+T +M+   A+ +  +++    + KL  + ++N+Q+ + GQTA+ L   HD ++ +  L +  AD+N++D + ++ LM+A    N+  V+ +LA P     L +K G +AL +A +     EI+ L        RS
Sbjct:  123 FLNACRALS----QHLPETGTTTDQLLRQSLNTISQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIVKLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAV--VWKLLREGNVNIQATQGGQTALMLGVSHDREDMVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTDKAGRTALSIALKSPTHMEIAGLLRAHAEQGRS 364          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Human
Match: KANK4 (KN motif and ankyrin repeat domains 4 [Source:HGNC Symbol;Acc:HGNC:27263])

HSP 1 Score: 93.5893 bits (231), Expect = 1.876e-19
Identity = 64/248 (25.81%), Postives = 127/248 (51.21%), Query Frame = 3
Query: 3717 WLNTSKLVSMNNIEHMPQ------EMIKPCLMLI--DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLA-EQNNFSEISALFTQRRSIRRS 4427
            +LN  + +S    +H+P+      ++++  L  I  +W+     K SS  ++ +  + +   + +F+K LV   D  GNT +HY + H  +    ++  TG+ + +  N  G+T +M+   A+ +  +++    + KL  + ++N+Q+ + GQTA+ L   HD ++ +  L +  AD+N++D + ++ LM+A    N+  V+ +LA P     L +K G +AL +A +     EI+ L        RS
Sbjct:  107 FLNACRALS----QHLPETGTTTDQLLRQSLNTISQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIVKLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAV--VWKLLREGNVNIQATQGGQTALMLGVSHDREDMVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTDKAGRTALSIALKSPTHMEIAGLLRAHAEQGRS 348          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Human
Match: KANK4 (KN motif and ankyrin repeat domains 4 [Source:HGNC Symbol;Acc:HGNC:27263])

HSP 1 Score: 93.5893 bits (231), Expect = 2.259e-18
Identity = 64/248 (25.81%), Postives = 127/248 (51.21%), Query Frame = 3
Query: 3717 WLNTSKLVSMNNIEHMPQ------EMIKPCLMLI--DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLA-EQNNFSEISALFTQRRSIRRS 4427
            +LN  + +S    +H+P+      ++++  L  I  +W+     K SS  ++ +  + +   + +F+K LV   D  GNT +HY + H  +    ++  TG+ + +  N  G+T +M+   A+ +  +++    + KL  + ++N+Q+ + GQTA+ L   HD ++ +  L +  AD+N++D + ++ LM+A    N+  V+ +LA P     L +K G +AL +A +     EI+ L        RS
Sbjct:  751 FLNACRALS----QHLPETGTTTDQLLRQSLNTISQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIVKLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAV--VWKLLREGNVNIQATQGGQTALMLGVSHDREDMVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTDKAGRTALSIALKSPTHMEIAGLLRAHAEQGRS 992          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Human
Match: KANK3 (KN motif and ankyrin repeat domains 3 [Source:HGNC Symbol;Acc:HGNC:24796])

HSP 1 Score: 90.8929 bits (224), Expect = 1.439e-17
Identity = 64/240 (26.67%), Postives = 117/240 (48.75%), Query Frame = 3
Query: 3789 LMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHI-RKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEI-SGYSKILSSNSNPISPRTFRKYT 4502
            L+  +W+     + S  + +  +   +       +  +V   D  GNT +HY + H      S++  TG  + N  N  G++ +MLAA   V  E  +  + ++L    D+N ++ + GQTA+ L+  H   + + TL A GAD+N +D++  T LM A+    +  V+ +L  PG    + + +G SAL +A +    E++AL     S  + +  +G  +   S+  P  PR F+K++
Sbjct:  578 LVAQEWFRVSSQRRSQAEPVARMLEGVRRLGPELLAHVVNLADGNGNTALHYSVSHGNLAIASLLLDTGACEVNRQNRAGYSALMLAALTSVRQEEEDMAVVQRLFCMGDVNAKASQTGQTALMLAISHGRQDMVATLLACGADVNAQDADGATALMCASEYGRLDTVRLLLTQPGCDPAILDNEGTSALAIALEAEQDEVAALLHAHLSSGQPDTQAGVQRHNLSSLQPPPPR-FKKFS 816          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Human
Match: KANK1 (KN motif and ankyrin repeat domains 1 [Source:HGNC Symbol;Acc:HGNC:19309])

HSP 1 Score: 87.8113 bits (216), Expect = 1.470e-17
Identity = 58/204 (28.43%), Postives = 106/204 (51.96%), Query Frame = 3
Query: 3885 NFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISPRTFRK 4496
            + +++++   D  GNT +HY + H  +E   ++    + + +  N  G+T +MLAA   V  E     + +L    D+N ++ + GQTA+ L+  H   + +  L A GAD+NI+D E +T LM A+   +++ VK +LA PG    L++ DG++AL +A +    +I+ L     +  +++            +P +PR  RK
Sbjct:  149 DVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQ------------SPGTPRLGRK 340          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Celegans
Match: vab-19 (VAB-19 [Source:UniProtKB/TrEMBL;Acc:G5EDN8])

HSP 1 Score: 95.5153 bits (236), Expect = 2.201e-19
Identity = 60/186 (32.26%), Postives = 100/186 (53.76%), Query Frame = 3
Query: 3900 LVIN-RDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKIL 4454
            +V+N  DQ GNT +HY + H  +   S I  +G  D +  N  G+T +MLAA  Q+ D++    + +L    ++N ++ +HGQTA+ L+  H    T   L A GA++N +D + +T LM A    + + VK +LA   V   L + D ++AL +A +N+  EI  +     +  R +ISG +  +
Sbjct:  855 MVVNFCDQNGNTALHYAVSHANFAVVSSILDSGECDLDAPNRAGYTAVMLAALSQLDDDMEKAVVHRLFQMGNVNAKASQHGQTALMLAVSHGKKTTTELLLACGANVNEQDQDGSTALMCAAEHGHKELVKMLLAENLVNASLTDVDNSTALSIALENDHREIGVMIYAYLNYGRLDISGPTSTI 1040          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0303758)

HSP 1 Score: 98.9821 bits (245), Expect = 3.752e-21
Identity = 57/203 (28.08%), Postives = 105/203 (51.72%), Query Frame = 3
Query: 3888 FVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISPRTFRK 4496
             +++ V   D  GNT MHY + H  ++  S++  + + D N  N  G+T +ML +  ++        + +L   AD+N+++K+H QTA+ L+  H N + +  L   GADINI+D + +T LM A     +  +K +L+ P     + + DG++A K+A Q    ++  L      + RS++       ++ S+ ISP   ++
Sbjct:  242 LLEYCVNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKMADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGADINIQDEDGSTALMCAAEHGRVDVIKHLLSHPECDSLVTDVDGSTAFKIAWQAGHRDVGLLIYVHEQMLRSKLPNRGD--ATRSSLISPPRHKR 442          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0087429)

HSP 1 Score: 96.2857 bits (238), Expect = 1.872e-19
Identity = 53/182 (29.12%), Postives = 96/182 (52.75%), Query Frame = 3
Query: 3888 FVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEI 4433
             +++ V   D  GNT MHY + H  ++  S++  + + D N  N  G+T +ML +  ++        + +L   AD+N+++K+H QTA+ L+  H N + +  L   GADINI+D + +T LM A     +  +K +L+ P     + + DG++A K+A Q    ++  L      + RS++
Sbjct: 1097 LLEYCVNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKMADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGADINIQDEDGSTALMCAAEHGRVDVIKHLLSHPECDSLVTDVDGSTAFKIAWQAGHRDVGLLIYVHEQMLRSKL 1278          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0112929)

HSP 1 Score: 95.9005 bits (237), Expect = 2.572e-19
Identity = 53/182 (29.12%), Postives = 96/182 (52.75%), Query Frame = 3
Query: 3888 FVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEI 4433
             +++ V   D  GNT MHY + H  ++  S++  + + D N  N  G+T +ML +  ++        + +L   AD+N+++K+H QTA+ L+  H N + +  L   GADINI+D + +T LM A     +  +K +L+ P     + + DG++A K+A Q    ++  L      + RS++
Sbjct: 1135 LLEYCVNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKMADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGADINIQDEDGSTALMCAAEHGRVDVIKHLLSHPECDSLVTDVDGSTAFKIAWQAGHRDVGLLIYVHEQMLRSKL 1316          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0332856)

HSP 1 Score: 95.5153 bits (236), Expect = 2.631e-19
Identity = 53/182 (29.12%), Postives = 96/182 (52.75%), Query Frame = 3
Query: 3888 FVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEI 4433
             +++ V   D  GNT MHY + H  ++  S++  + + D N  N  G+T +ML +  ++        + +L   AD+N+++K+H QTA+ L+  H N + +  L   GADINI+D + +T LM A     +  +K +L+ P     + + DG++A K+A Q    ++  L      + RS++
Sbjct:  835 LLEYCVNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKMADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGADINIQDEDGSTALMCAAEHGRVDVIKHLLSHPECDSLVTDVDGSTAFKIAWQAGHRDVGLLIYVHEQMLRSKL 1016          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0303756)

HSP 1 Score: 95.5153 bits (236), Expect = 2.762e-19
Identity = 53/182 (29.12%), Postives = 96/182 (52.75%), Query Frame = 3
Query: 3888 FVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEI 4433
             +++ V   D  GNT MHY + H  ++  S++  + + D N  N  G+T +ML +  ++        + +L   AD+N+++K+H QTA+ L+  H N + +  L   GADINI+D + +T LM A     +  +K +L+ P     + + DG++A K+A Q    ++  L      + RS++
Sbjct:  859 LLEYCVNLSDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKMADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGADINIQDEDGSTALMCAAEHGRVDVIKHLLSHPECDSLVTDVDGSTAFKIAWQAGHRDVGLLIYVHEQMLRSKL 1040          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Zebrafish
Match: kank1b (KN motif and ankyrin repeat domains 1b [Source:ZFIN;Acc:ZDB-GENE-060526-260])

HSP 1 Score: 98.2117 bits (243), Expect = 3.465e-20
Identity = 65/244 (26.64%), Postives = 122/244 (50.00%), Query Frame = 3
Query: 3681 ENIFQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLI--DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            E +      + + LN SK +S  N EH      + CL  +  +W+     K    Q++    +     + + + ++    DQ GNT +HY + H  +    V+ A G+ + +  N  G+T +MLA  A ++  ++++   +++L  + D+N ++ + GQTA+ L+  H   + +  L A GA++NI+D E ++ LM A    +   VK +LA PG    L + D ++AL +A +    +I+ L 
Sbjct:  392 EKMLSACQTLEIHLNGSKTIS--NREH------RSCLSTVQQEWFCVSSQKRVCPQIVEDFLFACCQVSPDVLCYVANMPDQNGNTALHYSVSHSNFSVVKVLLAAGVCNIDHQNKAGYTPIMLASLAAVETKEDMIV--VQELFSRGDVNAKASQAGQTALMLAVSHGRLDMVQALLAAGAEVNIQDDEGSSALMCAGEHGHADIVKLLLAQPGCDATLTDNDESTALSIALEAGHKDIAMLI 625          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Zebrafish
Match: kank3 (KN motif and ankyrin repeat domains 3 [Source:ZFIN;Acc:ZDB-GENE-081105-185])

HSP 1 Score: 94.7449 bits (234), Expect = 3.726e-20
Identity = 63/231 (27.27%), Postives = 119/231 (51.52%), Query Frame = 3
Query: 3798 IDWWVDMVIKLSSNQLLTTVQYLI--STFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISPR 4484
            ++W+     K++  Q L    YL+  S  +   ++ +V   D  GNT +HY + H  +    ++  TG+ + N  N  G+T +MLAA   V +E     ++KL    ++N ++ + GQTA+ L+  H     +  L   GA++NI+D E +T LM A+     + V  +L  PG  + + + DG++AL +A + + ++I+ L     +  +++     K  +++ +P SPR
Sbjct:  114 LEWFRVSSAKMA--QPLRVSNYLMAFSEVSPVLLEHIVNMTDGNGNTALHYSVSHSNFAVVDLLLDTGMCNVNQQNKAGYTAVMLAALSAVKEEDEMAVVQKLFRLGNVNAKASQAGQTALMLAVSHGRQEMVRALLDCGANVNIQDDEGSTALMCASEHGRAEIVSLLLEQPGCDISIVDNDGSNALSIALEASHNDIAVLLYAHMNYSKTQADASPK--ANSRSPSSPR 340          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Zebrafish
Match: kank1a (KN motif and ankyrin repeat domains 1a [Source:ZFIN;Acc:ZDB-GENE-060526-215])

HSP 1 Score: 96.2857 bits (238), Expect = 2.369e-19
Identity = 68/281 (24.20%), Postives = 138/281 (49.11%), Query Frame = 3
Query: 3690 FQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLI--DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAA--TLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKI-LSSNSNPISPRTFRKYTYN*SR 4517
            +++S +++   N  K   +N+ + +  + ++PC+  +  +W+     K +  +++        + +   ++ +V   D  GNT +HY + H  +     +    + + N  N  G+T +MLAA   ++ P ++    + +L  K D+N ++ + GQT + L+  H   + +  L A GAD+NI+D E +T LM A+   +++ VK +LA PG    L + D ++AL +A +    +I+ L              Y+ +  S   +P +PR  RK + + +R
Sbjct: 1040 YELSEKMLSACNILK-SHLNDPKALSSKDVRPCVNTVQHEWFRVSSQKTAVAEMVEDYLNAFRSISPALLQHIVNMADGNGNTALHYSVSHSNFHIVKKLLEADVCNVNQQNKAGYTPIMLAALAAVEAPKDM--RVVDELFSKGDVNAKASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCDPTLSDNDESNALSIALEAGHKDIAVLL-------------YAHMNFSKAQSPGTPRLGRKTSPSPTR 1304          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Zebrafish
Match: kank1a (KN motif and ankyrin repeat domains 1a [Source:ZFIN;Acc:ZDB-GENE-060526-215])

HSP 1 Score: 96.2857 bits (238), Expect = 2.614e-19
Identity = 68/281 (24.20%), Postives = 138/281 (49.11%), Query Frame = 3
Query: 3690 FQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLI--DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAA--TLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKI-LSSNSNPISPRTFRKYTYN*SR 4517
            +++S +++   N  K   +N+ + +  + ++PC+  +  +W+     K +  +++        + +   ++ +V   D  GNT +HY + H  +     +    + + N  N  G+T +MLAA   ++ P ++    + +L  K D+N ++ + GQT + L+  H   + +  L A GAD+NI+D E +T LM A+   +++ VK +LA PG    L + D ++AL +A +    +I+ L              Y+ +  S   +P +PR  RK + + +R
Sbjct: 1032 YELSEKMLSACNILK-SHLNDPKALSSKDVRPCVNTVQHEWFRVSSQKTAVAEMVEDYLNAFRSISPALLQHIVNMADGNGNTALHYSVSHSNFHIVKKLLEADVCNVNQQNKAGYTPIMLAALAAVEAPKDM--RVVDELFSKGDVNAKASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCDPTLSDNDESNALSIALEAGHKDIAVLL-------------YAHMNFSKAQSPGTPRLGRKTSPSPTR 1296          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Zebrafish
Match: kank3 (KN motif and ankyrin repeat domains 3 [Source:ZFIN;Acc:ZDB-GENE-081105-185])

HSP 1 Score: 95.9005 bits (237), Expect = 2.772e-19
Identity = 63/231 (27.27%), Postives = 119/231 (51.52%), Query Frame = 3
Query: 3798 IDWWVDMVIKLSSNQLLTTVQYLI--STFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISPR 4484
            ++W+     K++  Q L    YL+  S  +   ++ +V   D  GNT +HY + H  +    ++  TG+ + N  N  G+T +MLAA   V +E     ++KL    ++N ++ + GQTA+ L+  H     +  L   GA++NI+D E +T LM A+     + V  +L  PG  + + + DG++AL +A + + ++I+ L     +  +++     K  +++ +P SPR
Sbjct:  682 LEWFRVSSAKMA--QPLRVSNYLMAFSEVSPVLLEHIVNMTDGNGNTALHYSVSHSNFAVVDLLLDTGMCNVNQQNKAGYTAVMLAALSAVKEEDEMAVVQKLFRLGNVNAKASQAGQTALMLAVSHGRQEMVRALLDCGANVNIQDDEGSTALMCASEHGRAEIVSLLLEQPGCDISIVDNDGSNALSIALEASHNDIAVLLYAHMNYSKTQADASPK--ANSRSPSSPR 908          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Xenopus
Match: cnnm1 (cyclin and CBS domain divalent metal cation transport mediator 1 [Source:Xenbase;Acc:XB-GENE-989587])

HSP 1 Score: 94.7449 bits (234), Expect = 1.175e-18
Identity = 66/251 (26.29%), Postives = 126/251 (50.20%), Query Frame = 3
Query: 3777 IKPCLMLI--DWWVDMVIKLSSNQ--LLTTVQYLISTF---NKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAA--TLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKI-LSSNSNPISPRTFRKY 4499
            ++ CL  +  +W+     ++SS +  +   V+  I+ F   +   + +++   D  GNT +HY + H  ++   ++    + + N  N  G+T +MLAA   ++ P ++    + +L    D+N ++ + GQTA+ L+  H   + +  L A GAD+NI+D E +T LM A+   +++ VK +LA  G    L++ DG+SAL +A      +I+ +              Y+ +  S   +P +PR  RK+
Sbjct: 1102 VRLCLTTVQNEWF-----RVSSQKSAVAPMVEDYITAFKDLSPAVLSYIINMADGNGNTALHYSVSHSNFDIVKLLLDADVCNVNQQNKAGYTPIMLAALAAVEAPKDM--GVVEELFGSGDVNAKASQAGQTALMLAVSHGRIDMVRALLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQHGCNAALEDNDGSSALSIALDAGHKDIAVIL-------------YAHLNFSKTPSPGTPRLSRKF 1332          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Xenopus
Match: clasp1 (cytoplasmic linker associated protein 1 [Source:Xenbase;Acc:XB-GENE-6049805])

HSP 1 Score: 89.3521 bits (220), Expect = 3.761e-17
Identity = 54/186 (29.03%), Postives = 96/186 (51.61%), Query Frame = 3
Query: 3855 VQYLISTFNKNFVKFL--VIN-RDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFT 4403
            +++ ++ F     + L  +IN  D +GNT +HY +    + +   +  TGL D N  N  GFT +ML A      +     + ++    D+N ++ + GQTA+ L+  H   + +  L A GAD+NI+D + +T LM A    +   V  +LA P   + L + DG++AL +A +   ++I+ L +
Sbjct:  674 IRHHLTVFRAMSPRLLEVIINMADAKGNTAVHYAVSQSNFTAVRQLLDTGLCDVNRQNKAGFTPLMLTALAAFRSDEDIETVTQMLRLGDVNCRASQAGQTALMLAVSHGRLDVVRALLACGADVNIQDHDGSTALMCACEHGHADIVSLLLAVPACDVSLTDNDGSTALSIALEAGQNDIAMLLS 859          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Xenopus
Match: clasp1 (cytoplasmic linker associated protein 1 [Source:Xenbase;Acc:XB-GENE-6049805])

HSP 1 Score: 89.3521 bits (220), Expect = 4.089e-17
Identity = 54/186 (29.03%), Postives = 96/186 (51.61%), Query Frame = 3
Query: 3855 VQYLISTFNKNFVKFL--VIN-RDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFT 4403
            +++ ++ F     + L  +IN  D +GNT +HY +    + +   +  TGL D N  N  GFT +ML A      +     + ++    D+N ++ + GQTA+ L+  H   + +  L A GAD+NI+D + +T LM A    +   V  +LA P   + L + DG++AL +A +   ++I+ L +
Sbjct:  675 IRHHLTVFRAMSPRLLEVIINMADAKGNTAVHYAVSQSNFTAVRQLLDTGLCDVNRQNKAGFTPLMLTALAAFRSDEDIETVTQMLRLGDVNCRASQAGQTALMLAVSHGRLDVVRALLACGADVNIQDHDGSTALMCACEHGHADIVSLLLAVPACDVSLTDNDGSTALSIALEAGQNDIAMLLS 860          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Xenopus
Match: ENSXETT00000039221.1 (KN motif and ankyrin repeat domains 3 [Source:NCBI gene;Acc:100170188])

HSP 1 Score: 86.2705 bits (212), Expect = 3.367e-16
Identity = 49/162 (30.25%), Postives = 87/162 (53.70%), Query Frame = 3
Query: 3915 DQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            D  GNT +HY + H  +    ++  TG+ + +  N  G+T +MLAA   V  E   N + +L    ++N ++ + GQTA+ L+  H     +  L A GA++N++D E +T LM A+     + VK +LA     + + + DG++AL +A +   ++I+ L 
Sbjct:  867 DGNGNTALHYSVSHSNFFIVQLLLDTGVCNVDRQNKAGYTAIMLAALAAVEKEDDMNVVSRLFSLGNVNAKASQAGQTALMLAVSHGRQEMVQALLACGANVNLQDDEGSTALMCASEHGRAEIVKLLLAQTDCDVSITDNDGSNALSIALEAGQNDIAMLL 1028          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Xenopus
Match: letmd1 (LETM1 domain containing 1 [Source:Xenbase;Acc:XB-GENE-962658])

HSP 1 Score: 64.6994 bits (156), Expect = 1.817e-11
Identity = 37/107 (34.58%), Postives = 59/107 (55.14%), Query Frame = 3
Query: 4107 KADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRS 4427
            + ++NL + +  QT++ L+  H   + +T L   GAD+N++D +  T LM+A    N+  VK +LA PG   EL +K GN+AL +   +  SEI+         RRS
Sbjct:   23 EGNVNLCATQGRQTSLMLAVSHGRLDMVTVLLNCGADVNLQDEDGETALMMACRLGNMDLVKLLLAQPGCDTELSDKVGNTALSIVLNSAHSEIAEFLQAHTEHRRS 129          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Mouse
Match: Kank3 (KN motif and ankyrin repeat domains 3 [Source:MGI Symbol;Acc:MGI:1098615])

HSP 1 Score: 99.7525 bits (247), Expect = 8.903e-21
Identity = 59/205 (28.78%), Postives = 106/205 (51.71%), Query Frame = 3
Query: 3789 LMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHI-RKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            L+  +W+     K S  + +  V   + +     + ++V   D  GNT +HY + H      S++  TG+ D N  N  G++ +MLAA   V  E  +  + ++L    D+N ++ + GQTA+ L+  H + + +  L   GAD+N++D++  T LM A+    +  V+ +LA PG  L + + +G SAL +A +    E++AL 
Sbjct:  374 LVAQEWFRVSSQKRSQAESVAGVLRGVKSLGPELLAYVVNLADGNGNTALHYSVSHGNLAISSLLLDTGVCDVNHQNRAGYSALMLAALTSVGQEEEDMAVAQRLFSMGDVNAKASQTGQTALMLAISHGHQDMVAALLECGADVNVQDADGATALMCASEYGRLDTVQLLLAQPGCDLTILDNEGTSALAIALEAEQDEVAALL 578          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Mouse
Match: Kank3 (KN motif and ankyrin repeat domains 3 [Source:MGI Symbol;Acc:MGI:1098615])

HSP 1 Score: 99.7525 bits (247), Expect = 1.576e-20
Identity = 59/205 (28.78%), Postives = 106/205 (51.71%), Query Frame = 3
Query: 3789 LMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHI-RKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            L+  +W+     K S  + +  V   + +     + ++V   D  GNT +HY + H      S++  TG+ D N  N  G++ +MLAA   V  E  +  + ++L    D+N ++ + GQTA+ L+  H + + +  L   GAD+N++D++  T LM A+    +  V+ +LA PG  L + + +G SAL +A +    E++AL 
Sbjct:  562 LVAQEWFRVSSQKRSQAESVAGVLRGVKSLGPELLAYVVNLADGNGNTALHYSVSHGNLAISSLLLDTGVCDVNHQNRAGYSALMLAALTSVGQEEEDMAVAQRLFSMGDVNAKASQTGQTALMLAISHGHQDMVAALLECGADVNVQDADGATALMCASEYGRLDTVQLLLAQPGCDLTILDNEGTSALAIALEAEQDEVAALL 766          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Mouse
Match: Kank4 (KN motif and ankyrin repeat domains 4 [Source:MGI Symbol;Acc:MGI:3043381])

HSP 1 Score: 89.3521 bits (220), Expect = 2.678e-17
Identity = 52/189 (27.51%), Postives = 101/189 (53.44%), Query Frame = 3
Query: 3801 DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKL 4361
            +W+     KLSS + +      +   +   +K LV   D+ GNT +HY + H  +    ++  TG+ + +  N  G+T +M+   A+ +  +++    + KL  + ++N+Q+ + GQTA+ L   HD ++ +  L +  AD+N++D++ ++ LM+A  + N   V+ +LA P     L +K G +AL L
Sbjct:  798 EWFRVSSRKLSSPEAVAAYLLEVQPHSPYLLKLLVNLADRSGNTALHYSVSHSNFAIVKLLLDTGVCNVDHQNKAGYTAVMITPLASAETKEDMAV--VWKLLREGNVNIQATQGGQTALMLGVSHDREDMVQALLSCQADVNLQDNDGSSALMLACHQGNADLVRLLLAHPACNSSLTDKAGRTALSL 984          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Mouse
Match: Kank1 (KN motif and ankyrin repeat domains 1 [Source:MGI Symbol;Acc:MGI:2147707])

HSP 1 Score: 89.3521 bits (220), Expect = 3.598e-17
Identity = 59/205 (28.78%), Postives = 106/205 (51.71%), Query Frame = 3
Query: 3885 NFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKI-LSSNSNPISPRTFRK 4496
            + +++++   D  GNT +HY + H  ++   ++    + + +  N  G+T +MLAA   V  E     + +L    D+N ++ + GQTA+ L+  H   + +  L A GAD+NI+D E +T LM A+   +++ VK +LA PG    L++ DG++AL +A +    +I+ L              Y+ +  S   +P +PR  RK
Sbjct: 1157 DVLRYIINMADGNGNTALHYSVSHSNFQIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMQVVEELFSCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLL-------------YAHLNFSKAQSPSTPRLGRK 1348          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Mouse
Match: Kank2 (KN motif and ankyrin repeat domains 2 [Source:MGI Symbol;Acc:MGI:2384568])

HSP 1 Score: 85.5001 bits (210), Expect = 3.927e-16
Identity = 64/231 (27.71%), Postives = 118/231 (51.08%), Query Frame = 3
Query: 3795 LIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFL--VIN-RDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRS--EISGYSKILSSNS 4466
            ++  W+ +  +  ++  L  V+  + TF     + L  V+N  D  GNT +HY + H  +     +  +G+   +  N  G++ +ML   ATL+  D+I    I +L    ++N ++ + GQTA+ L+  H   + +  L A  AD+NI+D + +T LM A    + +    +LA P   + L ++DG++AL +A     SEI+++   R +I+ S   +S Y    SS++
Sbjct:  615 VLQEWLRLACRSDAHPEL--VRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVSHANFPVVRQLLDSGVCHVDKLNRAGYSPIMLTALATLKTQDDI--ETILQLFRLGNVNAKASQAGQTALMLAVSHGRVDVVRALLACEADVNIQDEDGSTALMCACEHGHKEITGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSDYESPASSSA 841          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. UniProt/SwissProt
Match: sp|Q9Z1P7|KANK3_MOUSE (KN motif and ankyrin repeat domain-containing protein 3 OS=Mus musculus OX=10090 GN=Kank3 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.102e-19
Identity = 59/205 (28.78%), Postives = 106/205 (51.71%), Query Frame = 3
Query: 3789 LMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHI-RKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            L+  +W+     K S  + +  V   + +     + ++V   D  GNT +HY + H      S++  TG+ D N  N  G++ +MLAA   V  E  +  + ++L    D+N ++ + GQTA+ L+  H + + +  L   GAD+N++D++  T LM A+    +  V+ +LA PG  L + + +G SAL +A +    E++AL 
Sbjct:  562 LVAQEWFRVSSQKRSQAESVAGVLRGVKSLGPELLAYVVNLADGNGNTALHYSVSHGNLAISSLLLDTGVCDVNHQNRAGYSALMLAALTSVGQEEEDMAVAQRLFSMGDVNAKASQTGQTALMLAISHGHQDMVAALLECGADVNVQDADGATALMCASEYGRLDTVQLLLAQPGCDLTILDNEGTSALAIALEAEQDEVAALL 766          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. UniProt/SwissProt
Match: sp|X1WE18|KANK2_DANRE (KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.156e-18
Identity = 52/203 (25.62%), Postives = 102/203 (50.25%), Query Frame = 3
Query: 3792 MLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            +L +W      K +   ++       ++ +   ++F++   D  GNT +HY + H  +    ++  TGL + +  N  G+T +ML A      +     + +L    D+N ++ + GQTA+ L+  H   + +  L A GA +N+RD + +T LM A    ++  V+ +L+ PG    L + DG++AL +A + + ++I+ L 
Sbjct:  852 VLQEWLRVSCHKAADTAVVKAHMDAFASISPQLLEFVINMADGNGNTALHYTVSHSNFPVVKLLLDTGLCNADKQNKAGYTAIMLTALAAFSSDSDLQTVLQLLRTGDVNAKASQAGQTALMLAVSHGRGDMVKALLACGAQVNLRDDDGSTALMCACEHGHVDIVRQLLSVPGCDATLTDNDGSTALSIALEASQNDIAVLL 1054          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. UniProt/SwissProt
Match: sp|Q5T7N3|KANK4_HUMAN (KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KANK4 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.085e-17
Identity = 64/248 (25.81%), Postives = 127/248 (51.21%), Query Frame = 3
Query: 3717 WLNTSKLVSMNNIEHMPQ------EMIKPCLMLI--DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLA-EQNNFSEISALFTQRRSIRRS 4427
            +LN  + +S    +H+P+      ++++  L  I  +W+     K SS  ++ +  + +   + +F+K LV   D  GNT +HY + H  +    ++  TG+ + +  N  G+T +M+   A+ +  +++    + KL  + ++N+Q+ + GQTA+ L   HD ++ +  L +  AD+N++D + ++ LM+A    N+  V+ +LA P     L +K G +AL +A +     EI+ L        RS
Sbjct:  751 FLNACRALS----QHLPETGTTTDQLLRQSLNTISQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIVKLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAV--VWKLLREGNVNIQATQGGQTALMLGVSHDREDMVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTDKAGRTALSIALKSPTHMEIAGLLRAHAEQGRS 992          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. UniProt/SwissProt
Match: sp|Q6NY19|KANK3_HUMAN (KN motif and ankyrin repeat domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KANK3 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.908e-17
Identity = 64/240 (26.67%), Postives = 117/240 (48.75%), Query Frame = 3
Query: 3789 LMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHI-RKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEI-SGYSKILSSNSNPISPRTFRKYT 4502
            L+  +W+     + S  + +  +   +       +  +V   D  GNT +HY + H      S++  TG  + N  N  G++ +MLAA   V  E  +  + ++L    D+N ++ + GQTA+ L+  H   + + TL A GAD+N +D++  T LM A+    +  V+ +L  PG    + + +G SAL +A +    E++AL     S  + +  +G  +   S+  P  PR F+K++
Sbjct:  578 LVAQEWFRVSSQRRSQAEPVARMLEGVRRLGPELLAHVVNLADGNGNTALHYSVSHGNLAIASLLLDTGACEVNRQNRAGYSALMLAALTSVRQEEEDMAVVQRLFCMGDVNAKASQTGQTALMLAISHGRQDMVATLLACGADVNAQDADGATALMCASEYGRLDTVRLLLTQPGCDPAILDNEGTSALAIALEAEQDEVAALLHAHLSSGQPDTQAGVQRHNLSSLQPPPPR-FKKFS 816          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. UniProt/SwissProt
Match: sp|Q6P9J5|KANK4_MOUSE (KN motif and ankyrin repeat domain-containing protein 4 OS=Mus musculus OX=10090 GN=Kank4 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.873e-16
Identity = 52/189 (27.51%), Postives = 101/189 (53.44%), Query Frame = 3
Query: 3801 DWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKL 4361
            +W+     KLSS + +      +   +   +K LV   D+ GNT +HY + H  +    ++  TG+ + +  N  G+T +M+   A+ +  +++    + KL  + ++N+Q+ + GQTA+ L   HD ++ +  L +  AD+N++D++ ++ LM+A  + N   V+ +LA P     L +K G +AL L
Sbjct:  798 EWFRVSSRKLSSPEAVAAYLLEVQPHSPYLLKLLVNLADRSGNTALHYSVSHSNFAIVKLLLDTGVCNVDHQNKAGYTAVMITPLASAETKEDMAV--VWKLLREGNVNIQATQGGQTALMLGVSHDREDMVQALLSCQADVNLQDNDGSSALMLACHQGNADLVRLLLAHPACNSSLTDKAGRTALSL 984          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. TrEMBL
Match: A0A0K8SHE3 (ANK_REP_REGION domain-containing protein OS=Lygus hesperus OX=30085 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.785e-22
Identity = 69/228 (30.26%), Postives = 116/228 (50.88%), Query Frame = 3
Query: 3807 WVDMVIKLSSNQLLTTVQYLISTFNK---NFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISP 4481
            W  +    S+N L   V+Y +  F +     ++ +V   D  GNT MHY + +  ++  S++  + + + N  N  G+T +ML A  +V  E     +R+L   AD+N+++K+HGQTA+ L+  H   +T+  L   GADINI+D + +T LM A     I+ VK +LA P   L + + DG +AL +A +    ++  L   +    R   S Y+ +    S   +P
Sbjct:   48 WFKVSSVASANPL--DVEYYLDCFEEISGTLLEHVVNMSDVSGNTAMHYAVSNGNFDVVSILLDSKVCNINKLNTAGYTCIMLVALTKVKSETDREVVRRLFHMADVNIRAKQHGQTALMLAVSHGRIDTVELLLEAGADINIQDDDGSTALMCAAEHGYIEIVKLLLAQPDCDLSITDYDGTTALAIAMEAGNRDVGVLLYAQEHFSRGS-SPYTSLKHKRSKSTTP 272          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. TrEMBL
Match: A0A226DHA0 (KN motif and ankyrin repeat domain-containing protein 1 OS=Folsomia candida OX=158441 GN=Fcan01_21279 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.095e-22
Identity = 62/199 (31.16%), Postives = 105/199 (52.76%), Query Frame = 3
Query: 3876 FNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNP 4472
            ++   ++++V   D  GNT +HY + H  ++  S++  + + DPN  N  G+T +ML A   +  E     +R+L    D+N+++ +HGQTA+ L A H   +TI  L   GADINI+D + +T LM A    ++K VK +LA P     + + DG++A  +A +    +I  L   +    R E +G     S ++ P
Sbjct:  760 YSPQLLRYIVNMPDGNGNTALHYAVSHGNFDVVSILLDSKVCDPNKANKAGYTSIMLVALANISCEAHRQVVRRLFSLGDVNIKAAQHGQTALMLGASHGRFDTIRLLLEAGADINIQDEDGSTALMCAAEHGHMKIVKYLLAHPDCNPHITDNDGSTAFSIAMEGQHKDIGVLLYAQMHFARPEGAGGLAAKSRSTTP 958          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. TrEMBL
Match: A0A2G9TL30 (Ankyrin repeat protein OS=Teladorsagia circumcincta OX=45464 GN=TELCIR_19983 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 4.224e-22
Identity = 60/188 (31.91%), Postives = 100/188 (53.19%), Query Frame = 3
Query: 3867 ISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSE 4430
            I   +   +K +V   DQ GNT +HY + H  +   S +  +G    N+ N  G++ +MLAA   + +E+    +++L +  D+N ++++HGQTA+ LS  H    T   L A GAD+N++D E +T LM A    +   VK +L  PG+   L + D ++AL +A +N   +I  L     +  R+E
Sbjct:   49 IKALSPALLKVIVNITDQNGNTALHYAVSHGNFGVVSSLLDSGECQLNLANRAGYSAVMLAALSSLENEVEKAVVQRLFELGDVNARAQQHGQTALMLSVSHGKKATTDLLLACGADVNLQDEEGSTALMCAAEHGHKDIVKLLLGQPGIDAALTDCDSSTALSIAVENGHRDIGVLIYAHLNYSRAE 236          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. TrEMBL
Match: A0A1B6MJY1 (ANK_REP_REGION domain-containing protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.25556 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 4.960e-22
Identity = 78/278 (28.06%), Postives = 139/278 (50.00%), Query Frame = 3
Query: 3708 VMLWLNTSKLVSMNNIEHMPQEMIKPCLMLIDWWVDMVIKLSSNQLLTTVQYL--ISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF----------TQRRSIRRSEISGYSKILSSNSNPISPRTFRKYTY 4505
             M  LN + L S N   + P +M     ++   W  +    S+N L     YL  +   +   ++++V   D  GNT MHY + H  ++  S++  + + + N  N  G+T +ML +  QV  E     +R+L   AD+N+++K+HGQTA+ L+  H   + +  L   GAD+NI+D + +T LM A   ++I+ VK +LA P   L +++ DG++AL +A +    +I  L           +   S+R       +  L + ++P  PRT + +++
Sbjct:  172 AMKVLNDALLKSPNG--NPPPQMKNAINIIQQEWFKISSTASANPL-DVEDYLDCLEEMSSRLLEYVVNMTDVSGNTAMHYAVSHGNFDVVSILLDSKVCNINQTNAAGYTCIMLVSLAQVRSETHRQVVRRLFQMADVNIRAKQHGQTALMLAVSHGGLDMVDLLLQSGADMNIQDEDGSTALMCAAEHHHIEIVKLLLAQPDCDLSIRDYDGSTALNIAMEAGNRDIGVLLYAQEHFSRGSSPHTSLRHRRAKSTTPTLRTPTSP-QPRTKQDHSF 445          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. TrEMBL
Match: A0A0A9WCW6 (KN motif and ankyrin repeat domain-containing protein 1 OS=Lygus hesperus OX=30085 GN=KANK1_0 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 4.998e-22
Identity = 69/228 (30.26%), Postives = 116/228 (50.88%), Query Frame = 3
Query: 3807 WVDMVIKLSSNQLLTTVQYLISTFNK---NFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISP 4481
            W  +    S+N L   V+Y +  F +     ++ +V   D  GNT MHY + +  ++  S++  + + + N  N  G+T +ML A  +V  E     +R+L   AD+N+++K+HGQTA+ L+  H   +T+  L   GADINI+D + +T LM A     I+ VK +LA P   L + + DG +AL +A +    ++  L   +    R   S Y+ +    S   +P
Sbjct:   96 WFKVSSVASANPL--DVEYYLDCFEEISGTLLEHVVNMSDVSGNTAMHYAVSNGNFDVVSILLDSKVCNINKLNTAGYTCIMLVALTKVKSETDREVVRRLFHMADVNIRAKQHGQTALMLAVSHGRIDTVELLLEAGADINIQDDDGSTALMCAAEHGYIEIVKLLLAQPDCDLSITDYDGTTALAIAMEAGNRDVGVLLYAQEHFSRGS-SPYTSLKHKRSKSTTP 320          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Cavefish
Match: ENSAMXT00000041606.1 (KN motif and ankyrin repeat domain-containing protein 4-like [Source:NCBI gene;Acc:103044744])

HSP 1 Score: 102.449 bits (254), Expect = 1.692e-21
Identity = 59/185 (31.89%), Postives = 97/185 (52.43%), Query Frame = 3
Query: 3867 ISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIR 4421
            +S +    + FLV   D  GNT +HY + H  +    ++  TG+ + +  N  G+T MMLA  + V   +    I++L   +D+N ++ + GQTA++L+  H   +T+  L A GA+IN +D    T L+ A  + +   V+ +L  P   + L +K G SAL LA Q + +EI+ L   R   R
Sbjct:  597 VSKYTPAVLPFLVNMVDDNGNTALHYSVSHSNFRIAKILLDTGVCEVDKRNKIGYTAMMLACLVPVDSPVEMKAIQQLMKLSDVNARAGQVGQTALHLAVRHGRVSTVQLLLAQGANINAQDRAGTTALISACDRGHADIVRILLEDPDCDVNLTDKGGRSALSLATQASHTEIADLLRARAGTR 781          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Cavefish
Match: ENSAMXT00000019381.2 (KN motif and ankyrin repeat domain-containing protein 4-like [Source:NCBI gene;Acc:103044744])

HSP 1 Score: 102.449 bits (254), Expect = 2.016e-21
Identity = 59/185 (31.89%), Postives = 97/185 (52.43%), Query Frame = 3
Query: 3867 ISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIR 4421
            +S +    + FLV   D  GNT +HY + H  +    ++  TG+ + +  N  G+T MMLA  + V   +    I++L   +D+N ++ + GQTA++L+  H   +T+  L A GA+IN +D    T L+ A  + +   V+ +L  P   + L +K G SAL LA Q + +EI+ L   R   R
Sbjct:  732 VSKYTPAVLPFLVNMVDDNGNTALHYSVSHSNFRIAKILLDTGVCEVDKRNKIGYTAMMLACLVPVDSPVEMKAIQQLMKLSDVNARAGQVGQTALHLAVRHGRVSTVQLLLAQGANINAQDRAGTTALISACDRGHADIVRILLEDPDCDVNLTDKGGRSALSLATQASHTEIADLLRARAGTR 916          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Cavefish
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:103041518])

HSP 1 Score: 96.6709 bits (239), Expect = 1.322e-19
Identity = 76/291 (26.12%), Postives = 147/291 (50.52%), Query Frame = 3
Query: 3690 FQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLI--DWWVDMVIKLSSNQ--LLTTVQYLISTF---NKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNV-----QGFTVMMLAA--TLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKI-LSSNSNPISPRTFRKYTYN*SR 4517
            +++S +++   N  K   +N+ +    + ++ C+  +  +W+     ++SS +  + T V+  ++ F   +   +K +V   D  GNT +HY + H    +F ++    L+D N+ NV      G+T +MLAA   ++ P ++    + +L  K D+N ++ + GQT + L+  H   + +  L A GAD+NI+D E +T LM A+   +++ VK +LA PG    L + D ++AL +A +    +I+ L              Y+ +  S   +P +PR  RK + + +R
Sbjct:  857 YELSEKMLAACNVVK-AHLNDPKSSSGKEVRMCMNTVQHEWF-----RVSSQKTAVATMVEDYLNAFRNISPALLKHVVNLADGNGNTALHYSVSHS---NFHIVKK--LLDANVCNVNQQNKAGYTPIMLAALAAVEAPKDM--RVVEELFSKGDVNSKASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCDATLSDNDESTALSIALEAGHKDIAVLL-------------YAHVNFSKAQSPGTPRLGRKTSPSPTR 1121          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Cavefish
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:103041518])

HSP 1 Score: 96.6709 bits (239), Expect = 1.441e-19
Identity = 76/291 (26.12%), Postives = 147/291 (50.52%), Query Frame = 3
Query: 3690 FQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLI--DWWVDMVIKLSSNQ--LLTTVQYLISTF---NKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNV-----QGFTVMMLAA--TLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKI-LSSNSNPISPRTFRKYTYN*SR 4517
            +++S +++   N  K   +N+ +    + ++ C+  +  +W+     ++SS +  + T V+  ++ F   +   +K +V   D  GNT +HY + H    +F ++    L+D N+ NV      G+T +MLAA   ++ P ++    + +L  K D+N ++ + GQT + L+  H   + +  L A GAD+NI+D E +T LM A+   +++ VK +LA PG    L + D ++AL +A +    +I+ L              Y+ +  S   +P +PR  RK + + +R
Sbjct: 1058 YELSEKMLAACNVVK-AHLNDPKSSSGKEVRMCMNTVQHEWF-----RVSSQKTAVATMVEDYLNAFRNISPALLKHVVNLADGNGNTALHYSVSH---SNFHIVKK--LLDANVCNVNQQNKAGYTPIMLAALAAVEAPKDM--RVVEELFSKGDVNSKASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCDATLSDNDESTALSIALEAGHKDIAVLL-------------YAHVNFSKAQSPGTPRLGRKTSPSPTR 1322          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Cavefish
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:103041518])

HSP 1 Score: 96.6709 bits (239), Expect = 1.527e-19
Identity = 76/291 (26.12%), Postives = 147/291 (50.52%), Query Frame = 3
Query: 3690 FQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLI--DWWVDMVIKLSSNQ--LLTTVQYLISTF---NKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNV-----QGFTVMMLAA--TLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKI-LSSNSNPISPRTFRKYTYN*SR 4517
            +++S +++   N  K   +N+ +    + ++ C+  +  +W+     ++SS +  + T V+  ++ F   +   +K +V   D  GNT +HY + H    +F ++    L+D N+ NV      G+T +MLAA   ++ P ++    + +L  K D+N ++ + GQT + L+  H   + +  L A GAD+NI+D E +T LM A+   +++ VK +LA PG    L + D ++AL +A +    +I+ L              Y+ +  S   +P +PR  RK + + +R
Sbjct: 1054 YELSEKMLAACNVVK-AHLNDPKSSSGKEVRMCMNTVQHEWF-----RVSSQKTAVATMVEDYLNAFRNISPALLKHVVNLADGNGNTALHYSVSH---SNFHIVKK--LLDANVCNVNQQNKAGYTPIMLAALAAVEAPKDM--RVVEELFSKGDVNSKASQAGQTGLMLAVSHGRMDMVKALLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCDATLSDNDESTALSIALEAGHKDIAVLL-------------YAHVNFSKAQSPGTPRLGRKTSPSPTR 1318          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003964.1 (pep scaffold:Pmarinus_7.0:GL481009:348:11102:1 gene:ENSPMAG00000003629.1 transcript:ENSPMAT00000003964.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 1.155e-18
Identity = 48/162 (29.63%), Postives = 88/162 (54.32%), Query Frame = 3
Query: 3915 DQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            D  GNT +HY + H  +    ++  TG  + +  N  G+T +MLA+   +  E     ++KL    D+N ++ + GQTA+ L+  H   + +  L A GAD+N++D + +T LM A+   ++  V+ +LA  G    + + DG++AL +A +   ++I+ L 
Sbjct:  508 DGNGNTALHYSVSHSNFAIVQMLLGTGECNVDAQNKAGYTAIMLASLAAINSERDMAVVQKLLSLGDVNARASQAGQTALMLAVSHGRKDMVRALLACGADVNVQDDDGSTALMCASEHGHVDIVRLLLAQAGCNAAIADNDGSTALSIALEAGHNDIAVLL 669          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004707.1 (pep scaffold:Pmarinus_7.0:GL480522:11184:13485:1 gene:ENSPMAG00000004287.1 transcript:ENSPMAT00000004707.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 6.598e-6
Identity = 29/110 (26.36%), Postives = 53/110 (48.18%), Query Frame = 3
Query: 4110 ADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISG 4439
            A +   +  + QT  +++A   + + +  L  +GA++N +D    TPL  A    + + V  ++AC G  +E+ N  G + L+LA    FS  +A      + RR +  G
Sbjct:   13 ASVTTVTSRYAQTPAHIAAFGGHQHCLLWLLRVGANVNQQDYLGETPLHKAARSGSEECVHLLVAC-GAQVEVPNHSGITPLELAISQGFSRPAAFLANELARRRGDAGG 121          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Nematostella
Match: EDO36063 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJL9])

HSP 1 Score: 90.5077 bits (223), Expect = 6.516e-20
Identity = 48/162 (29.63%), Postives = 87/162 (53.70%), Query Frame = 3
Query: 3915 DQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            D +GN  +HY + ++ W+  +V+  TG VD N+ N  G++ +MLAA      +   N  R+L    D+N +  E GQT + L+      + +  L    AD+N +D+E +T +M A+   +    + +LA P     +++ +G+SA+ +A + NF +I+ L 
Sbjct:   78 DAEGNNALHYAVTYRNWKVVNVLLNTGCVDVNLVNKAGYSSVMLAAVTGCQKDQYRNVARRLFQMGDVNKRYDETGQTPLMLAVSRGRLDMVDLLLETDADVNAQDNEGSTAIMCASEHGHTNIARRLLAQPHCDSSIEDNEGSSAMSIAMERNFKDIAVLI 239          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Nematostella
Match: EDO37330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG44])

HSP 1 Score: 50.447 bits (119), Expect = 7.157e-6
Identity = 32/96 (33.33%), Postives = 56/96 (58.33%), Query Frame = 3
Query: 4080 NNHIRKLADK-ADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLA 4364
            +N ++ L D+ AD+N Q+ E G TA+ +++   +   +  L   GAD N+++ E+ TPL  AT++     V+ +L   G  + +KN  G SAL++A
Sbjct:  705 DNEVKALIDEGADVNFQN-ELGHTALMVASREGHLKVVDELMVGGADPNLQEKEKRTPLQYATLRGKKLVVQTLLQY-GADITIKNTVGESALEIA 798          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Medaka
Match: ENSORLT00000046848.1 (KN motif and ankyrin repeat domain-containing protein 4 [Source:NCBI gene;Acc:105356192])

HSP 1 Score: 108.227 bits (269), Expect = 2.732e-23
Identity = 69/228 (30.26%), Postives = 114/228 (50.00%), Query Frame = 3
Query: 3744 MNNIEHMPQEMIKPCLMLIDWWVDMVIKLSSNQL-LTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILN-NHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIR 4421
            M N+++  ++M K  + L   W     + +S    +      +     + + FLV   D  GNT +HY + H  +   S++  TG+ D N+ N  G+T +MLA +L  PD       +RKL +  +LN++S + GQTA++L+  H  D  +  L + GAD NI+D++  T LM A  K +    + +L      L L +K G +AL +A Q + S+ +AL       R
Sbjct:  597 MGNMDNPSEDMRKALVTLFQHWFTTAAEEASEACNVAACVRGVKKETPSLLAFLVNLPDDNGNTVLHYSVSHCNYSIVSLLLDTGVADVNVQNKAGYTAVMLA-SLTAPDGPDGMETVRKLMELGNLNVRSSQTGQTALHLAVRHGRDIMVRLLLSCGADTNIQDNQGTTALMFAAEKGHTHVARLLLERSQSDLTLTDKRGRTALSIALQGSHSDTAALLQAHAKAR 823          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Medaka
Match: kank1a (KN motif and ankyrin repeat domains 1 [Source:NCBI gene;Acc:101162911])

HSP 1 Score: 100.523 bits (249), Expect = 1.024e-20
Identity = 61/214 (28.50%), Postives = 111/214 (51.87%), Query Frame = 3
Query: 3888 FVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLA--ATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKI-LSSNSNPISPRTFRKYTYN*SRN 4520
             ++++V   D  GNT +HY + H  ++    +    + + N  N  G+T +MLA  A ++ P ++  + + +L  K D+N ++ + GQT + L+  H   + +  L A GAD+N++D E +T LM A+   +++ VK +LA PG    L + DG+SAL +A +    +I+ L              Y+ +  S   +P +PR  RK + + +R 
Sbjct: 1008 VLRYIVNMADGNGNTALHYSVSHSNFQVVKTLLDADVCNVNQQNKAGYTPIMLAALAAVETPKDM--SVVEELFGKGDVNARASQAGQTGLMLAVSHGRMDMVRALLAHGADVNVQDDEGSTALMCASEHGHVEIVKLLLAQPGCDATLSDGDGSSALSIALEAGHKDIAVLL-------------YAHVNFSKAQSPGTPRLSRKASPSPTRR 1206          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Medaka
Match: kank1b (KN motif and ankyrin repeat domain-containing protein 1-like [Source:NCBI gene;Acc:101174279])

HSP 1 Score: 98.2117 bits (243), Expect = 5.334e-20
Identity = 58/177 (32.77%), Postives = 93/177 (52.54%), Query Frame = 3
Query: 3915 DQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAA--TLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISG 4439
            D  GNT +HY + H  +E    +   G+ + N+ N  G+T +MLAA   ++ PD +    + KL    ++N ++ + GQTA+ L+  H   + + TL A GAD+NIRD E +T LM A+       VK +LA P     L + D ++AL +A +   S+I+ L     +  R   +G
Sbjct: 1053 DGSGNTALHYSLSHSNFEVVKKLLDAGVCNVNLQNAAGYTPIMLAALSAVENPDHM--RVVEKLFAAGNVNAKASQAGQTALMLAVSHGRRDMVETLLAQGADVNIRDDEGSTALMCASEHGYADIVKLLLAQPECDATLTDSDESTALSIALEAGHSDIAVLLYAHTTFSRQTGAG 1227          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Medaka
Match: kank3 (KN motif and ankyrin repeat domains 3 [Source:NCBI gene;Acc:101163478])

HSP 1 Score: 97.0561 bits (240), Expect = 1.109e-19
Identity = 72/262 (27.48%), Postives = 126/262 (48.09%), Query Frame = 3
Query: 3771 EMIKPCLMLIDWWVDMVIKLSSNQLLT---TVQ-------------------YLI--STFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISA-LFTQRRSIRRSEISGYSKILSSNSNPISP 4481
            +M + CL+L +   D V  L S ++L+   TVQ                   YL+  S  +   ++ +V   D  GNT +HY + H  +    ++  TG+   +  N  G+T +MLAA   V +E     +RKL  + ++N ++ + GQTA+ L+  H     +  L   GAD+N++D E +T LM A+     + VK +L  PG  + + + DG++AL +A +   ++ +  L+      +   ++G  K  S   +P SP
Sbjct:  714 KMREACLILKNHLNDDVKTLKSKEVLSSTHTVQLEWFRISSAKTAQPSRVSDYLMAFSEVSSALLEHVVNMTDGNGNTALHYSVSHSNFHVVRLLLDTGVCCVDKQNKAGYTAIMLAALSTVKEEEDMAVVRKLFSQGNVNAKASQAGQTALMLAVSHGRQEMVRALLECGADVNVQDDEGSTALMCASEHGRAEIVKLLLEQPGCDISIVDNDGSNALSIALEAAHNDTAVLLYAHMNYAKAPSVAGSPK--SQARSPTSP 973          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Medaka
Match: kank2 (KN motif and ankyrin repeat domains 2 [Source:NCBI gene;Acc:101159267])

HSP 1 Score: 90.5077 bits (223), Expect = 1.032e-17
Identity = 51/203 (25.12%), Postives = 101/203 (49.75%), Query Frame = 3
Query: 3792 MLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALF 4400
            +L +W      K +   ++       ++ +   ++F++   D  GNT +HY + H  +    ++  T L + +  N  G+T +ML A      +     + +L    D+N ++ + GQTA+ L+  H   + +  L + GA +NIRD + +T LM A    ++  V+ +L+ PG    L + DG++AL +A + + ++I+ L 
Sbjct:  788 VLQEWLRVSCHKAADTSVVKAYMDTFASLSPQLLEFVINMADGNGNTALHYTVSHSNFPVVKLLLDT-LCNADKQNKAGYTAIMLTALAAFHSDSDLQTVLQLLRTGDVNAKASQAGQTALMLAVSHGRGDMVRALLSCGAQVNIRDDDGSTALMCACEHGHVDIVRQLLSVPGCDATLTDNDGSTALSIALEASQNDIAVLL 989          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Planmine SMEST
Match: SMESG000059500.1 (SMESG000059500.1)

HSP 1 Score: 2748 bits (7122), Expect = 0.000e+0
Identity = 1483/1484 (99.93%), Postives = 1484/1484 (100.00%), Query Frame = 3
Query:   57 MLKSEDKRTNNKKMSQPRQNSNSYMTREYSVRSQITNEMLANDNKYLNNEPESQWGINLINNSETLPTRFINRNLPTSLNRASNLNSMTTSSINYQMNEPDLQWKNNNNRFESRLMTDLPSPMSGVHNLASATMSPNINDNRDQFSIYGSFKKHISEKRDSSMKYDSTQVIETREINYKNLPVKQSTASYTSSEFEVPVNSALTSSGFFTPQTRSQQYTLQDILNSDATDSIKNQIVEDVPIKAETQNQNQNFSSLPEIVVETPKNEIASKDQEIKKLNKTIDKLNNKMKTLLQSNEEMKTHLKNLLNERKNLIKQXXXXXXXXXXXXXXVQRAKPNIATNVIPSQQKSTVIKQELIKENYLEKSKISLQDLPQHILNKYRQEIIDCERDKIELEKRTLINTLNIQYQQQLQSLRHEQDIRKTQMKHVSIQSYKTKKFNQTVSEVNLSRSTPPPKSIGTVFQPATFSKQSQNDIKDETNKKLAKDLDIHFTNYIRRRQIKTTEWQNTILQQLTESLDKNNSEQFMNIIEEILFKSSKNILTSVQPTVSSKLSQNEAIEDGNKSLSREVSKSLNEYIRSIKMKLSDWQKIMLERFLKSLEMNDVDNLSSVIEEILLKQMKSVETLSQPATVSRLSQNDSSEDSNSKLANEAFTLFXXXXXXXXXXXXKWQESIVERLMNSLKTNNSQMLSTVMEELLFKPSRTIGINSVPDNMNKNSQTQQKNYSNLSHEVNIVEEKPKFERLSKSVSAKPTTFQKGIQPDEKFFFETGTMTDHLFFRSQGVNTLTDYSKNLNSPYSETDSFVTRTSSRNESKKEIKSHTVIQSSSSNXXXXXXXXXXXXXXXIEPQNKNITEEWNQTFLVKELKGSNQNVSTTLDNIKSEVKEETIIKAQNKTQETASKPRXXXXXXXXXXXXKVQVMTAHVDKNQNIKDDTQTTVECWETISKIKDGKLIEKKECYRDKYVSSNPDEIRKHLXXXXXXXXXXXFEDKNDSGKSVETXXXXXXXXXXXXXXXXTLSNYGNSRLNTKTSSSSFNVPVIKGFEETEISKFRNYTNLGVSRKEVSSIVEQLSNSQLKENHSISERIEQSSTSKXXXXXXXXXXXXXXXXXDKSNYEPANQRKIDILSRSSKPKVLPKPITIQNSESLRSSQGINVNLKTFSPTIESSEMYFDETENSTVIGSDNSAFYSISELXXXXXXXXXXXXXEVLLPENIFQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISPRTFRKYTYN 4508
            MLKSEDKRTNNKKMSQPRQNSNSYMTREYSVRSQITNEMLANDNKYLNNEPESQWGINLINNSETLPTRFINRNLPTSLNRASNLNSMTTSSINYQMNEPDLQWKNNNNRFESRLMTDLPSPMSGVHNLASATMSPNINDNRDQFSIYGSFKKHISEKRDSSMKYDSTQVIETREINYKNLPVKQSTASYTSSEFEVPVNSALTSSGFFTPQTRSQQYTLQDILNSDATDSIKNQIVEDVPIKAETQNQNQNFSSLPEIVVETPKNEIASKDQEIKKLNKTIDKLNNKMKTLLQSNEEMKTHLKNLLNERKNLIKQIENSEFEEIIEEEEVQRAKPNIATNVIPSQQKSTVIKQELIKENYLEKSKISLQDLPQHILNKYRQEIIDCERDKIELEKRTLINTLNIQYQQQLQSLRHEQDIRKTQMKHVSIQSYKTKKFNQTVSEVNLSRSTPPPKSIGTVFQPATFSKQSQNDIKDETNKKLAKDLDIHFTNYIRRRQIKTTEWQNTILQQLTESLDKNNSEQFMNIIEEILFKSSKNILTSVQPTVSSKLSQNEAIEDGNKSLSREVSKSLNEYIRSIKMKLSDWQKIMLERFLKSLEMNDVDNLSSVIEEILLKQMKSVETLSQPATVSRLSQNDSSEDSNSKLANEAFTLFTTTMRSSRVTTTKWQESIVERLMNSLKTNNSQMLSTVMEELLFKPSRTIGINSVPDNMNKNSQTQQKNYSNLSHEVNIVEEKPKFERLSKSVSAKPTTFQKGIQPDEKFFFETGTMTDHLFFRSQGVNTLTDYSKNLNSPYSETDSFVTRTSSRNESKKEIKSHTVIQSSSSNLLKQHQKLQEKLEIKIEPQNKNITEEWNQTFLVKELKGSNQNVSTTLDNIKSEVKEETIIKAQNKTQETASKPRELIEEWEQNIEEKVQVMTAHVDKNQNIKDDTQTTVECWETISKIKDGKLIEKKECYRDKYVSSNPDEIRKHLESHEHNHSHSNFEDKNDSGKSVETHKHFHQNEEHNEHQKNTLSNYGNSRLNTKTSSSSFNVPVIKGFEETEISKFRNYTNLGVSRKEVSSIVEQLSNSQLKENHSISERIEQSSTSKSFNSPISFTSFSSISTNDKSNYEPANQRKIDILSRSSKPKVLPKPITIQNSESLRSSQGINVNLKTFSPTIESSEMYFDETENSTVIGSDNSAFYSISELPKPKKDDQKYDYQEVLLPENIFQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYL+ALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISPRTFRKYTYN
Sbjct:    1 MLKSEDKRTNNKKMSQPRQNSNSYMTREYSVRSQITNEMLANDNKYLNNEPESQWGINLINNSETLPTRFINRNLPTSLNRASNLNSMTTSSINYQMNEPDLQWKNNNNRFESRLMTDLPSPMSGVHNLASATMSPNINDNRDQFSIYGSFKKHISEKRDSSMKYDSTQVIETREINYKNLPVKQSTASYTSSEFEVPVNSALTSSGFFTPQTRSQQYTLQDILNSDATDSIKNQIVEDVPIKAETQNQNQNFSSLPEIVVETPKNEIASKDQEIKKLNKTIDKLNNKMKTLLQSNEEMKTHLKNLLNERKNLIKQIENSEFEEIIEEEEVQRAKPNIATNVIPSQQKSTVIKQELIKENYLEKSKISLQDLPQHILNKYRQEIIDCERDKIELEKRTLINTLNIQYQQQLQSLRHEQDIRKTQMKHVSIQSYKTKKFNQTVSEVNLSRSTPPPKSIGTVFQPATFSKQSQNDIKDETNKKLAKDLDIHFTNYIRRRQIKTTEWQNTILQQLTESLDKNNSEQFMNIIEEILFKSSKNILTSVQPTVSSKLSQNEAIEDGNKSLSREVSKSLNEYIRSIKMKLSDWQKIMLERFLKSLEMNDVDNLSSVIEEILLKQMKSVETLSQPATVSRLSQNDSSEDSNSKLANEAFTLFTTTMRSSRVTTTKWQESIVERLMNSLKTNNSQMLSTVMEELLFKPSRTIGINSVPDNMNKNSQTQQKNYSNLSHEVNIVEEKPKFERLSKSVSAKPTTFQKGIQPDEKFFFETGTMTDHLFFRSQGVNTLTDYSKNLNSPYSETDSFVTRTSSRNESKKEIKSHTVIQSSSSNLLKQHQKLQEKLEIKIEPQNKNITEEWNQTFLVKELKGSNQNVSTTLDNIKSEVKEETIIKAQNKTQETASKPRELIEEWEQNIEEKVQVMTAHVDKNQNIKDDTQTTVECWETISKIKDGKLIEKKECYRDKYVSSNPDEIRKHLESHEHNHSHSNFEDKNDSGKSVETHKHFHQNEEHNEHQKNTLSNYGNSRLNTKTSSSSFNVPVIKGFEETEISKFRNYTNLGVSRKEVSSIVEQLSNSQLKENHSISERIEQSSTSKSFNSPISFTSFSSISTNDKSNYEPANQRKIDILSRSSKPKVLPKPITIQNSESLRSSQGINVNLKTFSPTIESSEMYFDETENSTVIGSDNSAFYSISELPKPKKDDQKYDYQEVLLPENIFQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLAALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRRSEISGYSKILSSNSNPISPRTFRKYTYN 1484          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Planmine SMEST
Match: SMESG000043522.1 (SMESG000043522.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.234e-18
Identity = 64/251 (25.50%), Postives = 124/251 (49.40%), Query Frame = 3
Query: 3675 LPENIFQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQS-KEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQRRSIRR 4424
             PE I +    V +W+N S            +++ +   ++ ++W ++    SS+ +    ++  S+FN    + ++   D  GNTC+HY +    W    ++  T  V+ N  N  G+TV+ML A  +  DE     ++ L D ++++ QS  +  QTA+ ++A       +  L   G+ +NI D + +T LM A    +++ VK +L  P    EL++  G++A+K+A  N+  +I+ L   R ++ +
Sbjct:  761 FPEKIQEACELVAVWMNDSTTTC-------SKDLNESLAIIRNFWFEVTSDNSSDIMFYIKKF--SSFNPTLQERIINMTDSNGNTCLHYAVSEGRWSIVRLLLQTQQVNVNKTNNAGYTVLMLVAVSESIDE---ESLKMLIDASEIDKQSLNDTQQTALMIAASQGKTKLVQLLLEKGSSVNITDGDGSTALMCACDNGHLEVVKLLLTRPETDTELEDNTGSNAMKIALDNSHKDIALLIFARNNLHK 999          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Planmine SMEST
Match: SMESG000017281.1 (SMESG000017281.1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.553e-7
Identity = 59/224 (26.34%), Postives = 106/224 (47.32%), Query Frame = 3
Query: 3762 MPQEMIKPCLMLIDWWVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINR-------DQQGNTCMHYIIGHQFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNS----ALKLAEQNNFSEISALF 4400
            +P+  IK C +LI+   D  +   +N  +T +    S+ +    + L  +R       D   +T +H  +      S  ++   G  D N  N + F    LAA LQ   +IL   +++   K  +    KE    AI+L AL+++++ +  L A  ADINIR++   T L IA ++ ++  VK IL      + L++ DG++    A+K+ +   F ++  +F
Sbjct:  497 VPKNQIKICDLLINKGAD--VNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAA-LQGHAKILELFLKREGVK--IVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVK-ILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMF 713          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.926e-6
Identity = 33/95 (34.74%), Postives = 53/95 (55.79%), Query Frame = 3
Query: 4071 EILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSAL 4355
            EI+   I+   D+ D+NL+  + G  A++ +AL D+   I  L   GADIN R+    TPL IA  K +++ +KA+L     L   ++ DG++ L
Sbjct:  582 EIVQALIKYGGDQLDINLKDPD-GDAAVHHAALGDHKIIIQILKNAGADINSRNRRNQTPLHIAVNKGHLEVLKALLELKSALQTNQDYDGDTPL 675          
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 52.373 bits (124), Expect = 3.265e-6
Identity = 34/95 (35.79%), Postives = 54/95 (56.84%), Query Frame = 3
Query: 4071 EILNNHIRKLADKADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLMIATIKNNIKAVKAILACPGVLLELKNKDGNSAL 4355
            EI+   I+   D+ D+NL+  + G  A++ +AL D+   I  L   GADIN R+    TPL IA  K +++ +KA+L     L  L++ DG++ L
Sbjct:  582 EIVQALIKYGGDQLDINLKDPD-GDAAVHHAALGDHKIIIQILKNAGADINSRNRRNQTPLHIAVNKGHLEVLKALLELK-CLASLQDYDGDTPL 674          
The following BLAST results are available for this feature:
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KANK41.738e-1925.81KN motif and ankyrin repeat domains 4 [Source:HGNC... [more]
KANK41.876e-1925.81KN motif and ankyrin repeat domains 4 [Source:HGNC... [more]
KANK42.259e-1825.81KN motif and ankyrin repeat domains 4 [Source:HGNC... [more]
KANK31.439e-1726.67KN motif and ankyrin repeat domains 3 [Source:HGNC... [more]
KANK11.470e-1728.43KN motif and ankyrin repeat domains 1 [Source:HGNC... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vab-192.201e-1932.26VAB-19 [Source:UniProtKB/TrEMBL;Acc:G5EDN8][more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kank3.752e-2128.08gene:FBgn0027596 transcript:FBtr0303758[more]
Kank1.872e-1929.12gene:FBgn0027596 transcript:FBtr0087429[more]
Kank2.572e-1929.12gene:FBgn0027596 transcript:FBtr0112929[more]
Kank2.631e-1929.12gene:FBgn0027596 transcript:FBtr0332856[more]
Kank2.762e-1929.12gene:FBgn0027596 transcript:FBtr0303756[more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kank1b3.465e-2026.64KN motif and ankyrin repeat domains 1b [Source:ZFI... [more]
kank33.726e-2027.27KN motif and ankyrin repeat domains 3 [Source:ZFIN... [more]
kank1a2.369e-1924.20KN motif and ankyrin repeat domains 1a [Source:ZFI... [more]
kank1a2.614e-1924.20KN motif and ankyrin repeat domains 1a [Source:ZFI... [more]
kank32.772e-1927.27KN motif and ankyrin repeat domains 3 [Source:ZFIN... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnnm11.175e-1826.29cyclin and CBS domain divalent metal cation transp... [more]
clasp13.761e-1729.03cytoplasmic linker associated protein 1 [Source:Xe... [more]
clasp14.089e-1729.03cytoplasmic linker associated protein 1 [Source:Xe... [more]
ENSXETT00000039221.13.367e-1630.25KN motif and ankyrin repeat domains 3 [Source:NCBI... [more]
letmd11.817e-1134.58LETM1 domain containing 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kank38.903e-2128.78KN motif and ankyrin repeat domains 3 [Source:MGI ... [more]
Kank31.576e-2028.78KN motif and ankyrin repeat domains 3 [Source:MGI ... [more]
Kank42.678e-1727.51KN motif and ankyrin repeat domains 4 [Source:MGI ... [more]
Kank13.598e-1728.78KN motif and ankyrin repeat domains 1 [Source:MGI ... [more]
Kank23.927e-1627.71KN motif and ankyrin repeat domains 2 [Source:MGI ... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1P7|KANK3_MOUSE1.102e-1928.78KN motif and ankyrin repeat domain-containing prot... [more]
sp|X1WE18|KANK2_DANRE2.156e-1825.62KN motif and ankyrin repeat domain-containing prot... [more]
sp|Q5T7N3|KANK4_HUMAN1.085e-1725.81KN motif and ankyrin repeat domain-containing prot... [more]
sp|Q6NY19|KANK3_HUMAN6.908e-1726.67KN motif and ankyrin repeat domain-containing prot... [more]
sp|Q6P9J5|KANK4_MOUSE1.873e-1627.51KN motif and ankyrin repeat domain-containing prot... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K8SHE31.785e-2230.26ANK_REP_REGION domain-containing protein OS=Lygus ... [more]
A0A226DHA03.095e-2231.16KN motif and ankyrin repeat domain-containing prot... [more]
A0A2G9TL304.224e-2231.91Ankyrin repeat protein OS=Teladorsagia circumcinct... [more]
A0A1B6MJY14.960e-2228.06ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A0A9WCW64.998e-2230.26KN motif and ankyrin repeat domain-containing prot... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000041606.11.692e-2131.89KN motif and ankyrin repeat domain-containing prot... [more]
ENSAMXT00000019381.22.016e-2131.89KN motif and ankyrin repeat domain-containing prot... [more]
kank1a1.322e-1926.12KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
kank1a1.441e-1926.12KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
kank1a1.527e-1926.12KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003964.11.155e-1829.63pep scaffold:Pmarinus_7.0:GL481009:348:11102:1 gen... [more]
ENSPMAT00000004707.16.598e-626.36pep scaffold:Pmarinus_7.0:GL480522:11184:13485:1 g... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO360636.516e-2029.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373307.157e-633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046848.12.732e-2330.26KN motif and ankyrin repeat domain-containing prot... [more]
kank1a1.024e-2028.50KN motif and ankyrin repeat domains 1 [Source:NCBI... [more]
kank1b5.334e-2032.77KN motif and ankyrin repeat domain-containing prot... [more]
kank31.109e-1927.48KN motif and ankyrin repeat domains 3 [Source:NCBI... [more]
kank21.032e-1725.12KN motif and ankyrin repeat domains 2 [Source:NCBI... [more]
back to top
BLAST of KN motif and ankyrin repeat domain-containing protein 4 isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059500.10.000e+099.93SMESG000059500.1[more]
SMESG000043522.11.234e-1825.50SMESG000043522.1[more]
SMESG000017281.15.553e-726.34SMESG000017281.1[more]
SMESG000030607.12.926e-634.74SMESG000030607.1[more]
SMESG000030607.13.265e-635.79SMESG000030607.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029492 ID=SMED30029492|Name=KN motif and ankyrin repeat domain-containing protein 4 isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=4723bp
AGCAAAGTACAAGTATTTAAAAATATATAAATTATCTATTTATAATTGTA
TTTTTTATGTTAAAGAGTGAAGATAAAAGAACGAATAATAAGAAAATGAG
CCAACCGAGACAAAATTCCAATTCGTACATGACGAGAGAGTATTCAGTGA
GATCTCAAATCACCAATGAAATGCTAGCCAATGATAACAAATATCTAAAC
AATGAACCAGAATCACAATGGGGAATTAATCTTATAAATAACTCAGAAAC
TTTACCAACGAGATTCATCAATCGGAATCTGCCAACTTCACTTAATCGTG
CTTCAAATTTAAACAGCATGACAACTTCATCGATAAATTACCAAATGAAC
GAGCCTGATTTACAATGGAAAAACAATAATAATCGATTTGAATCAAGATT
AATGACTGATCTGCCAAGCCCGATGTCTGGAGTTCATAATTTGGCTTCGG
CAACTATGTCTCCCAATATTAACGATAACAGAGATCAGTTTTCTATCTAC
GGGTCTTTCAAAAAACACATTAGTGAAAAAAGAGACAGCTCAATGAAATA
TGATTCAACGCAAGTGATTGAAACTCGTGAAATCAATTATAAAAATTTGC
CAGTTAAACAATCGACAGCTAGTTATACATCTTCAGAGTTTGAAGTTCCA
GTAAATTCTGCATTGACTTCTTCAGGATTTTTCACTCCCCAGACTCGCAG
TCAACAATATACGTTGCAAGACATTCTCAATTCCGATGCCACCGATTCCA
TTAAAAATCAAATAGTTGAAGATGTTCCCATTAAAGCCGAAACTCAAAAT
CAAAATCAAAATTTCTCTAGCTTACCGGAAATTGTAGTTGAAACCCCTAA
AAACGAAATCGCTTCCAAAGATCAAGAAATAAAAAAACTGAATAAAACAA
TTGACAAACTGAACAACAAAATGAAAACTCTCCTGCAAAGCAATGAAGAA
ATGAAAACTCACTTAAAGAATCTTTTAAACGAAAGAAAAAACCTCATTAA
ACAAATCGAGAATTCAGAATTCGAGGAAATAATTGAAGAAGAAGAAGTTC
AAAGAGCTAAGCCTAACATTGCCACGAATGTGATTCCAAGCCAACAAAAA
TCCACTGTAATAAAACAAGAATTGATCAAAGAGAATTATCTAGAAAAAAG
TAAAATAAGTTTACAGGATTTGCCGCAACATATCTTAAATAAATACAGAC
AAGAGATCATAGATTGCGAAAGAGACAAAATCGAACTTGAAAAAAGAACA
TTAATTAATACACTAAATATTCAATATCAACAGCAACTGCAATCTTTGAG
ACACGAGCAAGACATTCGCAAAACCCAAATGAAACATGTCTCAATACAAA
GTTACAAAACAAAGAAATTCAACCAAACTGTGTCTGAAGTGAATTTGTCT
CGATCAACTCCTCCTCCCAAATCAATTGGAACCGTTTTCCAACCAGCAAC
ATTTTCGAAACAATCGCAAAATGACATTAAGGATGAAACGAATAAAAAAT
TAGCCAAAGATCTTGACATTCATTTTACAAATTACATTAGAAGACGACAA
ATTAAAACAACGGAATGGCAAAATACAATTCTGCAACAATTGACAGAATC
TTTGGACAAAAATAACTCAGAGCAATTTATGAATATCATTGAGGAAATTC
TTTTTAAATCATCGAAGAATATTTTAACCTCTGTCCAGCCAACTGTCAGT
AGTAAACTATCGCAAAATGAGGCGATAGAGGACGGAAATAAATCTCTTTC
TAGAGAAGTATCAAAATCATTGAACGAATACATAAGAAGTATTAAAATGA
AATTGTCTGATTGGCAGAAAATTATGTTGGAAAGATTTTTAAAATCTTTG
GAAATGAATGACGTAGACAATCTTTCATCGGTGATCGAGGAAATACTGTT
GAAACAAATGAAATCTGTCGAAACACTCTCTCAACCGGCTACGGTTAGTC
GATTGAGTCAAAATGACTCTAGTGAAGATTCGAATTCAAAGTTGGCAAAC
GAAGCCTTTACTTTATTCACTACGACCATGAGGAGTTCAAGAGTCACCAC
AACAAAATGGCAAGAGTCAATTGTAGAACGATTGATGAATTCCTTGAAAA
CCAATAATTCCCAAATGCTTTCAACGGTGATGGAAGAATTACTTTTTAAA
CCTTCGAGAACTATTGGCATTAACAGTGTACCCGATAACATGAATAAAAA
TAGCCAAACTCAACAAAAGAATTATAGCAATCTTTCTCATGAAGTTAACA
TTGTCGAAGAGAAACCGAAGTTTGAAAGATTATCGAAATCAGTTTCAGCA
AAACCAACAACCTTTCAAAAAGGAATTCAACCCGATGAGAAGTTTTTCTT
TGAAACTGGAACAATGACTGATCATTTGTTTTTTCGGAGTCAAGGAGTTA
ATACTTTGACTGATTATTCGAAAAATTTAAACTCACCATATTCGGAAACC
GATTCTTTCGTTACTAGGACCTCAAGTCGTAATGAATCAAAGAAAGAAAT
CAAGTCTCATACTGTTATCCAATCATCATCAAGCAACTTATTAAAACAAC
ATCAAAAATTACAGGAAAAGTTAGAAATTAAAATTGAACCTCAAAATAAA
AATATTACAGAAGAATGGAACCAGACTTTCTTGGTTAAAGAGCTTAAAGG
ATCAAATCAAAATGTTAGTACGACACTCGACAATATTAAATCAGAAGTAA
AAGAAGAAACAATTATTAAAGCACAAAATAAAACTCAGGAAACTGCTTCG
AAACCCCGAGAATTAATTGAAGAATGGGAGCAAAATATTGAAGAAAAGGT
CCAAGTCATGACTGCACATGTTGATAAAAACCAAAACATAAAAGATGATA
CACAGACGACTGTTGAATGCTGGGAGACAATCTCGAAAATAAAAGACGGA
AAATTAATCGAAAAAAAAGAATGCTACCGAGACAAATATGTCAGTTCGAA
CCCAGATGAAATTCGCAAACATCTTGAATCCCATGAACATAATCATAGCC
ATTCTAATTTCGAAGACAAAAATGATTCCGGAAAATCTGTTGAAACCCAT
AAACACTTTCATCAAAATGAAGAACACAATGAACACCAAAAAAACACTTT
GAGCAACTACGGAAATTCTAGACTCAATACAAAAACTTCTTCGAGTTCGT
TCAATGTTCCAGTAATAAAAGGTTTTGAAGAAACTGAAATTTCCAAATTC
AGAAACTACACAAATCTCGGTGTCAGCCGCAAAGAAGTTTCATCAATTGT
AGAACAACTCTCAAATTCCCAATTGAAAGAAAATCATTCAATATCGGAAA
GAATCGAACAAAGTTCCACATCGAAATCATTCAATTCTCCAATATCTTTC
ACGTCTTTCTCATCGATTTCTACCAACGATAAATCCAATTACGAACCGGC
AAACCAAAGGAAAATCGATATTTTATCGAGAAGTTCCAAGCCGAAAGTTT
TACCGAAACCGATCACAATTCAAAATTCCGAATCATTGCGATCATCACAA
GGAATCAATGTCAATCTCAAAACGTTTTCACCAACCATCGAATCTTCGGA
AATGTATTTTGATGAAACCGAGAACTCAACGGTCATTGGATCAGACAACA
GCGCTTTCTATTCGATATCAGAGCTACCGAAACCGAAGAAAGACGACCAA
AAATATGATTATCAAGAAGTTCTGCTGCCAGAAAACATATTCCAAATGTC
TAGCCAAGTGATGCTGTGGTTAAATACGAGCAAACTTGTTTCTATGAATA
ATATTGAGCATATGCCCCAAGAAATGATTAAGCCGTGCTTAATGCTAATT
GACTGGTGGGTAGACATGGTGATCAAGCTCTCCTCTAACCAACTTCTAAC
AACCGTCCAGTACCTCATTTCAACATTCAATAAGAATTTCGTCAAGTTTC
TTGTCATTAACAGAGATCAACAGGGAAATACTTGCATGCATTACATAATT
GGACATCAATTTTGGGAATCGTTTTCTGTGATTTATGCCACCGGTCTTGT
CGACCCAAACATATACAACGTCCAGGGTTTTACAGTAATGATGTTAGCAG
CAACTCTTCAAGTACCTGATGAAATACTAAATAACCACATTCGGAAACTA
GCGGATAAAGCCGATCTTAACCTTCAGTCAAAGGAACATGGACAGACTGC
CATCTACCTATCAGCTCTTCATGATAATGATAACACCATTACCACTTTGT
ATGCACTGGGAGCAGATATTAATATTAGGGATAGTGAGGAAAATACTCCT
TTAATGATTGCTACAATTAAGAACAACATTAAAGCTGTAAAAGCCATTTT
GGCTTGTCCCGGTGTATTGCTGGAATTAAAAAATAAAGATGGAAATTCAG
CTTTGAAACTCGCGGAACAGAATAATTTTTCAGAAATTAGTGCATTATTT
ACACAAAGAAGATCAATTCGACGTTCTGAAATATCAGGTTATTCAAAAAT
ACTAAGCTCAAACTCTAATCCTATATCCCCAAGAACCTTCAGAAAATATA
CCTACAATTAATCAAGAAATTATTAATTATCACATTTATGCTCATTTATA
GTTGTGATCAATAAATAAGTGCTTTTAATAAATATTTGCACGCTTTGCTG
TGAGTGCTGAATTTGAAATTGACATTTTGCTCATTCCAATTATTGTATTC
ATTGTTTTGTTATTTGATTTTTATACCTATAATGTTTTTTTATGTATTAT
TTATTATTGTGTTGATCGGTTAC
back to top

protein sequence of SMED30029492-orf-1

>SMED30029492-orf-1 ID=SMED30029492-orf-1|Name=SMED30029492-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1485bp
MLKSEDKRTNNKKMSQPRQNSNSYMTREYSVRSQITNEMLANDNKYLNNE
PESQWGINLINNSETLPTRFINRNLPTSLNRASNLNSMTTSSINYQMNEP
DLQWKNNNNRFESRLMTDLPSPMSGVHNLASATMSPNINDNRDQFSIYGS
FKKHISEKRDSSMKYDSTQVIETREINYKNLPVKQSTASYTSSEFEVPVN
SALTSSGFFTPQTRSQQYTLQDILNSDATDSIKNQIVEDVPIKAETQNQN
QNFSSLPEIVVETPKNEIASKDQEIKKLNKTIDKLNNKMKTLLQSNEEMK
THLKNLLNERKNLIKQIENSEFEEIIEEEEVQRAKPNIATNVIPSQQKST
VIKQELIKENYLEKSKISLQDLPQHILNKYRQEIIDCERDKIELEKRTLI
NTLNIQYQQQLQSLRHEQDIRKTQMKHVSIQSYKTKKFNQTVSEVNLSRS
TPPPKSIGTVFQPATFSKQSQNDIKDETNKKLAKDLDIHFTNYIRRRQIK
TTEWQNTILQQLTESLDKNNSEQFMNIIEEILFKSSKNILTSVQPTVSSK
LSQNEAIEDGNKSLSREVSKSLNEYIRSIKMKLSDWQKIMLERFLKSLEM
NDVDNLSSVIEEILLKQMKSVETLSQPATVSRLSQNDSSEDSNSKLANEA
FTLFTTTMRSSRVTTTKWQESIVERLMNSLKTNNSQMLSTVMEELLFKPS
RTIGINSVPDNMNKNSQTQQKNYSNLSHEVNIVEEKPKFERLSKSVSAKP
TTFQKGIQPDEKFFFETGTMTDHLFFRSQGVNTLTDYSKNLNSPYSETDS
FVTRTSSRNESKKEIKSHTVIQSSSSNLLKQHQKLQEKLEIKIEPQNKNI
TEEWNQTFLVKELKGSNQNVSTTLDNIKSEVKEETIIKAQNKTQETASKP
RELIEEWEQNIEEKVQVMTAHVDKNQNIKDDTQTTVECWETISKIKDGKL
IEKKECYRDKYVSSNPDEIRKHLESHEHNHSHSNFEDKNDSGKSVETHKH
FHQNEEHNEHQKNTLSNYGNSRLNTKTSSSSFNVPVIKGFEETEISKFRN
YTNLGVSRKEVSSIVEQLSNSQLKENHSISERIEQSSTSKSFNSPISFTS
FSSISTNDKSNYEPANQRKIDILSRSSKPKVLPKPITIQNSESLRSSQGI
NVNLKTFSPTIESSEMYFDETENSTVIGSDNSAFYSISELPKPKKDDQKY
DYQEVLLPENIFQMSSQVMLWLNTSKLVSMNNIEHMPQEMIKPCLMLIDW
WVDMVIKLSSNQLLTTVQYLISTFNKNFVKFLVINRDQQGNTCMHYIIGH
QFWESFSVIYATGLVDPNIYNVQGFTVMMLAATLQVPDEILNNHIRKLAD
KADLNLQSKEHGQTAIYLSALHDNDNTITTLYALGADINIRDSEENTPLM
IATIKNNIKAVKAILACPGVLLELKNKDGNSALKLAEQNNFSEISALFTQ
RRSIRRSEISGYSKILSSNSNPISPRTFRKYTYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR018264Ribosomal_L33_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003735structural constituent of ribosome
GO:0008013beta-catenin binding
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0010977negative regulation of neuron projection development
GO:0030177positive regulation of Wnt signaling pathway
GO:0030336negative regulation of cell migration
GO:0030837negative regulation of actin filament polymerization
GO:0035024negative regulation of Rho protein signal transduction
GO:0035413positive regulation of catenin import into nucleus
GO:0046627negative regulation of insulin receptor signaling pathway
GO:0090303positive regulation of wound healing
GO:1900025negative regulation of substrate adhesion-dependent cell spreading
GO:1900028negative regulation of ruffle assembly
GO:2000114regulation of establishment of cell polarity
GO:2000393negative regulation of lamellipodium morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
GO:0032587ruffle membrane
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 377..397
NoneNo IPR availableCOILSCoilCoilcoord: 268..323
NoneNo IPR availablePFAMPF13637Ank_4coord: 1364..1414
e-value: 1.0E-5
score: 25.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 976..1012
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 976..1014
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..26
NoneNo IPR availablePANTHERPTHR24168FAMILY NOT NAMEDcoord: 1272..1460
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 1289..1319
e-value: 1800.0
score: 3.1
coord: 1361..1390
e-value: 0.082
score: 22.0
coord: 1394..1423
e-value: 41.0
score: 13.1
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 1361..1393
score: 11.434
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1248..1453
e-value: 6.5E-34
score: 119.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 1263..1449
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1289..1451
score: 20.473