Serine/threonine-protein kinase

Overview
NameSerine/threonine-protein kinase
Smed IDSMED30029489
Length (bp)1589
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase (SMED30029489) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase (SMED30029489) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase (SMED30029489) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase (SMED30029489) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029489

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029489SMESG000041899.1 SMESG000031064.1 SmedASXL_009246SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30029489SMESG000041899.1 SMESG000031064.1 Contig49219uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029489SMESG000041899.1 SMESG000031064.1 Contig49219newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v6_8347_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029489SMESG000041899.1 SMESG000031064.1 dd_Smed_v4_8347_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: NEK7 (NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC:13386])

HSP 1 Score: 416.772 bits (1070), Expect = 1.281e-143
Identity = 196/280 (70.00%), Postives = 230/280 (82.14%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N+ I  K+G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACT 299          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: NEK7 (NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC:13386])

HSP 1 Score: 416.772 bits (1070), Expect = 1.281e-143
Identity = 196/280 (70.00%), Postives = 230/280 (82.14%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N+ I  K+G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACT 299          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 406.371 bits (1043), Expect = 2.347e-139
Identity = 190/269 (70.63%), Postives = 224/269 (83.27%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 1305
            +L +++I  K+G+GQFS VYKA       R  VALKK+QI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VAK+MH
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCLLD--RKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 406.371 bits (1043), Expect = 2.347e-139
Identity = 190/269 (70.63%), Postives = 224/269 (83.27%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 1305
            +L +++I  K+G+GQFS VYKA       R  VALKK+QI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VAK+MH
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCLLD--RKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 406.371 bits (1043), Expect = 2.347e-139
Identity = 190/269 (70.63%), Postives = 224/269 (83.27%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 1305
            +L +++I  K+G+GQFS VYKA       R  VALKK+QI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VAK+MH
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCLLD--RKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMH 307          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 376.711 bits (966), Expect = 2.400e-128
Identity = 183/268 (68.28%), Postives = 215/268 (80.22%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEM 1302
            +L  + I  K+GKGQFS V++A      V   VALKKIQ++EM+D KARQDC+KEIDLLKQL+H NVI+  ASF++NN+LNIVLELA+AGD+S+MIKHF++  +L+PEKTIWKYFVQ+   L HMHSKRIMHRDIKPANVFIT  G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERI E  YN  SD+WS GCLLYEMAALQSPFYGDKM L  LCKKI+ C+YPPLPA+IYS +LR LVS+CI  + + RPE S +  VA+ M
Sbjct:   19 SLELFIIEKKIGKGQFSEVFRA--QCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQVAEHM 284          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 376.711 bits (966), Expect = 2.400e-128
Identity = 183/268 (68.28%), Postives = 215/268 (80.22%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEM 1302
            +L  + I  K+GKGQFS V++A      V   VALKKIQ++EM+D KARQDC+KEIDLLKQL+H NVI+  ASF++NN+LNIVLELA+AGD+S+MIKHF++  +L+PEKTIWKYFVQ+   L HMHSKRIMHRDIKPANVFIT  G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERI E  YN  SD+WS GCLLYEMAALQSPFYGDKM L  LCKKI+ C+YPPLPA+IYS +LR LVS+CI  + + RPE S +  VA+ M
Sbjct:   19 SLELFIIEKKIGKGQFSEVFRA--QCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQVAEHM 284          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 179.489 bits (454), Expect = 4.995e-48
Identity = 95/254 (37.40%), Postives = 147/254 (57.87%), Query Frame = 1
Query:  511 YEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSST--NDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 1266
            YE I  +GKG F +    +Y      ++V +K+I +Y++ D+  R+  + E+ LL +++HPN+I    SF E   L I +E AD G L+QM+    R   L+ E+ I    +Q+CS + ++H   ++HRD+K ANVF+T    VK+GD G+ +   + T    A+++VGTPYY+SPE     +YN  SD+W+LGC+LYEM  L+  F GD   L  L   I  C Y P+    YS E++ ++ + +  DP  RP
Sbjct:  133 YERIRTVGKGAFGSA--VLYRRREDSSLVIIKEINMYDL-DSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLS---RTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGD--NLPALVNSIMTCAYTPVKGP-YSAEMKMVIRELLQLDPQKRP 377          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 179.104 bits (453), Expect = 5.503e-48
Identity = 95/254 (37.40%), Postives = 147/254 (57.87%), Query Frame = 1
Query:  511 YEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSST--NDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 1266
            YE I  +GKG F +    +Y      ++V +K+I +Y++ D+  R+  + E+ LL +++HPN+I    SF E   L I +E AD G L+QM+    R   L+ E+ I    +Q+CS + ++H   ++HRD+K ANVF+T    VK+GD G+ +   + T    A+++VGTPYY+SPE     +YN  SD+W+LGC+LYEM  L+  F GD   L  L   I  C Y P+    YS E++ ++ + +  DP  RP
Sbjct:  171 YERIRTVGKGAFGSA--VLYRRREDSSLVIIKEINMYDL-DSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLS---RTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGD--NLPALVNSIMTCAYTPVKGP-YSAEMKMVIRELLQLDPQKRP 415          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: nekl-2 (Serine/threonine-protein kinase nekl-2 [Source:UniProtKB/Swiss-Prot;Acc:O01775])

HSP 1 Score: 154.836 bits (390), Expect = 3.730e-42
Identity = 90/270 (33.33%), Postives = 149/270 (55.19%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQFSTVY--KAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFR-------RKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQV-KLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 1281
            + NYE +  +G+G F   +  +   +  H + ++ L  I  + M + K       E++LLK++ HP +I  + SF+ +N+L IV++ A+ G L ++I   R       R+Y   PEKT+  YF QI   LNHMH K I+HRD+KP N+ +     V KL D G+ +   + +  A +++GTP Y+SPE    + YN  SD+WSLGC+LYE+  L+  F G+ +  + +  KI      PL  ++ S +++ LV   +    + RP++S +
Sbjct:    1 MDNYEKVRVVGRGAFGVCWLCRGKNDASHQKVIIKL--INTHGMTE-KEENSIQSEVNLLKKVQHPLIIGYIDSFIMDNQLGIVMQYAEGGTLERLINDQRAIKDSNMREY--FPEKTVLDYFTQILIALNHMHQKNIVHRDLKPQNILMNRRKTVLKLSDFGISKELGTKSA-ASTVIGTPNYLSPEICESRPYNQKSDMWSLGCVLYELLQLERAFDGENLPAIVM--KITRSKQNPLGDHV-SNDVKMLVENLLKTHTDKRPDVSQL 261          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 178.718 bits (452), Expect = 2.810e-48
Identity = 97/267 (36.33%), Postives = 147/267 (55.06%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFV--ENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSK----RIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 1281
             L +YE+++ +G G F T YK          + A K +  Y+ +D       + EI +L+QL HPN+++     V  E   + IV+E    GDL+Q+++  R + Q   E  IW+   Q+C  L   H+K     I+HRDIKPAN+F+ + G  KLGD GL R      + A S VGTP+YMSPE +  + Y+  SD+W++GCL+YEM AL+ PF G       L +KI   ++  +PA IYS +L+ +++  +  D   RP I  +
Sbjct:   15 TLQDYEVLAVMGNGSFGTCYKV--RDKSTGELFAWKGMN-YDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRG--RAFDQLSEKIAQGEFSRIPA-IYSTDLQEIIAFMLAVDHEQRPGIEVI 275          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: niki (gene:FBgn0045980 transcript:FBtr0084737)

HSP 1 Score: 175.252 bits (443), Expect = 9.301e-47
Identity = 96/260 (36.92%), Postives = 152/260 (58.46%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQF--STVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 1275
            L NYE +  +G+G F  + +Y+   +G  +      K+I + E+     R   + E+D+  +L HPN++  L SF+++N L I +E AD G L+Q+I   + K    PE+ I   F QI S +N+MHS+ I+HRD+K ANVF+   G VK+GD G+ +  ++  + AQ+++GTPYY SPE    + Y+  SDIW+LGC+L EM  L+  F    ++  +L  KI   +Y P+P+  Y+  LR+L+S  +  +   RP  S
Sbjct:  102 LANYEKVRVVGQGSFGIAILYRRKSDGHQI----VFKQINLSEL-SPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHF-PERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLS--ELVTKIMAGNYTPVPSG-YTSGLRSLMSNLLQVEAPRRPTAS 351          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 142.124 bits (357), Expect = 7.454e-36
Identity = 84/248 (33.87%), Postives = 131/248 (52.82%), Query Frame = 1
Query:  526 KLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYG-DKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 1266
            ++GKG F  V+K + N    + VVA+K I + E  D     D  +EI +L Q D P V K   SF++  +L I++E    G    ++K          E  I     ++  GL+++HS+R +HRDIK ANV ++  G VKL D G+    +++T+   + VGTP++M+PE I +  Y+  +DIWSLG    E+A  + P      M ++ L  K    + PP     Y++  +  V  C+NKDP +RP
Sbjct:   18 RIGKGSFGEVFKGIDN--RTQQVVAIKIIDLEEAEDEI--DDIQQEIMVLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLMKAGS-----FEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPK----NNPPQLTGSYTKSFKDFVEACLNKDPENRP 252          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: SAK (gene:FBgn0026371 transcript:FBtr0078387)

HSP 1 Score: 136.346 bits (342), Expect = 1.446e-33
Identity = 81/254 (31.89%), Postives = 137/254 (53.94%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSR 1263
            + +YE+   LGKG F+TVYKA     H    VA+K I    +  T       +E+++  +L HP+V++    F + N + +VLELA  G+L + + H  R +      +I K   Q+ +GL ++HS  IMHRDI  +N+ ++    VK+ D GL            ++ GTP Y+SPE +   ++ L +D+WS+GC+LY +   + PF  D +       K+ + +Y  +PA++ S E + L+++ + K P+ R
Sbjct:   11 IEDYEVQHLLGKGGFATVYKA--RCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILK---QVVAGLLYLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQ--STLNKVVMSEY-IMPAHL-SYEAQDLINKLLKKLPHER 255          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 134.42 bits (337), Expect = 3.701e-33
Identity = 79/255 (30.98%), Postives = 138/255 (54.12%), Query Frame = 1
Query:  511 YEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPA----NIYSRELRTLVSQCINKDPNSR 1263
            ++I+ KLG+G + +VYKAV+      ++VA+K + +   +      + IKEI +++Q D P V++   S+ +  +L I +E   AG +S ++   R + + + E  I         GL ++H +R +HRDIK AN+ + + G  KL D G+    + +     +++GTP++M+PE I E  Y+  +DIWSLG    EMA  + P YG+    +   + I +    P P+    + +S E    VS+C+ K+P+ R
Sbjct:   42 FDIMYKLGEGSYGSVYKAVHK--ESSSIVAIKLVPVESDL-----HEIIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIM---RLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPP-YGE----IHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDR 281          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: nek7 (NIMA-related kinase 7 [Source:ZFIN;Acc:ZDB-GENE-040801-136])

HSP 1 Score: 429.098 bits (1102), Expect = 9.868e-149
Identity = 200/273 (73.26%), Postives = 231/273 (84.62%), Query Frame = 1
Query:  493 YSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEK 1311
            Y++L N+ I  K+G+GQFS VY+A Y   H  T+VALKKIQI+++MD KARQDCIKEIDLLKQL+HPNVIK  ASF+E NELNIVLELADAGDLSQMI+HF+++ +L+PEKT+WKYFVQ+CS L HMHS+RIMHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS+ELR LV  CIN DP  RP+I+Y+Y +AK MH +
Sbjct:   24 YNSLANFAIEKKIGRGQFSEVYRATYVLDH--TIVALKKIQIFDLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEENELNIVLELADAGDLSQMIRHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRIMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSQELRKLVDMCINPDPEKRPDITYVYSMAKHMHGR 294          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 392.119 bits (1006), Expect = 1.134e-134
Identity = 183/264 (69.32%), Postives = 216/264 (81.82%), Query Frame = 1
Query:  511 YEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEM 1302
            + I  K+G+GQFS VY+A     + +  VALKK+QI+EMMD KARQDC+KEIDLLKQL+HPNVIK L SF+ NNELNIVLELA AGDLSQMI HF++K +L+PE+TIWKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G+VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAAL SPFY DKM L+ LC KI+ C+YPPLP   YS++ R LVS CIN +P+ RP+IS++   + +M
Sbjct:    2 FLIEKKIGRGQFSEVYRATCLLNNQK--VALKKVQIFEMMDAKARQDCVKEIDLLKQLNHPNVIKYLDSFIANNELNIVLELASAGDLSQMIMHFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITASGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALHSPFYSDKMNLLSLCHKIEQCEYPPLPTEHYSQKFRDLVSMCINPEPDQRPDISFVLQFSTQM 263          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 320.857 bits (821), Expect = 6.873e-107
Identity = 158/269 (58.74%), Postives = 190/269 (70.63%), Query Frame = 1
Query:  496 SNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEM 1302
            SNL+N+ I  K+G+GQFS VY+A     + +  VALKK+QI+EMMD KARQDC+KEIDLLKQL+HPNVIK L SF+ NNELNIVLELA AGDLSQMI HF++K +L+PE+TIWKYFVQ+CS L HMHS+R+MHR                                    VGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAAL SPFY DKM L+ LC KI+ C+YPPLP   YS++ R LVS CIN +P+ RP+IS++   + +M
Sbjct:   18 SNLSNFLIEKKIGRGQFSEVYRATCLLNNQK--VALKKVQIFEMMDAKARQDCVKEIDLLKQLNHPNVIKYLDSFIANNELNIVLELASAGDLSQMIMHFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHR------------------------------------VGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALHSPFYSDKMNLLSLCHKIEQCEYPPLPTEHYSQKFRDLVSMCINPEPDQRPDISFVLQFSTQM 248          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 187.193 bits (474), Expect = 6.277e-55
Identity = 104/274 (37.96%), Postives = 162/274 (59.12%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQF--STVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYG---VAKEMHE 1308
            +  YE + K+G+G F  + + K+  +G        +K+I I   M  K RQ+  KE+ +L  + HPN+++   SF E+  L IV++  + GDL + I + R    L PE+ I  +FVQIC  L H+H ++I+HRDIK  N+F+T  G V+LGD G+ R  +S+   A++ +GTPYY+SPE    + YN  SDIW+LGC+LYEM  L+  F    M   +L  KI    YPP+  + YS +LR+L++Q   ++P  RP +S +     +A+ +H+
Sbjct:    1 MDKYERLKKIGEGSFGKAILVKSRTDGRQY----VIKEIGI-SRMSNKERQESRKEVAVLANMSHPNIVQYKESFEESGCLYIVMDYCEGGDLFKKINNQRG--SLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMK--NLVLKIIRGSYPPVSIH-YSPDLRSLLAQLFKRNPRERPSVSTILDKPFLARRIHK 264          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 159.844 bits (403), Expect = 5.176e-45
Identity = 91/257 (35.41%), Postives = 141/257 (54.86%), Query Frame = 1
Query:  496 SNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVE--NNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMH-----SKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCIN 1245
            S   +YE++  +G G +    K               K+  Y  M    +Q  + E++LL++L HPN+++     ++  N  L IV+E  + GDL+ +I    +  + + E+ I +   Q+   L   H     S  ++HRD+KPAN+F+ +   VKLGD GL R  +  T+ A++ VGTPYYMSPE+++  +YN  SDIWSLGCLLYE+ AL  PF     T  +L +KI+   +  +P   YS EL TL+S+ +N
Sbjct:    3 SKTEDYEVLLTIGCGSYGKCQKIKRKSD--------GKVLDYGTMAEGEKQMLVSEVNLLRELKHPNIVRYHDRIIDRTNTTLYIVMEYCEGGDLASLINRSIKDKRYLEEEFILRVMAQLSLALKECHGRSNGSSTVLHRDLKPANIFLDAKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQT--ELARKIREGRFRRIPYR-YSDELNTLLSKMLN 248          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 415.231 bits (1066), Expect = 3.963e-143
Identity = 197/284 (69.37%), Postives = 232/284 (81.69%), Query Frame = 1
Query:  469 ISNVPTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            I+  P   Y+ L N++I   +G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   11 ITLRPDMGYNILANFQIGKMIGRGQFSEVYRATCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 290          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 415.231 bits (1066), Expect = 4.592e-143
Identity = 196/280 (70.00%), Postives = 230/280 (82.14%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N++I   +G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   25 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 300          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 414.846 bits (1065), Expect = 6.145e-143
Identity = 196/280 (70.00%), Postives = 230/280 (82.14%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N++I   +G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   24 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 299          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 414.461 bits (1064), Expect = 6.962e-143
Identity = 196/280 (70.00%), Postives = 230/280 (82.14%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N++I   +G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   14 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 289          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 414.075 bits (1063), Expect = 1.251e-142
Identity = 196/280 (70.00%), Postives = 230/280 (82.14%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N++I   +G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   25 PDMGYNILANFQIGKMIGRGQFSEVYRATCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTYVYEVAKRMHALT 300          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 416.772 bits (1070), Expect = 8.239e-144
Identity = 197/280 (70.36%), Postives = 231/280 (82.50%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N+ I  K+G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L+HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACT 299          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 416.772 bits (1070), Expect = 8.239e-144
Identity = 197/280 (70.36%), Postives = 231/280 (82.50%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N+ I  K+G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L+HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACT 299          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 407.142 bits (1045), Expect = 5.162e-140
Identity = 197/299 (65.89%), Postives = 232/299 (77.59%), Query Frame = 1
Query:  409 NGIIAQPAAYGMYVTPPSSFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 1305
            +G  AQP A      PP            S  T+++I  K+G+GQFS VYKA       R  VALKK+QI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VA++MH
Sbjct:    3 DGRTAQPHASWREPKPPLPCTGACTP---SRPTDFQIEKKIGRGQFSEVYKATCLLD--RKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMH 296          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 404.831 bits (1039), Expect = 6.077e-139
Identity = 190/272 (69.85%), Postives = 225/272 (82.72%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            +L +++I  K+G+GQFS VYKA       R  VALKK+QI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VA++MH  T
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCLLD--RKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMHVWT 310          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 404.831 bits (1039), Expect = 6.077e-139
Identity = 190/272 (69.85%), Postives = 225/272 (82.72%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            +L +++I  K+G+GQFS VYKA       R  VALKK+QI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DP+ RP+I Y++ VA++MH  T
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCLLD--RKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDIVYVHQVARQMHVWT 310          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|Q9ES74|NEK7_MOUSE (Serine/threonine-protein kinase Nek7 OS=Mus musculus OX=10090 GN=Nek7 PE=1 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 5.763e-143
Identity = 197/280 (70.36%), Postives = 231/280 (82.50%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N+ I  K+G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L+HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACT 299          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|Q8TDX7|NEK7_HUMAN (Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 6.152e-143
Identity = 196/280 (70.00%), Postives = 230/280 (82.14%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N+ I  K+G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+++Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACT 299          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|D3ZBE5|NEK7_RAT (Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus OX=10116 GN=Nek7 PE=2 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 9.615e-143
Identity = 197/280 (70.36%), Postives = 231/280 (82.50%), Query Frame = 1
Query:  481 PTNHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            P   Y+ L N+ I  K+G+GQFS VY+A  + +G      VALKK+QI+++MD KAR DCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+CS L+HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV+ CIN DP  RP+I+Y+Y VAK MH  T
Sbjct:   24 PDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDG----VPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACT 299          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|P59895|NEK6_RAT (Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus OX=10116 GN=Nek6 PE=1 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 2.483e-139
Identity = 191/269 (71.00%), Postives = 224/269 (83.27%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 1305
            +L +++I  K+G+GQFS VYKA       R  VALKK+QI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DPN RP+I Y++ VAK+MH
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCLLD--RKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNHRPDIEYVHQVAKQMH 307          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|A2BD05|NEK6_PIG (Serine/threonine-protein kinase Nek6 OS=Sus scrofa OX=9823 GN=NEK6 PE=3 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 5.092e-139
Identity = 190/269 (70.63%), Postives = 224/269 (83.27%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 1305
            +L +++I  K+G+GQFS VYKA       R  VALKK+QI+EMMD KARQDC+KEI LLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F+++ +L+PE+T+WKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC+KI+ CDYPPLP   YS +LR LVS CI  DPN RP+I Y++ VA++MH
Sbjct:   41 SLADFQIEKKIGRGQFSEVYKATCLLD--RKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNQRPDIGYVHQVARQMH 307          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A1I8GQY4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 7.680e-149
Identity = 212/299 (70.90%), Postives = 245/299 (81.94%), Query Frame = 1
Query:  415 IIAQPAAYGMYVTPPSSFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEK 1311
            + + PA    +V P     ++ P N Y +L  ++I  K+GKGQFS V++A+        VVALKK+QI+EMMD KARQDCIKEIDLLKQLDHPNVI+ LASF+ENNELNIVLELADAGDLS+MIKHF+++ +L+PEKTIWKYFVQICSGL+HMHSKRIMHRDIKPANVFIT+ GQVKLGDLGLGRFFSS T +A SLVGTPYYMSPERIHE  YN  SD+WSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLPA+IYS ELR LVS  I   P++RP+ISY+Y VA+ MH K
Sbjct:  102 VASLPAMDADFVVP-----NHDPENKYGSLAKFKIDKKIGKGQFSEVWRAICRED--ECVVALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIKHFKKQQRLIPEKTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITASGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHENGYNFKSDLWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPADIYSSELRDLVSAMIQPSPDARPDISYVYEVAQRMHAK 393          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A267DHE5 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032735g1 PE=3 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 8.502e-149
Identity = 211/277 (76.17%), Postives = 237/277 (85.56%), Query Frame = 1
Query:  487 NHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEK 1311
            N YS L N +I  ++GKGQFS VYKA  + +G     VVALKK+QI+EMMD KARQDCIKEIDLLKQLDHPNVI+ LASF+ENNELNIVLELADAGDLS+MIKHF+++ +L+PEKTIWKYFVQICSGL+HMHSKRIMHRDIKPANVFIT+ GQVKLGDLGLGRFFSS T +A SLVGTPYYMSPERIHE  YN  SD+WSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLPA+IYS ELR LVS  I   P++RP+ISY+Y VA+ MH K
Sbjct:   69 NPYSALANLQIEKRIGKGQFSVVYKAHCIVDG----RVVALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIKHFKKQQRLIPEKTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITASGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHENGYNFKSDLWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPADIYSSELRDLVSAMIQPSPDARPDISYVYEVAQRMHAK 341          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A267H6D4 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033112g2 PE=3 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 9.354e-149
Identity = 211/277 (76.17%), Postives = 237/277 (85.56%), Query Frame = 1
Query:  487 NHYSNLTNYEIISKLGKGQFSTVYKA--VYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEK 1311
            N YS L N +I  ++GKGQFS VYKA  + +G     VVALKK+QI+EMMD KARQDCIKEIDLLKQLDHPNVI+ LASF+ENNELNIVLELADAGDLS+MIKHF+++ +L+PEKTIWKYFVQICSGL+HMHSKRIMHRDIKPANVFIT+ GQVKLGDLGLGRFFSS T +A SLVGTPYYMSPERIHE  YN  SD+WSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLPA+IYS ELR LVS  I   P++RP+ISY+Y VA+ MH K
Sbjct:   68 NPYSALANLQIEKRIGKGQFSVVYKAHCIVDG----RVVALKKVQIFEMMDAKARQDCIKEIDLLKQLDHPNVIRYLASFIENNELNIVLELADAGDLSRMIKHFKKQQRLIPEKTIWKYFVQICSGLDHMHSKRIMHRDIKPANVFITASGQVKLGDLGLGRFFSSKTTNAHSLVGTPYYMSPERIHENGYNFKSDLWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPADIYSSELRDLVSAMIQPSPDARPDISYVYEVAQRMHAK 340          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A5A9NTJ8 (Serine/threonine-protein kinase OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti015099 PE=3 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 7.681e-147
Identity = 203/274 (74.09%), Postives = 230/274 (83.94%), Query Frame = 1
Query:  493 YSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            Y+NL N+ II K+G+GQFS VY+A Y   H  T VALKKIQI+++MD KARQDCIKEIDLLKQL+HPNVIK  ASF+E NELNIVLELADAGDLSQMIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV  CIN DP  RP+I+Y+YG+AK M   T
Sbjct:   26 YNNLANFAIIKKIGRGQFSEVYRATYVLDH--TPVALKKIQIFDLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEENELNIVLELADAGDLSQMIKHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRKLVDMCINPDPEKRPDITYVYGIAKHMQAVT 297          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A067R9N9 (Serine/threonine-protein kinase Nek7 OS=Zootermopsis nevadensis OX=136037 GN=L798_10057 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 1.022e-146
Identity = 201/305 (65.90%), Postives = 243/305 (79.67%), Query Frame = 1
Query:  463 SFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKTRVDSAGGSRTSSRQTSAGSTH 1377
            +  +N+  + Y +LT +++  K+GKGQFS VY+A         VVALKK+QI+EMMD KAR DC+KEI+LL+QL+HPN+I+ ++SF+E+NELNIVLELADAGDLS+MIKHFR++ +L+PE+TIWKYFVQ+CS L HMHSKRIMHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYG+KM L  LC KI+ CDYPPLPA+IYS+ELR LV  CIN +P  RP+ISY+YGVA+EMH + +V  +  S     Q +    H
Sbjct:   13 ALTANLGASVYQSLTIFDVEKKIGKGQFSVVYRARCRADG--AVVALKKVQIFEMMDAKARLDCMKEINLLQQLNHPNIIRYISSFIEDNELNIVLELADAGDLSRMIKHFRKQRRLIPERTIWKYFVQLCSALEHMHSKRIMHRDIKPANVFITAQGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHEHGYNFKSDIWSLGCLLYEMAALQSPFYGEKMNLYTLCMKIEQCDYPPLPADIYSQELRDLVGACINAEPARRPDISYVYGVAREMHARNQVTGSAVSMAHEHQKAMFRHH 315          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:103046491])

HSP 1 Score: 427.172 bits (1097), Expect = 7.797e-148
Identity = 200/274 (72.99%), Postives = 230/274 (83.94%), Query Frame = 1
Query:  493 YSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            YS L+N++I  K+G+GQFS VY+A Y   +  T VALKKIQI+++MD KARQDCIKEIDLLKQL+HPNVIK  ASF+E NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV  CIN DP  RP+I+Y+Y +AK MH  T
Sbjct:   34 YSTLSNFQIEKKIGRGQFSEVYRARYLINN--TAVALKKIQIFDLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEENELNIVLELADAGDLSRMIKHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRKLVDMCINPDPERRPDIAYVYNIAKHMHALT 305          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 398.282 bits (1022), Expect = 1.147e-136
Identity = 186/269 (69.14%), Postives = 223/269 (82.90%), Query Frame = 1
Query:  496 SNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEM 1302
            S L+N+ I  K+G+GQFS VY+A Y   + +  VALKK+QI+EMMD K+RQDCIKEIDLLKQL+HPNVIK L SF+E+NELNIVLELADAGDLS MIK+F++K +L+PE+TIWKYFVQ+CS + HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T    SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFY D+M L+ LC+KI+ CDYPPLP   +S +LR+LVS CIN D + RP+I ++   +K+M
Sbjct:   26 SALSNFRIEKKIGRGQFSEVYRATYLLENQQ--VALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIKYFKKKRRLIPERTIWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTVVHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQM 292          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:103046491])

HSP 1 Score: 377.481 bits (968), Expect = 1.046e-128
Identity = 183/274 (66.79%), Postives = 210/274 (76.64%), Query Frame = 1
Query:  493 YSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            YS L+N++I  K+G+GQFS VY+A Y   +  T VALKKIQ                     QL+HPNVIK  ASF+E NELNIVLELADAGDLS+MIKHF+++ +L+PEKT+WKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLP++ YS ELR LV  CIN DP  RP+I+Y+Y +AK MH  T
Sbjct:   34 YSTLSNFQIEKKIGRGQFSEVYRARYLINN--TAVALKKIQ---------------------QLNHPNVIKYHASFIEENELNIVLELADAGDLSRMIKHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRKLVDMCINPDPERRPDIAYVYNIAKHMHALT 284          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 323.939 bits (829), Expect = 3.211e-108
Identity = 157/268 (58.58%), Postives = 193/268 (72.01%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 1305
            L+N+ I  K+G+GQFS VY+A Y   + +  VALKK+QI+EMMD K+RQDCIKEIDLLKQL+HPNVIK L SF+E+NELNIVLELADAGDLS MIK+F++K +L+PE+TIWKYFVQ+CS + HMHS+R+MHR                                    VGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFY D+M L+ LC+KI+ CDYPPLP   +S +LR+LVS CIN D + RP+I ++   +K+M 
Sbjct:   17 LSNFRIEKKIGRGQFSEVYRATYLLENQQ--VALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIKYFKKKRRLIPERTIWKYFVQLCSAVEHMHSRRVMHR------------------------------------VGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQMQ 246          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 322.398 bits (825), Expect = 1.985e-107
Identity = 166/275 (60.36%), Postives = 196/275 (71.27%), Query Frame = 1
Query:  496 SNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMP--EKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            S L+N+ I  K+G+GQFS VY+A Y   + +  VALKK+QI+EMMD K+RQDCIKEIDLLKQL+HPNVIK L SF+E+NELNIVLELADAGDLS MIK        +P  + T+W                      IKPANVFIT+ G VKLGDLGLGRFFSS T    SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFY D+M L+ LC+KI+ CDYPPLP   +S +LR+LVS CIN D + RP+I ++   +K+M   T
Sbjct:   25 SALSNFRIEKKIGRGQFSEVYRATYLLENQQ--VALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSHMIK--------LPSVQTTVWH---------------------IKPANVFITATGVVKLGDLGLGRFFSSKTTVVHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVLQFSKQMQLWT 268          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.874 bits (455), Expect = 1.859e-52
Identity = 97/261 (37.16%), Postives = 150/261 (57.47%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQFSTVYKAVYNG-GHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 1281
            +  Y ++S++G+G F           GH+  +   K+I I  M   K R +  KE+ +L  + HPN++    SF E   L IV++  + GDL + I    +K  L  E  I  + VQ+C  L H+H ++I+HRDIK  N+F+T  G V+LGD G+ R  +S+T  A++ +GTPYY+SPE    + YN  SD+W+LGC+LYEM  L+  F    M   +L  KI    +PP+ A+ YS ELR+ +S  + +DP +RP ++ +
Sbjct:    1 MERYTMVSQIGEGSFGKAMLVKSKADGHLYVI---KEINISRM-SPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINA--QKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMK--NLVLKIIRGSFPPVSAH-YSSELRSTLSGLLRRDPRARPPVAVL 252          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 168.703 bits (426), Expect = 3.936e-47
Identity = 99/281 (35.23%), Postives = 155/281 (55.16%), Query Frame = 1
Query:  595 VALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVE--NNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMH-----SKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM--YGVAKEMHEKTRVDSA----GGSRTSSRQTSAGSTHSK*SIIS 1398
            V + K+  Y  M    +Q  + E++LL++L HPN+++     ++  N  L IV+E  + GDL+ +I   RR  + + E+ + +   Q+   L   H      + ++HRD+KPANVF+ +   VKLGD GL R     T+ A++ VGTPYYMSPE+    +YN  SDIWSLGCLLYE+ AL  PF    M    L +KIK   +  +P   YS EL  ++S+ +N     RP I  +  YG+  E+ ++ +  +A     G  T+ R+ S GS  ++  +++
Sbjct:    2 VLVWKVLDYGTMSEPEKQMLVSEVNLLRELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLARILQHDTSFAKTFVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPFTA--MNQKQLAEKIKEGKFRRIPYR-YSDELNEIISKMLNLKDYLRPSIEQIMQYGLLAEVLDEEQARAAPEKPRGVPTTERR-SGGSPSAEEGLVA 278          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 163.31 bits (412), Expect = 2.323e-43
Identity = 91/246 (36.99%), Postives = 136/246 (55.28%), Query Frame = 1
Query:  529 LGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 1266
            LG+G F     A+Y      ++V  K+I +  + D K R+D   EID+L  L+H N+I     F++ N L I LE  + G L + I   ++     PEK I  YF Q+ S +  +H+ +I+HRDIK  N+F+T    +K+GD G+ +   S +  A+S VGTPYYMSPE I    YN  SDIW++GC+LYE+  L   F  D    + LC +I          + YS+E++ +V +C+ +D   RP
Sbjct:   42 LGRGAFGEA--ALYRRNEDNSLVVWKEIDLTRLSD-KERRDSQNEIDILSLLEHANIISYYNHFLDGNVLLIELEYCNGGTLYEKI--IKQHGAFFPEKDIVWYFYQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKILDSRSQMAESYVGTPYYMSPELIRGDKYNTKSDIWAMGCVLYELLTLTRTF--DATNPLKLCYEIIHGKKQVEIDDQYSKEIKEVVQKCLQQDAEQRP 280          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 149.058 bits (375), Expect = 2.981e-38
Identity = 93/257 (36.19%), Postives = 143/257 (55.64%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQFSTVYKAV--YNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKM-TLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSR 1263
            +  Y ++  +G+G F  VYK    Y G     VVALK I      D + R +  +EID+++ L HPN+++ L SF  + E+ +V + A+ G+L Q+++        +PE+ + +   Q+ S L ++HS RI+HRD+KP N+ +   G VKL D G  R  S +T    S+ GTP YMSPE + E+ Y+ T+D+WS+GC+LYE+     PFY + +  LV L  K    D    P N+ S E R  +   + K+P  R
Sbjct:    1 MEKYHVLEMIGEGSFGKVYKGRKRYTG----QVVALKFIPKVGRSDKELR-NLRREIDIMRGLQHPNIVQMLDSFETDKEVVVVTDYAE-GELFQILEDDGN----LPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVGTPPFYTNSIFQLVSLIIK----DPVKWPKNM-SSEFRNFLQGLLTKEPKLR 242          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 135.191 bits (339), Expect = 2.578e-36
Identity = 83/261 (31.80%), Postives = 128/261 (49.04%), Query Frame = 1
Query:  526 KLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIK---------EIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGR----FFSSSTNDA-QSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 1266
            +LGKG F TV+  + N G    ++A+K++++ +       Q   K         E++LL  L HPNV++ L + +E N  +I +E    G +++ +    R +  + E     Y  Q+  GL ++H   +MH D+K +N  IT  G VKL D G  +      S   N    S+ GT Y+M+PE I+   Y   +D+WSLGC L+EMA  + PF         L   I+    P LP   +S+E +  V QC  +D   RP
Sbjct:   20 RLGKGAFGTVFLGLTNQG---KLIAVKELELRDAQSANGNQGGQKQSELQKLQDEVELLTTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETV----RGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSCHENGGLHSVHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLP-QAFSKEAQEFVEQCFIRDKLKRP 272          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: KIN3 (Nonessential serine/threonine protein kinase; possible role in DNA damage response; influences tolerance to high levels of ethanol [Source:SGD;Acc:S000000071])

HSP 1 Score: 148.288 bits (373), Expect = 7.436e-40
Identity = 100/319 (31.35%), Postives = 152/319 (47.65%), Query Frame = 1
Query:  505 TNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQI-YEMMDTKARQDCIKEIDLLKQLDHPNVIKCL-ASFVENNE-LNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMH---------------------SKRIMHRDIKPANVFIT-------------------------------------SYGQ--VKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIK--ICDYPPLPANIYSRELRTLVSQCINKDPNSRP 1266
            + Y+++ ++G+G F +V K +    H+ T   L +  I Y  M++K RQ  I E  +L QL H N+++     F E  E L + +E    GDLSQMIKH++++++ +PEK +W    Q+ + L   H                        ++HRD+KP N+F++                                      Y Q  VKLGD GL +   +S   A + VGTPYYMSPE + +Q Y+  SDIWSLGC+++EM +L  PF       ++L  KIK   CD  P     YSR L  ++   I+ +  +RP
Sbjct:   23 SEYQVLEEIGRGSFGSVRKVI----HIPTKKLLVRKDIKYGHMNSKERQQLIAECSILSQLKHENIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIFEMCSLHPPFQAK--NYLELQTKIKNGKCDTVP---EYYSRGLNAIIHSMIDVNLRTRP 332          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 134.035 bits (336), Expect = 2.516e-34
Identity = 98/302 (32.45%), Postives = 157/302 (51.99%), Query Frame = 1
Query:  427 PAAYGMYVTPPSSFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHV--RTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLD-HPNVIKCLASFVE---NNELNIVLELADAGDLSQMIKHFRR---------KYQLMPEKTIWKYFVQICSGLNHMHSK-RIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMT---LVDLCKKIKICDYPPLPAN-IYSRELRTLVSQCINKDPNSRPEI 1272
            PAA  +  T     +S     +Y  L +   + K+G G   TV KA+    HV    +VA K I + +   T   Q  ++E+ ++K +  H N+I    ++     NNE+ I++E +D G L +++  ++R         K     E TI K    + +GL+H++ + +I+HRDIKP+NV I S GQ+KL D G+ +   +S   A + VGT  YMSPERI    Y++  D+WSLG ++ E+   + P  G   T   ++DL ++I     P LP + IYS+E+   V++C  K+   R  I
Sbjct:  168 PAAADLKDT-----LSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKAL----HVPDSKIVAKKTIPVEQNNSTIINQ-LVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSI--ADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSI 457          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 122.094 bits (305), Expect = 1.428e-31
Identity = 77/217 (35.48%), Postives = 118/217 (54.38%), Query Frame = 1
Query:  496 SNLTNYEIISKLGKGQFSTVYKAV-YNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENN--ELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPE-RIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGD 1134
              L NY+ + K+G+G +  VYKA+    G  + VVALKKI++ E  D       I+EI LLK+L   N+++ L   V ++  +L +V E  D  DL + ++    K Q +    + K+ +Q+C G+ + HS RI+HRD+KP N+ I   G +KLGD GL R F          + T +Y +PE  +  + Y+   D WS+GC+  EM   +  F GD
Sbjct:    3 GELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRL-ESEDEGVPSTAIREISLLKELKDDNIVR-LYDIVHSDAHKLYLVFEFLDL-DLKRYMEGIP-KDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGD 215          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 127.102 bits (318), Expect = 1.701e-31
Identity = 77/277 (27.80%), Postives = 139/277 (50.18%), Query Frame = 1
Query:  451 TPPSSFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERI--HEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 1275
            TPPS   +     H  +         LG+G F+  ++   + G +    A K +    +   K R+  + EI + K + HPN+++ +  F +++ + I+LE+   G L +++K  RRK    PE  +  +  QIC  + +MHS+R++HRD+K  N+F  S   +K+GD GL    ++ +    ++ GTP Y++PE +      ++   DIWSLG +LY +   + PF    +  +   ++IK  D+        S E + L+   ++ DP  RP ++
Sbjct:   70 TPPSLIKTRGKDYHRGHF--------LGEGGFARCFQIKDDSGEI---FAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLK--RRKVLTEPE--VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTI--YERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLT 329          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 121.709 bits (304), Expect = 1.020e-30
Identity = 68/240 (28.33%), Postives = 125/240 (52.08%), Query Frame = 1
Query:  409 NGIIAQPAAYGMYVTPPSSFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFY 1128
            +G + + A+ G+ +           +  YS L++++I+  LG G F  V+  +    H     ALK ++ + ++  K  +    E  +L  + HP +I+   +F ++ ++ +V++  + G+L  ++    RK Q  P      Y  ++C  L ++HSK I++RD+KP N+ +   G +K+ D G  ++    T    +L GTP Y++PE +  + YN + D WS G L+YEM A  +PFY
Sbjct:   55 SGKLKEEASAGICLVKKPMLQYRDTSGKYS-LSDFQILRTLGTGSFGRVH--LIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLL----RKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVT---YTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFY 284          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO34646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS0])

HSP 1 Score: 410.223 bits (1053), Expect = 6.349e-142
Identity = 195/271 (71.96%), Postives = 226/271 (83.39%), Query Frame = 1
Query:  493 YSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMH 1305
            Y+ L N+EI  K+G+GQFS VYKA     +   +VALKKIQI++MMD KARQDCIKEIDLLKQL+HPNVIK  ASF+ENNELNIVLELADAGDLS+MIKHF+++ +L+PE+T+WKYFVQ+ + L HMHS+R+MHRDIKPANVFIT+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPERI E  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LCKKI+ CDYPPLPA  YS++LR LVS CIN  P+ RP+I+Y+  +A EMH
Sbjct:   15 YNCLGNFEIEKKIGRGQFSVVYKARCTANN--QIVALKKIQIFDMMDAKARQDCIKEIDLLKQLNHPNVIKYYASFIENNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLTAALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIKENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPAEHYSQQLRHLVSLCINPIPDQRPDITYINEIANEMH 283          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 189.119 bits (479), Expect = 3.740e-56
Identity = 101/260 (38.85%), Postives = 153/260 (58.85%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQF--STVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 1275
            +  Y  + K+G+G F  + + K   +G H      +K+I I  M   + R++  KE+ +L QL HPN++    SF E+  L IV++  D GDL + I   R       E  +  +FVQIC GL H+H ++I+HRDIK  N+F+T +G +K+GD G+ R   S+   A++ +GTPYY+SPE +  + YN  SDIWSLGC+LYEM  L+  F    M   +L  KI    YPP+P   YS ++R LV+Q + ++P+ RP ++
Sbjct:    1 MERYVRVKKIGEGSFGKALLVKKRNDGKHY----VIKEINICRM-KPREREESRKEVKVLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQRG--IAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAFEAGNMK--NLVLKIIRGSYPPIPLR-YSADIRMLVAQLLKRNPHDRPSVN 250          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 176.022 bits (445), Expect = 3.370e-51
Identity = 93/265 (35.09%), Postives = 155/265 (58.49%), Query Frame = 1
Query:  496 SNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVE--NNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKR----IMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEI 1272
              L +YE + ++G G +    K      +   V+  K++   +M +T+ +Q  + E++LL++L HP++++     ++  N  + IV+E  + GDL  +IK  +R+ +   E  +WK   Q+   +   H ++    ++HRD+KPANVF+ +   VKLGD GL R  S  T+ A++ VGTPYYMSPE++++++YN  SDIWSLGCL+YE+ AL  PF    M  + L  KIK+  + P+P++ YS  L  L++  +  +   RP I
Sbjct:    4 GRLHDYEELERIGSGSYGICKKIRRKKDN--KVLVWKELDYGQMSETE-KQMLVSEVNLLRELKHPHIVRYYDRIIDRTNTTIYIVMEFCENGDLGALIKKHKREKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFLDANMNVKLGDFGLARVLSHDTSFAKTFVGTPYYMSPEQVNKRSYNEKSDIWSLGCLMYELCALSPPFTA--MDQIRLEAKIKVGRFHPIPSH-YSSSLSQLINSMLQVNDEMRPSI 262          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO37069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGU2])

HSP 1 Score: 172.17 bits (435), Expect = 5.667e-50
Identity = 96/260 (36.92%), Postives = 149/260 (57.31%), Query Frame = 1
Query:  493 YSNLTNYEIISKLGKGQFSTVY--KAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRP 1266
            Y+N   Y ++ +LG G F TV+  + +   G  +    LK+I + E+   +   D ++E  LL +L+HPN++K + SF++     IV E  + GDL   I  +R+  +   E  I  +F+QI   + HMH  RI+HRD+K  N+F+ +   VKLGD G+ R    +++ A +  GTPYYMSPE +  + YN  SDIWSLG +LYE+  LQ  F G   +L+ +  KI   + P L ++ YS +L+   S+ ++KDP  RP
Sbjct:    2 YAN--RYRVVRRLGSGSFGTVFLVEDLKANGERKV---LKEIYVGELQPDET-VDAMREAKLLSKLNHPNIVKFMDSFMDREYFCIVTEYCEGGDLDDKISAWRKSGKKFDESLILAWFIQIVLAVQHMHEMRILHRDLKTRNIFLKN-NIVKLGDFGISRILMGTSDMATTFTGTPYYMSPEVLKHEGYNHKSDIWSLGVVLYELCNLQHAFQGQ--SLMGVMYKIVEGELPAL-SDKYSSQLQAFYSRLMDKDPKLRP 251          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 163.31 bits (412), Expect = 2.122e-46
Identity = 96/262 (36.64%), Postives = 145/262 (55.34%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNE-LNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 1281
            +L  Y I   +GKG +  V+ + +     + V  LKK+ + +    + R+    E  LL QL HPN++    SF ++   L I +   + GDL   +K   +K   + E  I ++FVQI   L +MH K I+HRD+K  N+F+T    +K+GDLG+ R   SS++ A +L+GTPYYMSPE    + YN  SD+W+LGC LYEM  L+  F    M+   L  KI     PPLP   YS +L +++   +++DP+ RP  S +
Sbjct:    2 SLDRYTIGKCIGKGSYGEVFLSKHKKDKKQYV--LKKVDL-QKASVRERKAAELEAKLLSQLRHPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRLK--AQKGIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMS--SLVYKILKGKTPPLPKQ-YSTDLCSIIKSMLDQDPDKRPSASRL 255          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: nek6 (NIMA related kinase 6 [Source:NCBI gene;Acc:101173323])

HSP 1 Score: 415.616 bits (1067), Expect = 2.612e-143
Identity = 193/272 (70.96%), Postives = 229/272 (84.19%), Query Frame = 1
Query:  499 NLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKT 1314
            ++ N+ +  K+G+GQFS VY+AV      R  VALKK+QI+EMMD KARQDCIKEIDLLKQL+HPN+IK L SF+E+NELNIVLELADAGDLSQMIK+F++K +L+PE+TIWKYFVQ+CS L HMHS+R+MHRDIKPANVFIT+ G+VKLGDLGLGRFFSS T  A SLVGTPYYMSPERIHE  YN  SDIWSLGCLLYEMAALQSPFYGDKM L+ LC+KI+ CDYPPLP + YS +LR LVS CIN +P+ RP+I ++  +A +MH KT
Sbjct:   37 SMANFRVERKIGRGQFSEVYRAVRLLD--RQSVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLLSLCRKIEQCDYPPLPPDQYSDKLRELVSMCINSEPDQRPDIIFVLQIANQMHVKT 306          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:101170580])

HSP 1 Score: 410.223 bits (1053), Expect = 2.409e-141
Identity = 193/275 (70.18%), Postives = 226/275 (82.18%), Query Frame = 1
Query:  493 YSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKTR 1317
            YS+L N++I  K+GKGQFS VY+A Y   +  T VALKKIQI+ +MD KARQDCIKEIDLLKQL+HPNVIK  ASF+E+NELNIVLELADAGDLS+MI HF+ + +L+PEK +WKYFVQ+C  L HMHS+R+MHRDIKPANVF+T+ G VKLGDLGLGRFFSS T  A SLVGTPYYMSPER+ E  YN  SDIWSLGCLLYEMAALQSPFYGDKM L  LC KI+ CDYPPLP++ YS+ELR LV  CIN DP  RP+I+Y+Y +AK+M   T+
Sbjct:   29 YSSLANFQIEKKIGKGQFSEVYRARYILDN--TPVALKKIQIFNLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEDNELNIVLELADAGDLSRMINHFKNQRRLIPEKAVWKYFVQVCRALEHMHSRRVMHRDIKPANVFVTATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERLRENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCTKIQQCDYPPLPSDHYSQELRDLVDMCINPDPEKRPDITYVYDIAKKMRNMTQ 301          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000034147.1 (serine/threonine-protein kinase Nek5 [Source:NCBI gene;Acc:101162253])

HSP 1 Score: 194.897 bits (494), Expect = 8.591e-54
Identity = 104/259 (40.15%), Postives = 156/259 (60.23%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYG-QVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 1275
            + +YE++ ++G+G F   +      G   T   +K+I + + M  K R+   KE+ LL ++ HPN++  ++SF+E   L IV+E  D GDL + I + +R      E+ I   FVQIC GL H+H K+++HRDIK  N+F+T+ G + KLGD G+ R  ++S + A++ VGTPYY+SPE    + YN  +D+WSLGC+LYE+  L+ PF G   +L  L  KI    Y P+P   Y+ ELR LV+Q    +P  RP IS
Sbjct:    1 MNDYEVLWQIGEGAFGKAFLVRSKTGGGDTQCVIKQINL-QKMSAKERESSRKEVTLLSRMRHPNIVSFISSFLEKGSLFIVMEFCDGGDLLKKI-NMQRGVPFR-EEEILDLFVQICLGLKHIHDKKVLHRDIKCQNIFLTNGGMKAKLGDFGIARMLNNSMDLARTCVGTPYYLSPEICESRPYNNKTDVWSLGCVLYELCTLRHPFEGS--SLRQLLGKICRGRYAPVPTR-YTHELRLLVNQLFKVNPRDRPSIS 253          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000000545.2 (pep primary_assembly:ASM223467v1:4:1040495:1044496:1 gene:ENSORLG00000000439.2 transcript:ENSORLT00000000545.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 2.140e-48
Identity = 98/258 (37.98%), Postives = 147/258 (56.98%), Query Frame = 1
Query:  502 LTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEIS 1275
            +  YE + ++G+G F      + N         +K+I I   M TK R++  KE+ +L  + HPN+++   SF E   L IV++  + GDL + I    +K  L  E  I  +FVQIC  L H+H ++I+HRDIK  N+F+T  G V+LGD G+ R   ++   A++ +GTPYY+SPE    + YN   DIW+LGC+LYEM  L+  F    M   +L  KI    YPP+  + YS ELR+L++Q   ++P  RP +S
Sbjct:    1 MDKYENVKQIGEGSFGKA--ILVNSKEDGRQYVIKEIGI-SGMSTKERRESRKEVSVLANMSHPNIVQYKESF-EGGCLYIVMDYCEGGDLFKKINS--QKGVLFSEDQILDWFVQICLALKHVHGRKILHRDIKSQNIFLTKDGTVQLGDFGIARVL-NTVELARTCIGTPYYLSPEICENKPYN-NKDIWALGCVLYEMCTLKHAFEAGNMK--NLVLKIIRGSYPPVSVH-YSPELRSLLAQLFRRNPRERPSVS 247          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: nek2 (NIMA related kinase 2 [Source:NCBI gene;Acc:101168418])

HSP 1 Score: 165.236 bits (417), Expect = 4.375e-45
Identity = 95/268 (35.45%), Postives = 152/268 (56.72%), Query Frame = 1
Query:  496 SNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVE--NNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKR-----IMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPF--YGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEI 1272
            S + +YE++  +G G +    K          ++  K++  Y  M    +Q  + E++LL++L HPN+++     ++  N  L I++E  + GDLS +I    ++ + + E+ I +  VQ+   L   H +R     ++HRD+KPAN+F+ +   VKLGD GL R  +  T+ A++ VGTPYYMSPE+I+  +YN  SDIWSLGCLLYE+ AL  PF  Y  K    +L +KI+   +  +P   YS EL +L+S+ +N     RP +
Sbjct:    3 SCVDDYEVLYTIGSGSYGRCQKIKRKSDG--KILVWKELD-YGTMAECEKQMLVSEVNLLRELKHPNIVRYYDRIIDRRNTMLYIIMEYCEGGDLSCLISKCIKERKYLEEQFILRVMVQLSLALKECHRRRDGRATVLHRDLKPANIFLDANQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQINRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQK----ELAEKIREGKFRRIPFR-YSEELNSLISRMLNLKDYLRPSV 262          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000055481.1 (SMESG000055481.1)

HSP 1 Score: 406.371 bits (1043), Expect = 8.269e-140
Identity = 188/275 (68.36%), Postives = 233/275 (84.73%), Query Frame = 1
Query:  493 YSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYMYGVAKEMHEKTR 1317
            +SNL+ ++I  K+G+GQFSTVY+A     + + ++ALKK++I+EMMD K R+DCIKEIDLLK+LDHP++IK ++SF+E+NEL IVLELADAGDLS+MIKHF ++ +L+PE+TIWKYFVQICS L +MHS+RIMHRDIKPANVFITS G+VKLGD GLGRFFS+ T++  SLVGTPYYMSPERI E  Y++ SDIWSLGC+LYEMAALQSPFYG+ +TL  LC++I+  DYPPLP  IYS ELR LV +CI  DPNSRP IS++Y VAK MHEKTR
Sbjct:   16 FSNLSKFKIQKKIGRGQFSTVYQACCLEINDK-IIALKKVKIFEMMDAKTRRDCIKEIDLLKKLDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMHSQRIMHRDIKPANVFITSKGEVKLGDFGLGRFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRIYSSELRGLVDRCIQTDPNSRPNISHIYHVAKNMHEKTR 289          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000031064.1 (SMESG000031064.1)

HSP 1 Score: 394.815 bits (1013), Expect = 4.920e-137
Identity = 192/194 (98.97%), Postives = 193/194 (99.48%), Query Frame = 1
Query:   37 MDINETKDLEVADLDSSITQTEVTIDCIEQRGHRNNVTNPPIEYFIKNNINNATQQSTIQNCTLIESPQPCYYTDVNGRQIFVNQQINNPQFIYQDNIYVPPPNFLANVMAPSPIQCIRSPFNFNGIIAQPAAYGMYVTPPSSFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQI 618
            MDINETKDLEVADLDSSITQTEVTIDCIEQRGHRNNVTNPPIEYFIKNNINNATQQSTIQNCTLIESPQPCYYTDVNGRQIFVNQQINNPQFIYQDNIYVPPPNFLANVMAPSPIQCIRSPFNFNGIIAQPAAYGMYVTPPS FISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQ+
Sbjct:    1 MDINETKDLEVADLDSSITQTEVTIDCIEQRGHRNNVTNPPIEYFIKNNINNATQQSTIQNCTLIESPQPCYYTDVNGRQIFVNQQINNPQFIYQDNIYVPPPNFLANVMAPSPIQCIRSPFNFNGIIAQPAAYGMYVTPPSPFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQV 194          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000041899.1 (SMESG000041899.1)

HSP 1 Score: 394.815 bits (1013), Expect = 4.920e-137
Identity = 192/194 (98.97%), Postives = 193/194 (99.48%), Query Frame = 1
Query:   37 MDINETKDLEVADLDSSITQTEVTIDCIEQRGHRNNVTNPPIEYFIKNNINNATQQSTIQNCTLIESPQPCYYTDVNGRQIFVNQQINNPQFIYQDNIYVPPPNFLANVMAPSPIQCIRSPFNFNGIIAQPAAYGMYVTPPSSFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQI 618
            MDINETKDLEVADLDSSITQTEVTIDCIEQRGHRNNVTNPPIEYFIKNNINNATQQSTIQNCTLIESPQPCYYTDVNGRQIFVNQQINNPQFIYQDNIYVPPPNFLANVMAPSPIQCIRSPFNFNGIIAQPAAYGMYVTPPS FISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQ+
Sbjct:    1 MDINETKDLEVADLDSSITQTEVTIDCIEQRGHRNNVTNPPIEYFIKNNINNATQQSTIQNCTLIESPQPCYYTDVNGRQIFVNQQINNPQFIYQDNIYVPPPNFLANVMAPSPIQCIRSPFNFNGIIAQPAAYGMYVTPPSPFISNVPTNHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQV 194          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000057044.1 (SMESG000057044.1)

HSP 1 Score: 185.652 bits (470), Expect = 1.637e-51
Identity = 99/264 (37.50%), Postives = 155/264 (58.71%), Query Frame = 1
Query:  484 TNHYSNLTNYEIISKLGKGQFSTVYKAVYNGG--HVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPE 1269
            T H+ N   Y  +S +GKG F TVYK     G     ++  LK++ + + MD    ++C +E  LL +L+H N++K   SF   N   I+ E  + GDL Q+I+  +R    + E  I ++F+Q+  GL+++H ++I+HRD+KP N+F+  Y  VK+GD G+ R  + + + A + +GTPYYMSPE +    YN  SDIWS G +LYEM AL+  F GD +  V +      C  P +P+N YS  L+ ++   + KDP++RP+
Sbjct:    8 TRHWGN--RYIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVNV-DTMDQDQIEECTREGKLLSKLNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRKILHRDLKPNNIFL-KYDSVKIGDFGISRILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILESPC--PRIPSN-YSENLQEVLECILVKDPDNRPK 264          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 185.267 bits (469), Expect = 6.162e-50
Identity = 101/262 (38.55%), Postives = 159/262 (60.69%), Query Frame = 1
Query:  496 SNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDTKARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMIKHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYGQVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLGCLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQCINKDPNSRPEISYM 1281
            S++++++ ++K+G+G F   +  V +    +  V LK+I +Y+M + K R +  KE+ LL +++HPN++    SF E    +I++E  + GDL + IK   +   L  E  +  YF+QIC  L H+H +RI+HRDIKP N+F+T    VKLGD G+ +   S+T   ++ VGTP+Y SPE      YN  SDIWSLGC+LYE+ +L   FYG  +T+  L  +IK  +Y P+P+ ++S  LR LV     + P+ RP I+ +
Sbjct:    2 SSISDFKRLNKIGQGAFGIAW-LVESKIDCKKYV-LKEIGLYKMHE-KERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITI--LAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTI 255          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK71.281e-14370.00NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK71.281e-14370.00NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK62.347e-13970.63NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK62.347e-13970.63NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK62.347e-13970.63NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-32.400e-12868.28Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-32.400e-12868.28Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-14.995e-4837.40NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-15.503e-4837.40NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-23.730e-4233.33Serine/threonine-protein kinase nekl-2 [Source:Un... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek22.810e-4836.33gene:FBgn0029970 transcript:FBtr0071142[more]
niki9.301e-4736.92gene:FBgn0045980 transcript:FBtr0084737[more]
GckIII7.454e-3633.87gene:FBgn0266465 transcript:FBtr0083399[more]
SAK1.446e-3331.89gene:FBgn0026371 transcript:FBtr0078387[more]
hpo3.701e-3330.98gene:FBgn0261456 transcript:FBtr0331920[more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek79.868e-14973.26NIMA-related kinase 7 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek61.134e-13469.32NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek66.873e-10758.74NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek16.277e-5537.96NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek25.176e-4535.41NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek73.963e-14369.37NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek74.592e-14370.00NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek76.145e-14370.00NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek76.962e-14370.00NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek71.251e-14270.00NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek78.239e-14470.36NIMA (never in mitosis gene a)-related expressed k... [more]
Nek78.239e-14470.36NIMA (never in mitosis gene a)-related expressed k... [more]
Nek65.162e-14065.89NIMA (never in mitosis gene a)-related expressed k... [more]
Nek66.077e-13969.85NIMA (never in mitosis gene a)-related expressed k... [more]
Nek66.077e-13969.85NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ES74|NEK7_MOUSE5.763e-14370.36Serine/threonine-protein kinase Nek7 OS=Mus muscul... [more]
sp|Q8TDX7|NEK7_HUMAN6.152e-14370.00Serine/threonine-protein kinase Nek7 OS=Homo sapie... [more]
sp|D3ZBE5|NEK7_RAT9.615e-14370.36Serine/threonine-protein kinase Nek7 OS=Rattus nor... [more]
sp|P59895|NEK6_RAT2.483e-13971.00Serine/threonine-protein kinase Nek6 OS=Rattus nor... [more]
sp|A2BD05|NEK6_PIG5.092e-13970.63Serine/threonine-protein kinase Nek6 OS=Sus scrofa... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GQY47.680e-14970.90Protein kinase domain-containing protein OS=Macros... [more]
A0A267DHE58.502e-14976.17Protein kinase domain-containing protein (Fragment... [more]
A0A267H6D49.354e-14976.17Protein kinase domain-containing protein (Fragment... [more]
A0A5A9NTJ87.681e-14774.09Serine/threonine-protein kinase OS=Triplophysa tib... [more]
A0A067R9N91.022e-14665.90Serine/threonine-protein kinase Nek7 OS=Zootermops... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek77.797e-14872.99NIMA related kinase 7 [Source:NCBI gene;Acc:103046... [more]
nek61.147e-13669.14NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek71.046e-12866.79NIMA related kinase 7 [Source:NCBI gene;Acc:103046... [more]
nek63.211e-10858.58NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek61.985e-10760.36NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007414.11.859e-5237.16pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
nek23.936e-4735.23NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
NEK92.323e-4336.99NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
STK362.981e-3836.19serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
map3k192.578e-3631.80mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN37.436e-4031.35Nonessential serine/threonine protein kinase; poss... [more]
STE72.516e-3432.45Signal transducing MAP kinase kinase; involved in ... [more]
CDC281.428e-3135.48Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
CDC51.701e-3127.80Polo-like kinase; controls targeting and activatio... [more]
TPK31.020e-3028.33cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346466.349e-14271.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498223.740e-5638.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374133.370e-5135.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370695.667e-5036.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496902.122e-4636.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek62.612e-14370.96NIMA related kinase 6 [Source:NCBI gene;Acc:101173... [more]
nek72.409e-14170.18NIMA related kinase 7 [Source:NCBI gene;Acc:101170... [more]
ENSORLT00000034147.18.591e-5440.15serine/threonine-protein kinase Nek5 [Source:NCBI ... [more]
ENSORLT00000000545.22.140e-4837.98pep primary_assembly:ASM223467v1:4:1040495:1044496... [more]
nek24.375e-4535.45NIMA related kinase 2 [Source:NCBI gene;Acc:101168... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055481.18.269e-14068.36SMESG000055481.1[more]
SMESG000031064.14.920e-13798.97SMESG000031064.1[more]
SMESG000041899.14.920e-13798.97SMESG000041899.1[more]
SMESG000057044.11.637e-5137.50SMESG000057044.1[more]
SMESG000020466.16.162e-5038.55SMESG000020466.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029489 ID=SMED30029489|Name=Serine/threonine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1589bp
ATCTATATAAATCTTATATGGCTTTAAAGAAATTTTATGGATATTAATGA
AACCAAAGATTTAGAAGTTGCAGATCTAGATTCTTCTATTACACAAACAG
AAGTGACAATCGACTGTATTGAACAGCGTGGCCACCGAAATAATGTTACT
AATCCCCCAATAGAATATTTTATTAAAAATAATATAAATAATGCAACACA
ACAATCAACAATTCAAAATTGCACTCTTATAGAAAGTCCTCAACCATGTT
ATTACACTGATGTTAATGGACGGCAAATCTTTGTTAATCAACAGATAAAT
AATCCACAGTTCATTTATCAAGATAACATCTATGTACCACCACCAAATTT
TTTGGCAAATGTAATGGCGCCTTCTCCAATACAATGCATTCGTAGTCCTT
TTAACTTCAACGGTATAATTGCCCAACCAGCTGCATATGGCATGTATGTT
ACACCTCCGTCTTCATTCATATCTAATGTTCCGACTAATCACTATTCCAA
TCTTACTAATTATGAAATAATCAGTAAATTGGGTAAAGGACAATTTAGTA
CAGTTTACAAGGCAGTTTATAATGGTGGCCATGTTCGTACAGTCGTGGCT
CTTAAAAAGATACAGATTTACGAAATGATGGATACAAAGGCAAGGCAGGA
TTGTATAAAGGAAATTGATTTATTGAAGCAATTAGATCATCCAAATGTCA
TAAAATGTTTGGCATCGTTTGTTGAAAACAACGAATTGAATATTGTTTTA
GAATTAGCAGATGCAGGGGACCTGTCACAGATGATCAAGCATTTTCGAAG
AAAATATCAACTAATGCCTGAGAAAACTATTTGGAAATATTTCGTTCAAA
TCTGCAGTGGATTAAATCATATGCATTCGAAAAGGATTATGCATCGAGAT
ATTAAGCCTGCTAATGTTTTTATCACATCATATGGCCAAGTAAAACTTGG
AGATTTGGGACTTGGAAGATTTTTTAGCTCGTCAACTAATGATGCTCAAT
CTCTAGTTGGTACTCCATATTACATGTCTCCGGAGAGAATTCATGAACAA
AATTACAACTTGACATCTGATATATGGTCCCTCGGTTGTTTATTGTATGA
AATGGCAGCTTTACAATCCCCGTTTTATGGGGATAAAATGACGCTCGTTG
ACTTGTGTAAGAAAATTAAAATTTGTGACTATCCTCCGCTACCTGCAAAT
ATTTATTCTCGTGAATTACGAACTTTGGTCAGTCAATGTATAAATAAGGA
TCCTAATTCCCGTCCAGAAATCAGTTATATGTACGGTGTTGCTAAAGAAA
TGCACGAAAAAACAAGGGTGGACAGTGCAGGTGGCAGTCGTACGAGTAGC
CGGCAAACAAGTGCCGGCAGCACACATTCTAAATAATCGATAATTTCTTT
ATACTTTATACAACTATTTTTAACAATTTGATCCGTCTTAATCAATTTAG
ATCAATTCTGCATCCGTCCGGATAAAACCACTTTTACAAATACTTTTATC
ATTTTTCACATATCTTCGATTTATATTTTATATTATCATATGAAGCTGTT
GTTTTTAGTAATGTTAAAATATTTACAATATTATGTAGC
back to top

protein sequence of SMED30029489-orf-1

>SMED30029489-orf-1 ID=SMED30029489-orf-1|Name=SMED30029489-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=450bp
MDINETKDLEVADLDSSITQTEVTIDCIEQRGHRNNVTNPPIEYFIKNNI
NNATQQSTIQNCTLIESPQPCYYTDVNGRQIFVNQQINNPQFIYQDNIYV
PPPNFLANVMAPSPIQCIRSPFNFNGIIAQPAAYGMYVTPPSSFISNVPT
NHYSNLTNYEIISKLGKGQFSTVYKAVYNGGHVRTVVALKKIQIYEMMDT
KARQDCIKEIDLLKQLDHPNVIKCLASFVENNELNIVLELADAGDLSQMI
KHFRRKYQLMPEKTIWKYFVQICSGLNHMHSKRIMHRDIKPANVFITSYG
QVKLGDLGLGRFFSSSTNDAQSLVGTPYYMSPERIHEQNYNLTSDIWSLG
CLLYEMAALQSPFYGDKMTLVDLCKKIKICDYPPLPANIYSRELRTLVSQ
CINKDPNSRPEISYMYGVAKEMHEKTRVDSAGGSRTSSRQTSAGSTHSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000910cytokinesis
GO:0007346regulation of mitotic cell cycle
GO:0016310phosphorylation
GO:0032212positive regulation of telomere maintenance via telomerase
GO:0051225spindle assembly
GO:0051973positive regulation of telomerase activity
GO:1904355positive regulation of telomere capping
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 390..412
score: 28.04
coord: 238..251
score: 28.33
coord: 344..366
score: 38.02
coord: 278..296
score: 27.78
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 159..426
e-value: 4.0E-86
score: 302.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 159..413
e-value: 4.7E-64
score: 216.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 159..426
score: 48.188
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 241..448
e-value: 4.1E-17
score: 59.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 200..409
e-value: 3.6E-82
score: 277.1
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 159..241
e-value: 3.6E-82
score: 277.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 431..449
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 425..449
NoneNo IPR availablePANTHERPTHR43289:SF13SERINE/THREONINE-PROTEIN KINASE NEK6coord: 151..426
NoneNo IPR availablePANTHERPTHR43289FAMILY NOT NAMEDcoord: 151..426
NoneNo IPR availableCDDcd08224STKc_Nek6_7coord: 158..421
e-value: 0.0
score: 521.831
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 284..296
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 165..190
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 139..415