Smed-NDK

Overview
NameSmed-NDK (ADD84674.1)
Smed IDSMED30029487
Length (bp)2717
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Smed-NDK (SMED30029487) t-SNE clustered cells

Violin plots show distribution of expression levels for Smed-NDK (SMED30029487) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Smed-NDK (SMED30029487) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Smed-NDK (SMED30029487) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029487

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029487SMESG000062038.1 GU592830.1smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30029487SMESG000062038.1 GU592830.1smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30029487SMESG000062038.1 GU592830.1smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029487SMESG000062038.1 SmedASXL_009279SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029487SMESG000062038.1 GU592830.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30029487SMESG000062038.1 GU592830.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30029487SMESG000062038.1 GU592830.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30029487SMESG000062038.1 dd_Smed_v4_11285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029487SMESG000062038.1 dd_Smed_v6_11285_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029487SMESG000062038.1 OX_Smed_1.0.22718ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029487SMESG000062038.1 GU592830.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
anterior pole cellSMED30029487SMESG000062038.1 GU592830.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Smed-NDK vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 80.1073 bits (196), Expect = 6.249e-15
Identity = 89/344 (25.87%), Postives = 146/344 (42.44%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYS-FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS---SQEKLC------AVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH-LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGL-SLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            G  ++L+CP+    EG   + P   M  W   G+T     +++ +S F    + LK+ K V  ED+G Y CK   GFGS  V + + V+D     +E L         + P   ++  P F  P  +  +  I R VGS+V+L C   G      TW+            E  +    L++ NL+   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+          YG     N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   44 GRTVRLQCPV----EG---DPPPLTM--WTKDGRT-----IHSGWSRFRVLPQGLKV-KQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP-SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVE----------YGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ITRARQDDAGMYICLGANTM----GYSFRSAFLTV 355          
BLAST of Smed-NDK vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 80.1073 bits (196), Expect = 6.249e-15
Identity = 89/344 (25.87%), Postives = 146/344 (42.44%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYS-FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS---SQEKLC------AVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH-LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGL-SLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            G  ++L+CP+    EG   + P   M  W   G+T     +++ +S F    + LK+ K V  ED+G Y CK   GFGS  V + + V+D     +E L         + P   ++  P F  P  +  +  I R VGS+V+L C   G      TW+            E  +    L++ NL+   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+          YG     N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   44 GRTVRLQCPV----EG---DPPPLTM--WTKDGRT-----IHSGWSRFRVLPQGLKV-KQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP-SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVE----------YGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ITRARQDDAGMYICLGANTM----GYSFRSAFLTV 355          
BLAST of Smed-NDK vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 80.1073 bits (196), Expect = 6.249e-15
Identity = 89/344 (25.87%), Postives = 146/344 (42.44%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYS-FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS---SQEKLC------AVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH-LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGL-SLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            G  ++L+CP+    EG   + P   M  W   G+T     +++ +S F    + LK+ K V  ED+G Y CK   GFGS  V + + V+D     +E L         + P   ++  P F  P  +  +  I R VGS+V+L C   G      TW+            E  +    L++ NL+   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+          YG     N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   44 GRTVRLQCPV----EG---DPPPLTM--WTKDGRT-----IHSGWSRFRVLPQGLKV-KQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP-SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVE----------YGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ITRARQDDAGMYICLGANTM----GYSFRSAFLTV 355          
BLAST of Smed-NDK vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 80.1073 bits (196), Expect = 6.249e-15
Identity = 89/344 (25.87%), Postives = 146/344 (42.44%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYS-FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS---SQEKLC------AVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH-LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGL-SLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            G  ++L+CP+    EG   + P   M  W   G+T     +++ +S F    + LK+ K V  ED+G Y CK   GFGS  V + + V+D     +E L         + P   ++  P F  P  +  +  I R VGS+V+L C   G      TW+            E  +    L++ NL+   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+          YG     N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   44 GRTVRLQCPV----EG---DPPPLTM--WTKDGRT-----IHSGWSRFRVLPQGLKV-KQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP-SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVE----------YGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ITRARQDDAGMYICLGANTM----GYSFRSAFLTV 355          
BLAST of Smed-NDK vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 57.7658 bits (138), Expect = 1.347e-7
Identity = 64/248 (25.81%), Postives = 103/248 (41.53%), Query Frame = 1
Query:  607 VSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDP-IMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGI-RGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPN-NSPKILTDISNYTFRSKENISIIVEIECECKDL---IIKWLKRVDRLDPSNK----EHSYGLSLPNAMESEKGEY 1317
            V V  ++    + N +ILKL +  T ED+G+Y CK +   G+ +  FN++V+                   PP  +         + + R+V     L C+V+G+      W   GK L     N E + RG  L + N + +  G Y C V N AG       L +  PP+     + TDIS         I+ ++++ECE + L    I W K    +  S++    +    L +P A  S+   Y
Sbjct: 1399 VQVTESSTIQTVNNGKILKLFR-ATPEDAGRYSCKAINIAGTSQKYFNIDVL------------------VPPTIIGTNFPNEVSVVLNRDVA----LECQVKGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVL-------INSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSATY 1616          
BLAST of Smed-NDK vs. Ensembl Celegans
Match: igcm-4 (ImmunoGlobulin-like Cell adhesion Molecule family [Source:UniProtKB/TrEMBL;Acc:Q95XJ7])

HSP 1 Score: 76.6406 bits (187), Expect = 3.383e-14
Identity = 89/356 (25.00%), Postives = 157/356 (44.10%), Query Frame = 1
Query:  502 EELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVK---TPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKE-------NISI----IVEIECECK---DLIIKWLKRVD------RLDP-SNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRV----QPNLFKTVLNMESVGTHHSGKY--VVTAINKIVNLKSFEYKVV 1479
            ++ +L CPI+ + + +        M +W+  G+    +  +++Y   ++++ LK+ K V  EDSG+Y C+   GFG + + F V V D   +K  +VK      ++   P   +D +    +  I+   G  ++L C  +G+   +  W   +     I          +T+  +++ ++G Y C V N  G L+F + + V D  + +    T+ + Y   + E       NIS+      + +C+ K   + IIKWLK V       R DP S   H  G++L            L +D   T   +      N++   L +  V  HH+GKY  VVT+    +  KS E KV+
Sbjct:   50 KQFRLVCPIIATEKDS-------TMIQWSKNGE---QLDWDSQYKLSKDSKELKM-KSVKFEDSGRYQCQATNGFGHKTIEFIVHVHD-QHDKENSVKDYLVLSNTTASPSWLID-MNSEWRSPIKINTGGKLELRCPAQGNPLPEIRWYQNEME---ISEKTHKHVSTITVEPVESSHSGVYRCVVENPLGSLSFAFDVSVGDFFDPT---TTEATEYQETAMEPVIDQPYNISVYAGHTAQFQCKVKSNENTIIKWLKEVSDPLSIRRKDPNSTVIHVNGMNL------------LVLDHIQTESSLPQEDMDNIYTNRLTIHKVDYHHAGKYICVVTSAQGQIVYKSAELKVL 374          
BLAST of Smed-NDK vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 52.7582 bits (125), Expect = 1.389e-6
Identity = 50/211 (23.70%), Postives = 88/211 (41.71%), Query Frame = 1
Query:  481 DITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTW-LSGKTLAN----WILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIV 1098
            D +   G E+K+ C  VM      +N        W   G+  +S +   K     +N +L++  P   EDSG+Y C+ V   G    AF++++I S                     V P +  G  ++ + +G +V   C+  G+    YTW   G T+ +    ++++ +G     L I N++    G+Y+C   N  G ++    L V
Sbjct:  323 DNSFREGSEVKVNCE-VMGNPKPTIN--------WYHNGKRFISSR---KRQLGLSNNVLRIY-PFLEEDSGRYTCEAVNSVGKVRHAFSLDLISS---------------------VPPNIYEGPQSVSQNLGGSVVFVCKANGNPVPDYTWSFDGSTIGHIKGRFMVSDDGT---ELRISNIEKKDEGYYSCMAGNPVGAMSADAKLTV 496          
BLAST of Smed-NDK vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 51.6026 bits (122), Expect = 3.628e-6
Identity = 55/230 (23.91%), Postives = 96/230 (41.74%), Query Frame = 1
Query:  439 SIHCTIPIVKPFNPDITLNSGE-ELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNT-EGIR----GPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPP 1110
            S+   + I+ P   DI+ N  + ++ +  P +M    T   +PS    +W +K   EV+   N +   +E  ++L++ +   S+ +GK+ C      G +E+   ++V                       F  P++        + +G T+ L C   G+   +  W  G +L   I ++ +G R    G  L IP+LK    G YTCQ  N AG    +  + V  PP
Sbjct: 3755 SLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPS---IKW-LKNGKEVTDDENIR--IVEQGQVLQILR-TDSDHAGKWSCVAENDAGVKELEMVLDV-----------------------FTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSL---IFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPP 3951          

HSP 2 Score: 51.2174 bits (121), Expect = 4.153e-6
Identity = 52/211 (24.64%), Postives = 85/211 (40.28%), Query Frame = 1
Query:  481 DITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTW-LSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPP 1110
            ++ + +G+ L LECPI     G  + +      ++   GQ ++  Q ++  S +    I++     T ED+  Y C  V   G  E  F V            V TP      P  F D    T  +       +T+++ C   G  P + +W L GK +      T       L I N+K +  G YTC   N+AG      ++ +++PP
Sbjct: 2951 NVEVQAGDPLTLECPI-EDTSGVHITWSR----QFGKDGQLDMRAQSSSDKSKL---YIMQ----ATPEDADSYSCIAVNDAGGAEAVFQV-----------TVNTP------PKIFGDSFSTTEIV-----ADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPP 3127          
BLAST of Smed-NDK vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 51.6026 bits (122), Expect = 3.722e-6
Identity = 55/230 (23.91%), Postives = 96/230 (41.74%), Query Frame = 1
Query:  439 SIHCTIPIVKPFNPDITLNSGE-ELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNT-EGIR----GPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPP 1110
            S+   + I+ P   DI+ N  + ++ +  P +M    T   +PS    +W +K   EV+   N +   +E  ++L++ +   S+ +GK+ C      G +E+   ++V                       F  P++        + +G T+ L C   G+   +  W  G +L   I ++ +G R    G  L IP+LK    G YTCQ  N AG    +  + V  PP
Sbjct: 3755 SLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPS---IKW-LKNGKEVTDDENIR--IVEQGQVLQILR-TDSDHAGKWSCVAENDAGVKELEMVLDV-----------------------FTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSL---IFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPP 3951          

HSP 2 Score: 51.2174 bits (121), Expect = 4.189e-6
Identity = 52/211 (24.64%), Postives = 85/211 (40.28%), Query Frame = 1
Query:  481 DITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTW-LSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPP 1110
            ++ + +G+ L LECPI     G  + +      ++   GQ ++  Q ++  S +    I++     T ED+  Y C  V   G  E  F V            V TP      P  F D    T  +       +T+++ C   G  P + +W L GK +      T       L I N+K +  G YTC   N+AG      ++ +++PP
Sbjct: 2951 NVEVQAGDPLTLECPI-EDTSGVHITWSR----QFGKDGQLDMRAQSSSDKSKL---YIMQ----ATPEDADSYSCIAVNDAGGAEAVFQV-----------TVNTP------PKIFGDSFSTTEIV-----ADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPP 3127          
BLAST of Smed-NDK vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 51.2174 bits (121), Expect = 4.154e-6
Identity = 52/211 (24.64%), Postives = 85/211 (40.28%), Query Frame = 1
Query:  481 DITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTW-LSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPP 1110
            ++ + +G+ L LECPI     G  + +      ++   GQ ++  Q ++  S +    I++     T ED+  Y C  V   G  E  F V            V TP      P  F D    T  +       +T+++ C   G  P + +W L GK +      T       L I N+K +  G YTC   N+AG      ++ +++PP
Sbjct: 2951 NVEVQAGDPLTLECPI-EDTSGVHITWSR----QFGKDGQLDMRAQSSSDKSKL---YIMQ----ATPEDADSYSCIAVNDAGGAEAVFQV-----------TVNTP------PKIFGDSFSTTEIV-----ADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPP 3127          
BLAST of Smed-NDK vs. Ensembl Fly
Match: Dscam3 (gene:FBgn0261046 transcript:FBtr0113398)

HSP 1 Score: 50.8322 bits (120), Expect = 7.026e-6
Identity = 73/314 (23.25%), Postives = 126/314 (40.13%), Query Frame = 1
Query:  457 PIVKPFNPDITLNSGEELKLEC-------PIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKT-HYTGHYTCQVHNQAG-GLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKD---LIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKG-EYYLTI------DTGV 1341
            P+++PF     L  G   ++ C       PI  S +  D + PS+L          +++ +    YS +       + K +++  SGKY C       + +V +  E+          V+     +YEP       M T  +     +G+T+ ++CE  G      TW  G+   +       +R  H  + NL T +  G+Y CQ  N+ G GL  T  + V +P     +      N + R  + ++    ++C  K    + I W +   R+D +N   S        M++EKG +  LTI      D+GV
Sbjct:  634 PVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSL----------QITEKKEEFYSLL-------VFKDISARHSGKYTCYASNA--AAKVNYTAEL---------QVRVAPRWRYEP-------MDTAIM-----LGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRN-HSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNEP----ARFEQSARNISSRRNDPVT----LDCHAKGDEPITIGWTQNNGRIDLNNFRFSIA-----EMKTEKGVDSQLTIGHSDRHDSGV 893          
BLAST of Smed-NDK vs. Ensembl Fly
Match: Dscam3 (gene:FBgn0261046 transcript:FBtr0113397)

HSP 1 Score: 50.8322 bits (120), Expect = 7.414e-6
Identity = 73/314 (23.25%), Postives = 126/314 (40.13%), Query Frame = 1
Query:  457 PIVKPFNPDITLNSGEELKLEC-------PIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKT-HYTGHYTCQVHNQAG-GLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKD---LIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKG-EYYLTI------DTGV 1341
            P+++PF     L  G   ++ C       PI  S +  D + PS+L          +++ +    YS +       + K +++  SGKY C       + +V +  E+          V+     +YEP       M T  +     +G+T+ ++CE  G      TW  G+   +       +R  H  + NL T +  G+Y CQ  N+ G GL  T  + V +P     +      N + R  + ++    ++C  K    + I W +   R+D +N   S        M++EKG +  LTI      D+GV
Sbjct:  658 PVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSL----------QITEKKEEFYSLL-------VFKDISARHSGKYTCYASNA--AAKVNYTAEL---------QVRVAPRWRYEP-------MDTAIM-----LGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRN-HSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNEP----ARFEQSARNISSRRNDPVT----LDCHAKGDEPITIGWTQNNGRIDLNNFRFSIA-----EMKTEKGVDSQLTIGHSDRHDSGV 917          
BLAST of Smed-NDK vs. Ensembl Fly
Match: Dscam3 (gene:FBgn0261046 transcript:FBtr0330212)

HSP 1 Score: 50.8322 bits (120), Expect = 7.697e-6
Identity = 73/314 (23.25%), Postives = 126/314 (40.13%), Query Frame = 1
Query:  457 PIVKPFNPDITLNSGEELKLEC-------PIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKT-HYTGHYTCQVHNQAG-GLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKD---LIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKG-EYYLTI------DTGV 1341
            P+++PF     L  G   ++ C       PI  S +  D + PS+L          +++ +    YS +       + K +++  SGKY C       + +V +  E+          V+     +YEP       M T  +     +G+T+ ++CE  G      TW  G+   +       +R  H  + NL T +  G+Y CQ  N+ G GL  T  + V +P     +      N + R  + ++    ++C  K    + I W +   R+D +N   S        M++EKG +  LTI      D+GV
Sbjct:  634 PVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSL----------QITEKKEEFYSLL-------VFKDISARHSGKYTCYASNA--AAKVNYTAEL---------QVRVAPRWRYEP-------MDTAIM-----LGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRN-HSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNEP----ARFEQSARNISSRRNDPVT----LDCHAKGDEPITIGWTQNNGRIDLNNFRFSIA-----EMKTEKGVDSQLTIGHSDRHDSGV 893          
BLAST of Smed-NDK vs. Ensembl Fly
Match: Dscam3 (gene:FBgn0261046 transcript:FBtr0330211)

HSP 1 Score: 50.8322 bits (120), Expect = 7.832e-6
Identity = 73/314 (23.25%), Postives = 126/314 (40.13%), Query Frame = 1
Query:  457 PIVKPFNPDITLNSGEELKLEC-------PIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKT-HYTGHYTCQVHNQAG-GLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKD---LIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKG-EYYLTI------DTGV 1341
            P+++PF     L  G   ++ C       PI  S +  D + PS+L          +++ +    YS +       + K +++  SGKY C       + +V +  E+          V+     +YEP       M T  +     +G+T+ ++CE  G      TW  G+   +       +R  H  + NL T +  G+Y CQ  N+ G GL  T  + V +P     +      N + R  + ++    ++C  K    + I W +   R+D +N   S        M++EKG +  LTI      D+GV
Sbjct:  634 PVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSL----------QITEKKEEFYSLL-------VFKDISARHSGKYTCYASNA--AAKVNYTAEL---------QVRVAPRWRYEP-------MDTAIM-----LGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRN-HSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNEP----ARFEQSARNISSRRNDPVT----LDCHAKGDEPITIGWTQNNGRIDLNNFRFSIA-----EMKTEKGVDSQLTIGHSDRHDSGV 893          
BLAST of Smed-NDK vs. Ensembl Zebrafish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 95.1301 bits (235), Expect = 5.882e-20
Identity = 100/388 (25.77%), Postives = 163/388 (42.01%), Query Frame = 1
Query:  652 RILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQ-------------EKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH--LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDII------GVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSG 1746
            R LK+ K V  ED+G Y C+   GFGS  + F + VID +                  +++ P    +  P F  P     ++ + + VGS+V+L C   G+     TW   ++L +   N +  + P   LT+ NL+   +  YTC V N AG +N TY + V +  N+ P ILT     N T       S   ++  + K  +I+WLKRVD       E  Y     N+     G++Y+ + TG    R     +   L +       +G Y+    N +       Y  V    +++KD+I      G+   L++ I    +++  ++ V+  C  RR  S      +  R  H      + P+ TN  +  S +L +   T SG
Sbjct:   79 RSLKI-KEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRV-LEQPVGSSVRLKCLASGNPTPVITWWKDQSLLD---NPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKP-ILTGTHPVNTTVEFGGTASFQCKVHSDVKP-VIQWLKRVD----PGSEDRY-----NSTLEVGGQHYVVLPTGDVWSRPD-GSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSDPKVEKDVIPRHISPGLPWPLIIGIPAAALLIVGTI-VLWLCHSRRRQSALPPRPTTYRDHHISDKEPSSPN-TNKPDLPSHRLATGPATLSG 447          
BLAST of Smed-NDK vs. Ensembl Zebrafish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 92.0485 bits (227), Expect = 6.592e-19
Identity = 92/357 (25.77%), Postives = 150/357 (42.02%), Query Frame = 1
Query:  652 RILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQ-------------EKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH--LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDII------GVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSH 1653
            R LK+ K V  ED+G Y C+   GFGS  + F + VID +                  +++ P    +  P F  P     ++ + + VGS+V+L C   G+     TW   ++L +   N +  + P   LT+ NL+   +  YTC V N AG +N TY + V +  N+ P ILT     N T       S   ++  + K  +I+WLKRVD       E  Y     N+     G++Y+ + TG    R     +   L +       +G Y+    N +       Y  V    +++KD+I      G+   L++ I    +++  ++ V+  C  RR  S      +  R  H
Sbjct:   79 RSLKI-KEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRV-LEQPVGSSVRLKCLASGNPTPVITWWKDQSLLD---NPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKP-ILTGTHPVNTTVEFGGTASFQCKVHSDVKP-VIQWLKRVD----PGSEDRY-----NSTLEVGGQHYVVLPTGDVWSRPD-GSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSDPKVEKDVIPRHISPGLPWPLIIGIPAAALLIVGTI-VLWLCHSRRRQSALPPRPTTYRDHH 417          
BLAST of Smed-NDK vs. Ensembl Zebrafish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 92.0485 bits (227), Expect = 6.592e-19
Identity = 92/357 (25.77%), Postives = 150/357 (42.02%), Query Frame = 1
Query:  652 RILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQ-------------EKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH--LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDII------GVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSH 1653
            R LK+ K V  ED+G Y C+   GFGS  + F + VID +                  +++ P    +  P F  P     ++ + + VGS+V+L C   G+     TW   ++L +   N +  + P   LT+ NL+   +  YTC V N AG +N TY + V +  N+ P ILT     N T       S   ++  + K  +I+WLKRVD       E  Y     N+     G++Y+ + TG    R     +   L +       +G Y+    N +       Y  V    +++KD+I      G+   L++ I    +++  ++ V+  C  RR  S      +  R  H
Sbjct:   79 RSLKI-KEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRV-LEQPVGSSVRLKCLASGNPTPVITWWKDQSLLD---NPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKP-ILTGTHPVNTTVEFGGTASFQCKVHSDVKP-VIQWLKRVD----PGSEDRY-----NSTLEVGGQHYVVLPTGDVWSRPD-GSYLNKLAIVKARDEDAGMYICLGANTMGYSVRSAYLTVLSDPKVEKDVIPRHISPGLPWPLIIGIPAAALLIVGTI-VLWLCHSRRRQSALPPRPTTYRDHH 417          
BLAST of Smed-NDK vs. Ensembl Zebrafish
Match: fgfrl1a (fibroblast growth factor receptor like 1a [Source:ZFIN;Acc:ZDB-GENE-040128-2])

HSP 1 Score: 89.3521 bits (220), Expect = 4.632e-18
Identity = 109/427 (25.53%), Postives = 174/427 (40.75%), Query Frame = 1
Query:  487 TLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEP--------PCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKD------------------IIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALP 1680
            T+  G  +KL+CP+    EG   + P  +M  W   G+   S  M     F    + L++ K V ++D+G + CK   GFGS  + + + VID S       +   +++Y          P F  P  +  K  I R VGS+V+L C   G+      WL   + L    +     +   L++ NL   ++G YTC V N+AG +N TY + V    N+ P ILT     N T       S   ++  + K  +I+WLKRV+       E  Y     N+       +++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV  D                    IIG+ A +V        IL + L  + +C  R+H      S+ A  S+   PNG   P
Sbjct:   35 TVRIGRTMKLQCPV----EG---DPPPLIM--WTKDGRNIHSGWMR----FRVLQQALRI-KEVEADDAGTFICKATNGFGSVNINYTLIVIDDSSAGREGARPAGETEYSTDLTGKLVRPRFTQP-AKMRKRVIARPVGSSVRLKCTASGNPRPDIVWLKDSRPLTPEEVGEGRKKKWTLSLKNLTPEHSGKYTCHVSNRAGEINATYKVEVIQRTNSKP-ILTGTHPVNTTVDYGGTTSFQCKVRSDVKP-VIQWLKRVE----PGGEGKY-----NSTIEVGDHHFVVLPTGDVWSRPDGSYLNKLL-ITRAKEEDAGMYICLGANTM----GYSFRSAFLTVLPDPKPPFSPIPSVLPPSLPWPVIIGIPAGIV-------FILGTVL--LWFCQSRKHC-----SSGAIISAQTLPNGHRQP 416          
BLAST of Smed-NDK vs. Ensembl Zebrafish
Match: ttn.2 (titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030113-2])

HSP 1 Score: 67.0106 bits (162), Expect = 1.185e-10
Identity = 81/320 (25.31%), Postives = 130/320 (40.62%), Query Frame = 1
Query:  565 SNLMYEWNIKGQT--EVSVQMNTK--------YSFIENNRILKL-TKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH------LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPN--NSPKILTDISNYTFRSKENISIIVEIECECK-----DLIIKWLKRVDRLDPSNKEHSYG-------LSLPNAMESEKGEYYLTIDTGVTTVR-----------VQPNLFKTVLNMESV 1398
            SN  +E  +KG    EV+ Q ++K            +N+ I+ L  +   + D G+Y C      GS           SSQ  L        S  EPP FV+ I     +T+   +G  V+  C VRGS P+   W   ++   WIL    I+         LTIP  ++ ++G YTCQ  N+AG       L+V +PP     P+++            N++    +  ECK     +L +KW K    + PS ++HS         L L +    +KG Y   +   ++  +           + P+  K ++ ME +
Sbjct: 5540 SNAYFECLVKGTAPFEVTWQKDSKDIKSSLKHVILQKNDSIITLDVQKCDALDVGEYQCVVANEVGSC----------SSQSTL--------SIKEPPSFVERIENV--VTV---LGKMVEFKCVVRGSPPLSIQWQKDES---WILEDPSIQRTFENNVATLTIPVCESIHSGKYTCQAMNEAGQEKCFSTLVVQEPPQIIEKPEVI------------NVTAGDPVSFECKVSGTPELKVKWSKDGKEVIPS-RQHSLSYINNVSQLKLQSVQLEDKGTYVFEVSNHISACQCKVTLNVLEQIIPPSFIKPLMEMEEI 5820          

HSP 2 Score: 62.003 bits (149), Expect = 4.289e-9
Identity = 77/304 (25.33%), Postives = 127/304 (41.78%), Query Frame = 1
Query:  514 LECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAV-----KTPKD---SKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIR------GPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVE----IECE---CKDLIIKWLKRVDRLDPSNK------EHSYGLSLPNAMESEKGEYYLTI--DTG 1338
            LEC +  S E         +   W  K +TE+      + +F ++   L+++     EDSG Y C+  +  GS   +  V V   + +  C V     +T  D   +  EPP FV  +  T  +     +   V L C ++GS PM  +W+      + I  +E ++         + I +++  + G YTC   N+AG    T  L V +P           +N T ++K ++S+ V     +EC     K L  KWLK  + L    K      + S  L + +A +S+ GEY   +  D G
Sbjct: 4956 LECKVAGSPE---------ISIRW-YKNETEIGSDDKYQMAFTDSVATLRISS-CCIEDSGDYICQASSDAGSDRCSCLVTVKGDAGKYQCTVGNEVGQTSCDFLVTMKEPPSFVQKMDNTNVL-----LAKDVSLQCVLKGSMPMTISWMKDD---HEIKESEHVQISFENQTAVIYISSVQLKHGGKYTCHAQNEAGSQKCTAVLTVKEP-----------ANITEQAK-SVSVTVRDPATLECRYSGTKVLKAKWLKDGNELTSGRKYKIQSSDTSSILKILSAEKSDAGEYTFEVSNDAG 5228          

HSP 3 Score: 58.5362 bits (140), Expect = 4.052e-8
Identity = 63/235 (26.81%), Postives = 100/235 (42.55%), Query Frame = 1
Query:  484 ITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTW------LSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNN--SPKILTDISNYTFRSK 1164
            I + +G+ +  EC +  + E         L  +W+  G+ EV        S+I N   LKL + V  ED G Y  +      + +    + V++               +  PP F+ P+M   +I     +G  V++ C++ GS P+   W      LSG+T  + IL  E      L I  L+   TG YTC++ N+AG    +  L V +PP+    P+    I N T R K
Sbjct: 5721 INVTAGDPVSFECKVSGTPE---------LKVKWSKDGK-EVIPSRQHSLSYINNVSQLKL-QSVQLEDKGTYVFEVSNHISACQCKVTLNVLE---------------QIIPPSFIKPLMEMEEI-----IGKNVQIGCKISGSLPITVEWEKDGTKLSGRT-KHKILQDEN--SMSLDIECLEKADTGTYTCKLANKAGSCECSGTLRVKEPPSFVLVPESQAVIPNTTVRFK 5921          

HSP 4 Score: 57.7658 bits (138), Expect = 7.253e-8
Identity = 50/164 (30.49%), Postives = 70/164 (42.68%), Query Frame = 1
Query:  622 NTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSG-KTLANWILNTEGIRGPH--LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTD 1104
            N + +F EN   LK+     S DSG Y CK V   G+ E + ++ V                   EPP FV     T    +    G+TV  +  V+GS PMK  W  G K + +       +RG    L + N+   + G YTCQ+ N AG  N   +L V +
Sbjct: 6401 NYEITFTENTCTLKVPTLKLS-DSGTYKCKAVNSAGAAETSASLVV------------------KEPPSFV-----TTPQPVEALPGTTVTFTATVQGSTPMKLKWFRGSKEIVSGRSCEIALRGDTAILELHNIDKSHAGEYTCQIINDAGKENCPVNLFVKE 6540          

HSP 5 Score: 56.225 bits (134), Expect = 2.191e-7
Identity = 57/221 (25.79%), Postives = 87/221 (39.37%), Query Frame = 1
Query:  484 ITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH-----------LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPN 1113
            I++ +GE   LEC +  + E         L  +W  K   E+S     K +F +    LKL     S D+G+Y        GS   A  + V+D               K  PP F   +  T  I     VG +++L C+  GS P+  +W   +         E + GP+           L +P LK   +G Y C+  N AG    +  L+V +PP+
Sbjct: 6269 ISVTAGEAAALECTVSGTPE---------LKPKW-FKDGVELSSGKKYKITFSKMISSLKLLSTERS-DTGEYTFSIKNEVGSDSCAMQLTVLD---------------KIVPPLFSRKLKDTQSI-----VGKSMELDCKASGSAPLTISWFHNEV--------EIMSGPNYEITFTENTCTLKVPTLKLSDSGTYKCKAVNSAGAAETSASLVVKEPPS 6450          

HSP 6 Score: 51.2174 bits (121), Expect = 7.842e-6
Identity = 69/261 (26.44%), Postives = 109/261 (41.76%), Query Frame = 1
Query:  421 IFSYIKSIHCTIPIVK--PFNP----DITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKY--SFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSG----KTLANW----ILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTD---PPNNSPKILTDISN 1146
            I S   S H T+  VK  P  P     I    G+ ++ EC +  S         S +   W   G+   +++ +++Y  SF +N+ +L + K      SG+Y C      GS           S + KL    T ++ +Y PP F   +     + +   VG TV+L C + GS P+K TW       +T  N+    + NT     PHLTI       +G Y+C   N  G  + +  + V +   PP+ + K  T I +
Sbjct: 6713 IGSATSSCHLTVQDVKTPPSFPKKITSIMQIEGQPVQFECRVAGS---------SPMEVSWLKDGE---ALRSDSEYTMSFDDNSAVLNIAKG-EMRHSGEYTCVATNSVGSA----------SCRAKL----TLQEPRY-PPVFDKKL-----VPVDVSVGDTVELECHMTGSMPIKVTWSKDHKDIRTGGNYKISCVENT-----PHLTILKADKADSGRYSCHASNDVGKDSCSTEVSVKERKIPPSFTKKPSTTIED 6935          
BLAST of Smed-NDK vs. Ensembl Xenopus
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:Xenbase;Acc:XB-GENE-944987])

HSP 1 Score: 95.1301 bits (235), Expect = 9.797e-20
Identity = 109/429 (25.41%), Postives = 181/429 (42.19%), Query Frame = 1
Query:  487 TLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKL---------CAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKD---LIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELD-KDIIGVKANLVVYIAVPMVILASSLGVIIY-------CCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGS 1710
            T+  G  +KL CP+       + + P  +M  W   G+T  S    T++   ++   +K+ K V SED+G Y CK   GFGS  V + + VID S               V+     ++  P F  P  +  K  I R VGS+V+L C   G+     TWL   K L +  +     +   L + +LK   +G YTCQV+N+ G +N TY + V     + P ILT   N+   +  +       +C+ +     +I+WLKRV+       E+ Y     N+     G+ ++ + TG    R   +    ++ +       +G Y+    N +     + +K  F+TV  D K  I   A+    +  P++I   +  V I+       C  ++       S  A+ + HR P   A+P + +     S
Sbjct:   34 TVRLGRAIKLLCPV-------EADPPPLIM--WMKDGRTIHSGW--TRFRVYQHG--MKI-KDVESEDAGSYICKATNGFGSINVNYTLIVIDDSSSGKTNQPPDGPNAEVEEFSSKQWARPRFTQP-AKMRKRVIARPVGSSVRLKCIASGNPRPDITWLKDNKPLTSQEIGDNKKKKWTLNLKSLKPEDSGKYTCQVYNRVGQINATYKVEVIQRTRSKP-ILT--GNHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVE----YGTENKY-----NSTIDVGGQKFIVLPTGEVWSRPDGSYLNKLI-ITRAREEDAGMYICLGANTM----GYSFKSAFLTVLPDPKPPIAPVASTNSSLPWPVIIGIPAGAVFIFGTILLWLCQTKKKPC----SPPAAAAIHRQPARVAIPQMPDKEGIAS 426          
BLAST of Smed-NDK vs. Ensembl Xenopus
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:Xenbase;Acc:XB-GENE-944987])

HSP 1 Score: 94.7449 bits (234), Expect = 1.131e-19
Identity = 109/429 (25.41%), Postives = 181/429 (42.19%), Query Frame = 1
Query:  487 TLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKL---------CAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKD---LIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELD-KDIIGVKANLVVYIAVPMVILASSLGVIIY-------CCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGS 1710
            T+  G  +KL CP+       + + P  +M  W   G+T  S    T++   ++   +K+ K V SED+G Y CK   GFGS  V + + VID S               V+     ++  P F  P  +  K  I R VGS+V+L C   G+     TWL   K L +  +     +   L + +LK   +G YTCQV+N+ G +N TY + V     + P ILT   N+   +  +       +C+ +     +I+WLKRV+       E+ Y     N+     G+ ++ + TG    R   +    ++ +       +G Y+    N +     + +K  F+TV  D K  I   A+    +  P++I   +  V I+       C  ++       S  A+ + HR P   A+P + +     S
Sbjct:   24 TVRLGRAIKLLCPV-------EADPPPLIM--WMKDGRTIHSGW--TRFRVYQHG--MKI-KDVESEDAGSYICKATNGFGSINVNYTLIVIDDSSSGKTNQPPDGPNAEVEEFSSKQWARPRFTQP-AKMRKRVIARPVGSSVRLKCIASGNPRPDITWLKDNKPLTSQEIGDNKKKKWTLNLKSLKPEDSGKYTCQVYNRVGQINATYKVEVIQRTRSKP-ILT--GNHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVE----YGTENKY-----NSTIDVGGQKFIVLPTGEVWSRPDGSYLNKLI-ITRAREEDAGMYICLGANTM----GYSFKSAFLTVLPDPKPPIAPVASTNSSLPWPVIIGIPAGAVFIFGTILLWLCQTKKKPC----SPPAAAAIHRQPARVAIPQMPDKEGIAS 416          
BLAST of Smed-NDK vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:549077])

HSP 1 Score: 59.3066 bits (142), Expect = 3.206e-8
Identity = 77/305 (25.25%), Postives = 124/305 (40.66%), Query Frame = 1
Query:  676 VTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH----LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDI-SNYTFRSKENISIIVEIECECKDLIIKWLKRVD----RLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVIL 1563
            VT EDSG Y C  V G G     F++ V+DS      A    +D +  PP +  P  R  K       G+TVK  C   GS      WL             GI+  H    L + ++     G+YTC V N+ G L +TY L V +  ++ P +   + +N T R   ++    ++  + +   I+WLK ++    R  P +  +   L   +   SE    +L        + ++     T L   S+G  H   +++   +K   L+ F      +  E    II     L V +A+ +V+L
Sbjct:  108 VTYEDSGLYICV-VRGTGKILRRFSISVVDS-----LASGDEEDDEDGPPYWTQP-HRMDKKLHAVPAGNTVKFRCPAGGSPLPTIRWLKNGREFRGEHRIGGIQLRHQHWSLVMESVVPSDRGNYTCVVENRIGSLTYTYFLDVLERSSHRPILQAGLPANTTARVGSDVEFYCKVYSDAQPH-IQWLKHIEVNGSRFGPDDFPYVQVLKTADINTSEVEVLHL------RNITMEDAGEYTCLAGNSIGLSHQSAWLIVLPSK---LELF----FLLNPEYMDIIIYTSGFLAVAMAIVIVVL 391          
BLAST of Smed-NDK vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 59.3066 bits (142), Expect = 4.068e-8
Identity = 68/289 (23.53%), Postives = 117/289 (40.48%), Query Frame = 1
Query:  481 DITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLAN---WILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDL---IIKWLKRVDRLDPSNK----EHSYGLSLPNAMESEKGEY 1317
            DIT    E L+++C + ++        P+  +  W   G     +Q  T+Y F+ N R LK+       D+G+Y C      GS + +FN+ +                  Y PP  +     +  +T+     + + L+CEV G  P   +WL    + N    +    G  G  L IP  +    G Y+C   NQAG    T+ L +  PP+    I+ ++ + +      ++    +ECE   +   +I W K    +  ++     E    L++ NA   + GEY
Sbjct: 2762 DITSLVNETLEMDCTVAVT------GSPAPTI-SWLKDGH---PIQEGTRYHFLTNGRTLKILY-AQLMDTGRYVCVVENPAGSVQKSFNLNI------------------YVPPSVIG--SNSENVTVVES--NFISLTCEVTGFPPPAVSWLKDTMVLNSDSHLFIVPG--GRTLQIPQTRLSDVGEYSCIAINQAGEAKKTFFLDIYAPPS----IVANVRDSSTEVNVKVNASTILECESNAIPAPVINWYKNGQPIRETSSYQFLEGGQRLNIRNAQVFDTGEY 3011          

HSP 2 Score: 54.299 bits (129), Expect = 1.113e-6
Identity = 60/238 (25.21%), Postives = 102/238 (42.86%), Query Frame = 1
Query:  640 IENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVD-PIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGI-RGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPN-NSPKILTDISNYTFRSKENISIIVEIECECKDL---IIKWLKRVDRL----DPS--NKEHSYGLSLPNAMESEKGEY 1317
            I  +R + +   +T  D+G+Y C      G  E  ++++V                  ++PP   D  I+    + + +    T+ L CE  GS P   TW  G+T  +     + + +G  L I  +    +GHYTC+ +N AG     Y + V DPP       ++D+S    R        V +EC+ K +    I+W K  +RL    DP+    E+   L + ++  S+ G+Y
Sbjct: 1307 IVEDRAVLVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKV------------------HDPPLIKDMDIISNVSVLLHQ----TMSLLCEASGSPPPLITWYKGRTQVDESATVQILEKGKILKILKMALKDSGHYTCKANNIAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGRE-------VNLECKVKGIPFPSIQWFKE-NRLLSTEDPNVVMLENGQVLHIKHSRLSDSGKY 1514          
BLAST of Smed-NDK vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:549077])

HSP 1 Score: 58.5362 bits (140), Expect = 4.953e-8
Identity = 55/193 (28.50%), Postives = 84/193 (43.52%), Query Frame = 1
Query:  676 VTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH----LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDI-SNYTFRSKENISIIVEIECECKDLIIKWLKRVD 1239
            VT EDSG Y C  V G G     F++ V+DS      A    +D +  PP +  P  R  K       G+TVK  C   GS      WL             GI+  H    L + ++     G+YTC V N+ G L +TY L V +  ++ P +   + +N T R   ++    ++  + +   I+WLK ++
Sbjct:  114 VTYEDSGLYICV-VRGTGKILRRFSISVVDS-----LASGDEEDDEDGPPYWTQP-HRMDKKLHAVPAGNTVKFRCPAGGSPLPTIRWLKNGREFRGEHRIGGIQLRHQHWSLVMESVVPSDRGNYTCVVENRIGSLTYTYFLDVLERSSHRPILQAGLPANTTARVGSDVEFYCKVYSDAQPH-IQWLKHIE 298          
BLAST of Smed-NDK vs. Ensembl Mouse
Match: Fgfrl1 (fibroblast growth factor receptor-like 1 [Source:MGI Symbol;Acc:MGI:2150920])

HSP 1 Score: 80.8777 bits (198), Expect = 2.580e-15
Identity = 87/343 (25.36%), Postives = 147/343 (42.86%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYS-FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS---------SQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            G  ++L+CP+    EG   + P   M  W   G+T     +++ +S F    + LK+ K V +ED+G Y CK   GFGS  V + + ++D                  + P   ++  P F  P  +  +  I R VGS+V+L C   G       W+   +TL +   +    +   L++ NLK   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+    S   H       N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   40 GRTVRLQCPV----EG---DPPPLTM--WTKDGRT-----IHSGWSRFRVLPQGLKV-KEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKESPGPGGSSGGQEDPASQQWARPRFTQP-SKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNKAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVEY--GSEGRH-------NSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ISRARQDDAGMYICLGANTM----GYSFRSAFLTV 351          
BLAST of Smed-NDK vs. Ensembl Mouse
Match: Fgfrl1 (fibroblast growth factor receptor-like 1 [Source:MGI Symbol;Acc:MGI:2150920])

HSP 1 Score: 61.6178 bits (148), Expect = 2.636e-9
Identity = 58/233 (24.89%), Postives = 99/233 (42.49%), Query Frame = 1
Query:  799 PKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            P   ++  P F  P     ++ I R VGS+V+L C   G       W+   +TL +   +    +   L++ NLK   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+    S   H       N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   44 PASQQWARPRFTQPSKMRRRV-IARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNKAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVEY--GSEGRH-------NSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ISRARQDDAGMYICLGANTM----GYSFRSAFLTV 260          
BLAST of Smed-NDK vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 57.7658 bits (138), Expect = 9.301e-8
Identity = 61/234 (26.07%), Postives = 93/234 (39.74%), Query Frame = 1
Query:  622 NTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSG----KTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECK-----DLIIKWLKRVDRLDPSNKEHSYGLSLPNAM 1296
            N + SF++N   LK+ +   S  SG+Y C      G+           SS  +L A + PK S         P      ++I    G +    C V G+QPM+ TW       +   N+ +   G   PHL I  +    +G YTCQ  N  G    +  L V +PP    K+  D S    + +        I+ ECK     ++ + W +    L  S K   Y +S  N++
Sbjct:  123 NLQMSFVDNVATLKILQTDLSH-SGQYSCSASNPLGTA----------SSTARLTA-REPKKS---------PFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVG-NTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFIKKL--DASKVAKQGE-------SIQLECKISGSPEIKVVWFRNDSELHESWK---YNMSFVNSV 322          

HSP 2 Score: 51.2174 bits (121), Expect = 7.981e-6
Identity = 63/256 (24.61%), Postives = 93/256 (36.33%), Query Frame = 1
Query:  625 TKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH------LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPN--NSPKILTDISNYTFRSKENISIIVEIECECK---DLIIKWLKRVDRLDPSNKEH------SYGLSLPNAMESEKGEYYLTIDTGV 1341
            T  +F  +  I  L  P    D G+Y CK     GS   A             C VK       EPP FV  +     +     +G  V+L   V G QP+   WL  K     I  +E +R         L + + +   +G Y CQ+ N AG    +  L V +P      P+ +T  +   F           +EC      +L  KW K    L   ++ H         L +P+A  ++KG Y   ++  V
Sbjct:  410 TSKNFDTSLHIFNLEAP----DIGEYHCKATNEVGSDTCA-------------CTVKF-----KEPPRFVKKLSDASTL-----IGDPVELQAVVEGFQPISVVWLKDK--GEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTTGNPFT----------LECVVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRV 626          
BLAST of Smed-NDK vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 56.6102 bits (135), Expect = 1.735e-7
Identity = 61/234 (26.07%), Postives = 93/234 (39.74%), Query Frame = 1
Query:  622 NTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSG----KTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECK-----DLIIKWLKRVDRLDPSNKEHSYGLSLPNAM 1296
            N + SF++N   LK+ +   S  SG+Y C      G+           SS  +L A + PK S         P      ++I    G +    C V G+QPM+ TW       +   N+ +   G   PHL I  +    +G YTCQ  N  G    +  L V +PP    K+  D S    + +        I+ ECK     ++ + W +    L  S K   Y +S  N++
Sbjct: 2885 NLQMSFVDNVATLKILQTDLSH-SGQYSCSASNPLGTA----------SSTARLTA-REPKKS---------PFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVG-NTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFIKKL--DASKVAKQGE-------SIQLECKISGSPEIKVVWFRNDSELHESWK---YNMSFVNSV 3084          

HSP 2 Score: 51.6026 bits (122), Expect = 6.475e-6
Identity = 58/215 (26.98%), Postives = 89/215 (41.40%), Query Frame = 1
Query:  526 IVMSREGTDVNYPSNLMYEWNIKGQTEVSVQ--------MNTKY---SFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGK---TLANWIL----NTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPN 1113
            I+   +  DV     +  E  + G  E+ V+        + ++Y   SF ENN      + V  +DSG+Y  K    FGS      + V+D                  PP F   + +  K+     +GS++ + C+V GS P+   W   GK   T A + L    NT       L + NL+   T +YTC+V N AG    +  L V +PP+
Sbjct: 1808 IIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF-ENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDI---------------PPSFTKKLTKMDKV-----LGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHENTVS-----LEVSNLELEDTANYTCKVSNVAGDNACSGILTVKEPPS 1996          
BLAST of Smed-NDK vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 56.6102 bits (135), Expect = 2.132e-7
Identity = 61/234 (26.07%), Postives = 93/234 (39.74%), Query Frame = 1
Query:  622 NTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSG----KTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECK-----DLIIKWLKRVDRLDPSNKEHSYGLSLPNAM 1296
            N + SF++N   LK+ +   S  SG+Y C      G+           SS  +L A + PK S         P      ++I    G +    C V G+QPM+ TW       +   N+ +   G   PHL I  +    +G YTCQ  N  G    +  L V +PP    K+  D S    + +        I+ ECK     ++ + W +    L  S K   Y +S  N++
Sbjct: 6214 NLQMSFVDNVATLKILQTDLSH-SGQYSCSASNPLGTA----------SSTARLTA-REPKKS---------PFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVG-NTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFIKKL--DASKVAKQGE-------SIQLECKISGSPEIKVVWFRNDSELHESWK---YNMSFVNSV 6413          

HSP 2 Score: 51.2174 bits (121), Expect = 9.396e-6
Identity = 48/166 (28.92%), Postives = 70/166 (42.17%), Query Frame = 1
Query:  640 IENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGK---TLANWIL----NTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPN 1113
             ENN      + V  +DSG+Y  K    FGS      + V+D                  PP F   + +  K+     +GS++ + C+V GS P+   W   GK   T A + L    NT       L + NL+   T +YTC+V N AG    +  L V +PP+
Sbjct: 5197 FENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDI---------------PPSFTKKLTKMDKV-----LGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHENTVS-----LEVSNLELEDTANYTCKVSNVAGDNACSGILTVKEPPS 5337          
BLAST of Smed-NDK vs. UniProt/SwissProt
Match: sp|Q7T2H2|FGRL1_CHICK (Fibroblast growth factor receptor-like 1 OS=Gallus gallus OX=9031 GN=FGFRL1 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.737e-15
Identity = 96/348 (27.59%), Postives = 151/348 (43.39%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDS----------KYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGL-SLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELD 1500
            G  +KL CP+    EG   + P   M  W   G+T  S    T++  ++    LK+ K V SED+G Y CK   GFGS  V + + VID +     + +TP+ S          ++  P F  P     ++ I R VGS+++L C   G+     TWL   K L    +     +   L + NLK   +G YTC+V N+ G +N TY + V     + P ILT     N T       S   ++  + K  +I+WLKRV+          YG  S  N+     G+ ++ + TG    R   +    ++ +       +G Y+    N +     + ++  F+TV  D
Sbjct:   38 GRTIKLLCPV----EG---DPPPLTM--WMKDGRTIHSGW--TRFRILQQG--LKI-KEVESEDAGTYICKATNGFGSTNVNYTLIVIDDTSSGKNS-QTPEGSNGEYEDHSGKQWAQPRFTQPAKMRRRV-IARPVGSSIRLKCVASGNPRPDITWLKDNKPLMPHEIGENKKKKWTLNLKNLKPEDSGKYTCRVFNKVGEINATYKVEVIQRTRSKP-ILTGTHPVNTTVDYGGTTSFQCKVRSDVKP-VIQWLKRVE----------YGTESKYNSTIDVGGQKFVVLPTGEVWSRPDGSYLNKLM-ITRAKEEDAGMYICLGANTM----GYSFRSAFLTVLPD 352          
BLAST of Smed-NDK vs. UniProt/SwissProt
Match: sp|Q91V87|FGRL1_MOUSE (Fibroblast growth factor receptor-like 1 OS=Mus musculus OX=10090 GN=Fgfrl1 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.805e-14
Identity = 87/343 (25.36%), Postives = 147/343 (42.86%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYS-FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS---------SQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            G  ++L+CP+    EG   + P   M  W   G+T     +++ +S F    + LK+ K V +ED+G Y CK   GFGS  V + + ++D                  + P   ++  P F  P  +  +  I R VGS+V+L C   G       W+   +TL +   +    +   L++ NLK   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+    S   H       N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   40 GRTVRLQCPV----EG---DPPPLTM--WTKDGRT-----IHSGWSRFRVLPQGLKV-KEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKESPGPGGSSGGQEDPASQQWARPRFTQP-SKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNKAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVEY--GSEGRH-------NSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ISRARQDDAGMYICLGANTM----GYSFRSAFLTV 351          
BLAST of Smed-NDK vs. UniProt/SwissProt
Match: sp|Q8N441|FGRL1_HUMAN (Fibroblast growth factor receptor-like 1 OS=Homo sapiens OX=9606 GN=FGFRL1 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.001e-14
Identity = 89/344 (25.87%), Postives = 146/344 (42.44%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYS-FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS---SQEKLC------AVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH-LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGL-SLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            G  ++L+CP+    EG   + P   M  W   G+T     +++ +S F    + LK+ K V  ED+G Y CK   GFGS  V + + V+D     +E L         + P   ++  P F  P  +  +  I R VGS+V+L C   G      TW+            E  +    L++ NL+   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+          YG     N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   44 GRTVRLQCPV----EG---DPPPLTM--WTKDGRT-----IHSGWSRFRVLPQGLKV-KQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP-SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVE----------YGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ITRARQDDAGMYICLGANTM----GYSFRSAFLTV 355          
BLAST of Smed-NDK vs. UniProt/SwissProt
Match: sp|Q7TQM3|FGRL1_RAT (Fibroblast growth factor receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Fgfrl1 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.355e-14
Identity = 87/343 (25.36%), Postives = 146/343 (42.57%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYS-FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS---------SQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITV 1491
            G  ++L+CP+    EG   + P   M  W   G+T     +++ +S F    + LK+ K V +ED+G Y CK   GFGS  V + + ++D                  + P   ++  P F  P     ++ I R VGS+V+L C   G       W+   +TL     +    +   L++ NLK   +G YTC+V N+AG +N TY + V     + P +  T   N T       S   ++  + K  +I+WLKRV+    S   H       N+     G+ ++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV
Sbjct:   40 GRTVRLQCPV----EG---DPPPLTM--WTKDGRT-----IHSGWSRFRVLPQGLKV-KEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKENPGPGGSSGGQEDPVSQQWARPRFTQPSKMRRRV-IARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTRLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKP-VIQWLKRVEYG--SEGRH-------NSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL-ISRARQDDAGMYICLGANTM----GYSFRSAFLTV 351          
BLAST of Smed-NDK vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 6.467e-7
Identity = 64/248 (25.81%), Postives = 103/248 (41.53%), Query Frame = 1
Query:  607 VSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDP-IMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGI-RGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPN-NSPKILTDISNYTFRSKENISIIVEIECECKDL---IIKWLKRVDRLDPSNK----EHSYGLSLPNAMESEKGEY 1317
            V V  ++    + N +ILKL +  T ED+G+Y CK +   G+ +  FN++V+                   PP  +         + + R+V     L C+V+G+      W   GK L     N E + RG  L + N + +  G Y C V N AG       L +  PP+     + TDIS         I+ ++++ECE + L    I W K    +  S++    +    L +P A  S+   Y
Sbjct: 1399 VQVTESSTIQTVNNGKILKLFR-ATPEDAGRYSCKAINIAGTSQKYFNIDVL------------------VPPTIIGTNFPNEVSVVLNRDVA----LECQVKGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVL-------INSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSATY 1616          
BLAST of Smed-NDK vs. TrEMBL
Match: D4P937 (Smed-NDK (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1010.36 bits (2611), Expect = 0.000e+0
Identity = 504/505 (99.80%), Postives = 505/505 (100.00%), Query Frame = 1
Query:  451 TIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFXXXXXXXXXXXXVAVPVSHYQA 1965
            TIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKD+IGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFNNGNPYHHNNGYVAVPVSHYQA
Sbjct:    1 TIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDLIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFNNGNPYHHNNGYVAVPVSHYQA 505          
BLAST of Smed-NDK vs. TrEMBL
Match: Q8I0V7 (NOU-DARAKE OS=Dugesia japonica OX=6161 GN=nou-darake PE=2 SV=1)

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 438/524 (83.59%), Postives = 471/524 (89.89%), Query Frame = 1
Query:  394 MWSFFISWMIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFXXXXXXXXXXXXVAVPVSHYQA 1965
            MW+ FISWMI SYIKSIHCTIP+VKP+ PDITLNSGEELK+ECPIV+SREGTD NYPSNLMYEWNIKG TEVSVQMN KYSFIENNRILKL KPVTSEDSGKY CKGVTGFGSREV FNVE+IDS QE+LCA K PKDSK +PPCFVDP MR+GKITIR+EVGSTVKL C+  GS  +KY WL+GKT+ANWI N EG RGP +TI NLK+HYTG YTCQV N+AG LN+TY LIVTDP NNSPKILTD+SNYTFRSKENISI VEIECECK+ IIKWLKRVD  D SNKE S GL LPNA +SEKGE Y+T+DTGV+T R+QPNLFKT+LNMESV T  SGKYVV AINKIVNLK+FEYKVV+IT+E DKD IG+K NLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRS SASRSSHRC NGSALPSLTNGSNTGSEKLKSPSTT++GMVVGYN YKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQN VAGAQFNN NPYHHNNGYVAVP+SHYQA
Sbjct:    1 MWNVFISWMILSYIKSIHCTIPVVKPYKPDITLNSGEELKIECPIVLSREGTDANYPSNLMYEWNIKGLTEVSVQMNPKYSFIENNRILKLMKPVTSEDSGKYVCKGVTGFGSREVVFNVEIIDSLQERLCAEKNPKDSKLDPPCFVDPQMRSGKITIRKEVGSTVKLPCDAIGSPQLKYLWLTGKTIANWIQNVEGTRGPVITIRNLKSHYTGQYTCQVRNKAGSLNYTYQLIVTDPSNNSPKILTDLSNYTFRSKENISISVEIECECKEPIIKWLKRVDNFDSSNKEQSNGLVLPNAKDSEKGELYVTLDTGVSTKRIQPNLFKTLLNMESVETQQSGKYVVMAINKIVNLKNFEYKVVYITIEPDKDAIGIKNNLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSASASRSSHRCANGSALPSLTNGSNTGSEKLKSPSTTSTGMVVGYNPYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNTVAGAQFNNANPYHHNNGYVAVPISHYQA 524          
BLAST of Smed-NDK vs. TrEMBL
Match: T1E1E1 (NDK OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 317/519 (61.08%), Postives = 396/519 (76.30%), Query Frame = 1
Query:  412 SWMIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPN-GSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFXXXXXXXXXXXXVAVPVSHYQA 1965
            +++ F+Y+   H  +P++K +N +ITL  G+ LK+ECPI +S +G+D +  S++MYEW IK   +VSV MN+KYSF  N+RIL +TKP+  EDSG+Y CKG+TGFGS+E  FN++VID+ Q++LCA     D K E PCF+DP MR G+I +RREVGS V+ SCE  G+ P+KY W SGKT+ANWI   +GIR P ++I  LKT YTG YTCQV NQAG LN+TY LIV D PNNSP+I+T++ NYTFRS +  SI VEIECECK  IIKWLKRV+  D ++K++  GL+LPNA  SEKGE Y+T++ GV+T   Q N+F++ LN+  +G   SGKY+V  +NKIVN K+FEY+ V+I VE DK   G+++NL+VYIAVPMVIL SSL VIIYCCFRRHS GY RST+ASRSSH+C N GS LPS TNGSNTGSEK+KSPSTT++G V  YN YKY+YP QAPSS YDQYSVLSVSH+SQT PQYFQP    AG QF   NPYH NNGYV VP+SHY A
Sbjct:   10 TFICFNYV---HSQVPVIKAYNSEITLKVGDVLKMECPIEVSTDGSDASLQSSIMYEWKIKQFNDVSVAMNSKYSFNHNSRILNITKPLGVEDSGRYVCKGITGFGSKEAVFNIKVIDTLQKRLCAENKINDPKIEAPCFLDPQMRPGEIIVRREVGSYVEFSCEATGTPPLKYLWFSGKTIANWIQTADGIRSPTMSISKLKTTYTGQYTCQVSNQAGSLNYTYRLIVIDSPNNSPRIVTELMNYTFRSGDKASITVEIECECKSPIIKWLKRVEINDNTDKDNLKGLTLPNAKPSEKGELYITLENGVSTRNTQANVFESQLNINPLGKQDSGKYIVMTMNKIVNFKNFEYRAVYINVESDKAYTGIRSNLIVYIAVPMVILLSSLAVIIYCCFRRHSPGYARSTTASRSSHQCGNGGSGLPSFTNGSNTGSEKMKSPSTTSTGAVPVYNQYKYMYPPQAPSSTYDQYSVLSVSHASQTTPQYFQPTITTAGGQF--TNPYHQNNGYVPVPISHYPA 523          
BLAST of Smed-NDK vs. TrEMBL
Match: A0A4E0S3K6 (Fibroblast growth factor receptor 1 OS=Fasciola hepatica OX=6192 GN=D915_000111 PE=4 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 3.490e-77
Identity = 152/441 (34.47%), Postives = 241/441 (54.65%), Query Frame = 1
Query:  454 IPIVKPFNPDITLNSGEELKLECPIVMSREG------------TDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGK-ITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVD--RLDPSNKEHSYGLSLPNAMESEKGEYYLTI-------------------DTGVTTVRVQ-------------------PNLFKTVLNMES--VGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVI--IYCCFRR 1605
            +P+V   N  I L+ G  L+LECP+  +  G            ++ +Y S ++Y W ++ + + S+  + +Y F +N R+L++  P+   DSG Y C GVTGFG REV F+V V D S   LCA ++      + PCF+D  ++    ITI + VGSTV+LSCE  G++P+KY W  G T+A+WI  ++G RGP LTI ++   +TGHYTCQV N  G LN+TY L+VT+ P+ +PKI++D  N TF+S  N ++   I+C C + +I+WLKRV+    D   K  +  +SLPNA +SE  E ++ +                   + G  T  VQ                     +F T ++++       H GKYVV  ++ + ++KS EY V+++ +  D + +  +  +++Y  +P  +L + LG+I  I+ C RR
Sbjct:   28 VPVVANHNKQIRLDIGGHLRLECPVHSTPSGRLISAGEPLVPESNADYGSPVLYHWQVRDRLDYSLDSDPRYRFNDNRRVLEVIVPLELSDSGTYTCMGVTGFGKREVTFDVHVRDPSANLLCAEQSQLHQNVKAPCFIDSKLKHSPVITIEQPVGSTVRLSCESEGTEPIKYRWFMGNTVADWITTSQGARGPILTIDHVGREHTGHYTCQVSNLGGSLNYTYRLVVTELPSATPKIVSDARNQTFQSDSNAALTARIKCACDEPVIQWLKRVEPGEEDKYEKAGATKISLPNARQSEINEMFVVLGSWTGSPAVIDKTVVKRTEEVGSDTTLVQGSEQASKPTLYYGPKPSGTAQIFITRMHLQKPLEKDKHGGKYVVMTMS-LSDIKSMEYAVMYVDILQDPNFLKGR-RILIYFLIPFCLLFAVLGLIAYIFICRRR 466          
BLAST of Smed-NDK vs. TrEMBL
Match: A0A504YYA1 (Fibroblast growth factor receptor 1 OS=Fasciola gigantica OX=46835 GN=FGIG_03382 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 8.655e-77
Identity = 153/463 (33.05%), Postives = 250/463 (54.00%), Query Frame = 1
Query:  400 SFFISWMIF---SYIKS-IHCTIPIVKPFNPDITLNSGEELKLECPIVMSREG------------TDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGK-ITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVD--RLDPSNKEHSYGLSLPNAMESEKGEYYLTI-------------------DTGVTTVRVQ-------------------PNLFKTVLNMES--VGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVI--IYCCFRR 1605
            +  + W I+   SY ++     +P+V   N  I L+ G  L+LECP+  +  G            ++ +Y S ++Y W ++ + + S+  + +Y F +N R+L++  P+   DSG Y C GVTGFG REV F+V V D +   LCA ++      + PCF+D  ++    ITI + VGSTV+LSCE  G++P++Y W  G T+A+WI  ++G RGP LTI ++   +TGHYTCQV N  G LN+TY L+VT+ P+ +PKI++D  N TF+S  N ++   I+C C + +I+WLKRV+    D   K  +  +SLPNA +SE  E ++ +                   + G  T  +Q                     +F T ++++       H GKYVV  ++ + ++KS EY V+++ +  D + +  +  +++Y  +P  +L + LG+I  I+ C RR
Sbjct:    6 TMLLMWYIYALSSYDRTNAETNVPVVANHNKQIRLDIGGHLRLECPVHSTPSGRLISAGEPLVPESNADYGSPVLYHWQVRDRLDYSLDSDPRYRFNDNRRVLEVIVPLELSDSGTYTCMGVTGFGKREVTFDVHVRDPNANLLCAEQSQLHQNVKAPCFIDSKLKHSPVITIEQPVGSTVRLSCESEGAEPIRYRWFMGNTVADWITTSQGARGPVLTIDHVGREHTGHYTCQVSNLGGSLNYTYRLVVTELPSATPKIVSDARNQTFQSDSNAALTARIKCACDEPVIQWLKRVEPGEEDKYEKAGATKISLPNARQSEINEMFVVLGSWAGSPAVIDKTVVKRTEEVGSDTTLIQGSEQASKPTLYYGPKPSETAQIFITRMHLQKPLEKDKHGGKYVVMTMS-LSDIKSMEYAVMYVDILQDPNFLKGR-RILIYFLIPFCLLFAVLGLIAYIFICRRR 466          
BLAST of Smed-NDK vs. Ensembl Cavefish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 92.8189 bits (229), Expect = 2.825e-19
Identity = 100/420 (23.81%), Postives = 173/420 (41.19%), Query Frame = 1
Query:  487 TLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMN---TKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSRE---VAFNVEVIDSSQEKL-----CAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH----LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDI----------IGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPN 1665
            T   G  ++L CP+    EG         ++ W   G+T     +N   +++  +  +  LK+ K V +ED+G Y C+ + GFG+R    V+ +  V +     L      A++ P    +  P F  P     +    + VGS+V+L C   GS     TW   +     +  ++ IRG      LT+ NL+   +G YTC+V N AG +N+TY + V +  N+ P ILT     N T       S   ++  + K  +I+WLKRV+       E  Y     N+     G++++ + TG    R     +   L +       +G Y+    N +     + ++  +++V  D  +           G+   L+  I +P   L     ++++ C  R   G      A    H  P+
Sbjct:   37 TARLGRTVRLPCPV----EGD-----PPPLWHWLKDGRT-----VNPGWSRFRILRGSHSLKI-KEVEAEDAGLYICRAINGFGNRSALCVSDDATVPEHKPPSLEPTAEPALQDPTGQPWAKPRFSRPEKMRRRFR-EQPVGSSVRLKCSANGSPDPGITWWKDQ-----VQMSDPIRGKRQQWTLTLKNLQPQDSGRYTCRVSNTAGFINYTYRVDVIERTNSKP-ILTGTHPVNTTVEFGGTASFQCKVHSDVKP-VIQWLKRVE----PGTESRY-----NSTLEVGGQHFMVLPTGEVWSRPD-GSYLNKLAIVKARDEDAGMYICLGANTM----GYSFRSAYLSVLPDPQVEKSVSPAHLSSGLPWPLI--IGIPAAALLMMGTIVLWLCHSRLRQGALPPRPAPHRDHHTPD 417          
BLAST of Smed-NDK vs. Ensembl Cavefish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 92.8189 bits (229), Expect = 3.151e-19
Identity = 99/417 (23.74%), Postives = 171/417 (41.01%), Query Frame = 1
Query:  487 TLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSRE---VAFNVEVIDSSQEKL-----CAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH----LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDI----------IGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPN 1665
            T   G  ++L CP+    EG         ++ W   G+T       +++  +  +  LK+ K V +ED+G Y C+ + GFG+R    V+ +  V +     L      A++ P    +  P F  P     +    + VGS+V+L C   GS     TW   +     +  ++ IRG      LT+ NL+   +G YTC+V N AG +N+TY + V +  N+ P ILT     N T       S   ++  + K  +I+WLKRV+       E  Y     N+     G++++ + TG    R     +   L +       +G Y+    N +     + ++  +++V  D  +           G+   L+  I +P   L     ++++ C  R   G      A    H  P+
Sbjct:   36 TARLGRTVRLPCPV----EGD-----PPPLWHWLKDGRTVNPGW--SRFRILRGSHSLKI-KEVEAEDAGLYICRAINGFGNRSALCVSDDATVPEHKPPSLEPTAEPALQDPTGQPWAKPRFSRPEKMRRRFR-EQPVGSSVRLKCSANGSPDPGITWWKDQ-----VQMSDPIRGKRQQWTLTLKNLQPQDSGRYTCRVSNTAGFINYTYRVDVIERTNSKP-ILTGTHPVNTTVEFGGTASFQCKVHSDVKP-VIQWLKRVE----PGTESRY-----NSTLEVGGQHFMVLPTGEVWSRPD-GSYLNKLAIVKARDEDAGMYICLGANTM----GYSFRSAYLSVLPDPQVEKSVSPAHLSSGLPWPLI--IGIPAAALLMMGTIVLWLCHSRLRQGALPPRPAPHRDHHTPD 416          
BLAST of Smed-NDK vs. Ensembl Cavefish
Match: fgfrl1a (fibroblast growth factor receptor like 1a [Source:ZFIN;Acc:ZDB-GENE-040128-2])

HSP 1 Score: 63.5438 bits (153), Expect = 6.497e-10
Identity = 76/294 (25.85%), Postives = 119/294 (40.48%), Query Frame = 1
Query:  823 PCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPM-VILASSLGVII--------YCCFRRH-SSGYGRSTSASRSSHRCPN 1665
            P F  P  +  K  I R VGS+V+L C   G+      WL   + L    +     +   L++ NL   ++G YTC V N+AG +N TY + V    N+ P ILT     N T       S   ++  + K  +I+WLKRV+  D S           N+       +++ + TG    R   +    +L +       +G Y+    N +     + ++  F+TV  D          V    +P  VI+    GV+         +C  ++H SSG   S  A  + HR P 
Sbjct:  151 PRFTQP-AKMRKRVIARPVGSSVRLKCTASGNPRPDIVWLKDSRPLTPEEVGEGRKKKWTLSLKNLTPEHSGKYTCHVSNRAGEINATYKVEVIQRTNSKP-ILTGTHPVNTTVDYGGTTSFQCKVRSDVKP-VIQWLKRVEPGDESKF---------NSTIEVGDHHFVVLPTGEVWSRPDGSYLNKLL-ITRAKEEDAGMYICLGANTM----GYSFRSAFLTVLPDNKPYFSPIPAVSSPGLPWPVIIGIPAGVVFILGTILLWFCQSKKHCSSGAMVSAQALPNGHRQPQ 427          
BLAST of Smed-NDK vs. Ensembl Cavefish
Match: ENSAMXT00000037416.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:23529285:23536026:-1 gene:ENSAMXG00000029102.1 transcript:ENSAMXT00000037416.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 6.158e-7
Identity = 49/201 (24.38%), Postives = 79/201 (39.30%), Query Frame = 1
Query:  817 EPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGI------RGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNK------EHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQ----PNLF 1371
            EPP FV  +     +     VGS + + C ++GS PM  +WL  +   + + ++E +      R   L +  ++  + G YTC   N+AG    T  L+V +P       + D +    R               K L  +WL+    L    K      + S  L +  A  S++GEY   +   V T        PN+F
Sbjct:    6 EPPSFVQKLDNMSAL-----VGSEITMQCLLKGSLPMTVSWLKEE---HEVRDSEHVQISFENRTAVLHMSGIELKHGGKYTCTAQNEAGSQKCTAALVVKEPSKPISVTVGDPATLECRFSGT-----------KPLKARWLRDGKELTSGRKYKVQSTDKSSTLKILTAERSDEGEYVFEVSNDVGTRLASSASLPNVF 187          
BLAST of Smed-NDK vs. Ensembl Cavefish
Match: ENSAMXT00000055272.1 (neural cell adhesion molecule L1-like protein [Source:NCBI gene;Acc:103045998])

HSP 1 Score: 53.5286 bits (127), Expect = 9.706e-7
Identity = 62/230 (26.96%), Postives = 101/230 (43.91%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIEN-NRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILT-DISNYTFRSKENISI 1179
            GEEL+LEC      EG    +P+  + EW+  G+         K S I+N  ++L ++K V+ EDSGKY CK   G G     F+V V                   EPP +V   +++  +T+    GS V + C   G       W+ +GK   +   +   ++G  + +     + +  Y C+  N  G L  T +++V    N+ P ILT D   Y     +N+++
Sbjct:  257 GEELELEC----IAEG----FPTPAI-EWSKPGEKL------PKRSNIKNYGKLLTISK-VSEEDSGKYMCKASNGLGEALHYFHVHV------------------EEPPRWVKEPVKSQVVTM----GSDVHIKCHAAGKPQPTVKWMRNGKPFHDHSSSHSTVQGDTIMLLRALPNDSAVYQCEASNPHGTLLGTANVMVM---NHPPLILTKDYQEYATVRGKNVTM 445          
BLAST of Smed-NDK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006750.1 (pep scaffold:Pmarinus_7.0:GL477426:19036:34193:1 gene:ENSPMAG00000006079.1 transcript:ENSPMAT00000006750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 2.881e-13
Identity = 99/428 (23.13%), Postives = 186/428 (43.46%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS-----------SQEKLCAVKTPK---DSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVE--------LDKDIIGVKANL--VVYIAVPM-VILASSLGVIIYCCFRRHSSGYGRSTSAS-RSSHRCPNGSALPSLTNGSN 1701
            G  LKL CP+    EG   + P  +M  W+  G+   S  M  +Y  + +   L++T+ +  +D+G + C+   GFGS  + +++ VI +            +E   +++  K     ++  P F  P     ++ I R VGS+V+L C   GS      W   + +       +G +   L + +L+    G YTC+V N+ G ++ TY + V +   + P +  T   N T     + S+  ++  + K  +I+WLKRV   +P      +GL   N+    +G+ +  + TG    R   +    ++ + +     +G Y+    N +     + ++  F+TV+        + ++ +   ++L     + +P  V L  ++     C   RH   + RS+SAS R   R  +  A  S   GS+
Sbjct:   42 GRTLKLSCPV----EG---DPPPLIM--WSKDGRNIHSGWM--RYRVLRDG--LRVTE-LEPDDAGVFTCQATNGFGSVTINYSLAVIANITIPPYLPAPCLREPNASMQIQKPGGQPRWMKPRFTQPAKMRRRV-IARPVGSSVRLKCNAGGSPRPDVVWFKDEHVFG--DAAQGKKRWTLILRSLRPEDAGRYTCRVSNRFGEISATYKIDVIERMRSKPVLTGTHPVNTTVDFGGSTSLQCKVRSDVKP-VIQWLKRV---EPGG---VHGL---NSTIDVRGQRFAVLPTGEVWSRPDGSYLNKLVIVRAR-AEDAGMYICLGANSM----GYSFRSAFLTVQSAQSDPTKMKREPLPTASSLPWPAIVGIPTGVCLLLAMATFWLC---RH---HNRSSSASPRGGERTASAQATLSEKEGSS 431          
BLAST of Smed-NDK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002502.1 (pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-1 gene:ENSPMAG00000002253.1 transcript:ENSPMAT00000002502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 5.833e-9
Identity = 63/222 (28.38%), Postives = 91/222 (40.99%), Query Frame = 1
Query:  475 NPD-ITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTL----ANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVT--DPPNNS 1119
             PD + + +GE  +LEC I  SR          +   W +K   E+    N K  F +N   L + K    EDSG Y CK V   GS   +  V V D +                PP FV  +  T  I     + + V L C++ G+ P+  +W   +        + L T      +L I  L     G+YTC+V+N AG  + +  L VT  +PP  S
Sbjct: 5695 KPDPVEVTAGESFELECLIAGSRP---------IRISW-LKNNREIRSVGNYKLFFYDNAARLTVLK-AGKEDSGTYVCKAVNEVGSDTCSAQVTVKDHAV---------------PPTFVRQLKETDGI-----LNAPVSLECKISGTMPISVSWYKDQEELFDSQKYKLTTSD-HTVNLEILELGIADGGNYTCKVNNVAGKDSCSAILRVTIAEPPGFS 5884          

HSP 2 Score: 56.9954 bits (136), Expect = 2.512e-8
Identity = 71/275 (25.82%), Postives = 108/275 (39.27%), Query Frame = 1
Query:  460 IVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVT-SEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH----LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKD---LIIKWLKRVDRLDPSNK 1260
            I+K   P   +  G+    EC I    E   VN+      +W  +G  EV ++ + KY     N I KL    T + ++G+Y CK     G      +++VI+                  PP FV  +       I+   G  V+L  EV G+ P+   W S         ++  IR  H    L I N+   + G Y C+  N+ G    +  L VTD P+ S K L  +       K  +   + +ECE  D   + + W K    + PS K
Sbjct: 4064 IIKRLEPQ-RVREGDPALFECQI---EEVPLVNF------QW-FRG--EVIIKTSNKYKISTENFISKLEIVDTQTAEAGEYTCKATNPAGFVSCTADLKVIE----------------MRPPSFVKKLE-----PIKSFSGKAVQLIAEVSGTHPIAIVW-SKDGDDISDGDSYAIRSEHNQCILAIGNVAVAHQGTYACKATNEFGSDTCSAQLSVTDKPSFS-KALQPV-------KAAVGTPLRLECEVDDDKGVTVAWTKSGKEIRPSRK 4295          

HSP 3 Score: 53.9138 bits (128), Expect = 1.810e-7
Identity = 67/288 (23.26%), Postives = 112/288 (38.89%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLS---------GKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNK------EHSYGLSLPNAMESEKGEY 1317
            G+  +LEC +  S        P  + +   +K + ++    N K +F +N   L + K +   DSG+Y CK V   GS          D+S    C  +T    +   P F    +      +  E G  VKL   V GSQP+  TW           G+ L+    N   +    +++ + K   +G Y C+  N+AG   F   L + +   ++P     + + T    + +S    +    + L I WLK    + P  K      E    L +    +++ GEY
Sbjct: 6829 GDPAELECHLTGS-------LPIKIFW---MKDKKDIRPGPNCKMTFFDNTPHLTIYK-LDKSDSGEYTCKAVNDIGS----------DNS----CTCETAIAERKVAPMFTKKPLEI----LDEEEGKGVKLDSRVSGSQPIAITWTKDDKDLHAHPGRELS--FKNNIAL----MSLKSTKVSDSGLYVCKAENEAGTATFKVTLNIKE-RKHAPNFDKKVQSLTVVEGDTLSASCRVSG-SEPLQIMWLKDRKEVQPFGKVSIAYSEGDCTLEISQVTKADAGEY 7079          

HSP 4 Score: 48.9062 bits (115), Expect = 6.809e-6
Identity = 53/209 (25.36%), Postives = 83/209 (39.71%), Query Frame = 1
Query:  571 LMYEWNIKGQTEVSVQMNTKYS--FIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSG-KTLANWILNTEGIRG--PHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISII 1182
            ++  W+  G   V +    KY   F EN   L++ K V   D G Y C           A NV   DS    L  +        EPP F+  +     ++     GS     C V G++P+   W  G + L   I ++   R     L +  +K  + G Y+CQV N AG  + +  L V +P     K  +  S+   ++ ++ S I
Sbjct: 6374 ILVAWSKNG---VEIVDGDKYRCLFEENTASLEILK-VDKSDDGSYTC----------TATNVAGRDSCSTTLSII--------EPPSFLMKMEPQEVLS-----GSRATFQCAVSGTEPLLVKWYKGNQELRTDISHSISFRDSVALLIVEKVKLAFAGEYSCQVSNSAGKTSCSASLFVKEP----AKFFSKPSDLDVKAGDSASFI 6551          

HSP 5 Score: 48.521 bits (114), Expect = 8.844e-6
Identity = 51/185 (27.57%), Postives = 76/185 (41.08%), Query Frame = 1
Query:  583 WNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSG----KTLANW-ILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTD---PPN 1113
            W +K   E+    N K+SF++N  +L + K     DSG Y C+     G           D+S    CA  T K+ +  P    D  + +  +T     G   +L C V GS P+K TW       +   N+ ++  E I    LTI  +    +G YTC   N  G    +  + V D   PP+
Sbjct: 6186 W-LKDNKEIRPGTNYKFSFVDNTPLLTILK-TDKRDSGVYVCRAANEAG----------YDTS----CAPVTIKERRVAPT--FDQKLESLNVT----TGERAELECHVTGSVPIKVTWAKDNREIRAAGNYRMIFMENI--ARLTILKVGKLDSGIYTCAASNDVGSDVTSTEITVKDQAVPPS 6346          

HSP 6 Score: 48.521 bits (114), Expect = 9.070e-6
Identity = 66/302 (21.85%), Postives = 121/302 (40.07%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSE--DSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL--------SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFK 1374
            G  L+LEC         +V+    +   W   G+    ++ + K SF   N+ L + + + SE  D+G Y C   +  GS   A +VEV                 K +P       +R  +  ++ E    V L C ++GS  +K TW          G+   +++ N        L I + +T  +  YTC+  N+ G ++ T  + V + P+        + +   R   ++++ VE++       +KW+K    L   +K   Y   L N   + +   +   D G  + +V+ N+ K
Sbjct: 4264 GTPLRLEC---------EVDDDKGVTVAWTKSGK---EIRPSRKLSFTFKNK-LAVLEILKSELADTGDYVCTASSEAGSESTASSVEV-----------------KADPAG-----LRALQPEVK-EAKGLVHLDCSLKGSPVIKVTWFKNDNEVKADGRVQLSFVNNV-----AVLEIRDSETEDSADYTCEAQNEVGTVSCTCAVSVKEIPS----FKKPLESMEVRGNSDVTLEVELDG-SPPFDVKWVKNARELPKIDK---YRAKLENTTATLRIGNFSAADVGQYSCKVKNNVGK 4516          
BLAST of Smed-NDK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001917.1 (pep scaffold:Pmarinus_7.0:GL476868:2429:11074:1 gene:ENSPMAG00000001743.1 transcript:ENSPMAT00000001917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 1.659e-7
Identity = 41/168 (24.40%), Postives = 74/168 (44.05%), Query Frame = 1
Query: 1000 LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELD 1500
            LT+ +L+   +G YTC+V N AG +N TY + V     + P +  T   N T       S+  ++  + +  +++WLKRV   +P ++ H       NA     G+ ++ +  G    R     F   L +       +G Y+    N +     + ++  F+TV+ D
Sbjct:   16 LTLKSLRAEDSGRYTCRVFNTAGEINATYRVDVVQRLRSKPVLTGTHPVNTTVEMGGTTSLQCKVRSDVRP-VVQWLKRV---EPGSERHH------NATLDVGGQRFVVLPAGDVWSRPD-GSFLNKLVIARARAEDAGMYICLGANTM----GYSFRSAFLTVQPD 168          
BLAST of Smed-NDK vs. Ensembl Sea Lamprey
Match: malt2 (MALT paracaspase 2 [Source:ZFIN;Acc:ZDB-GENE-020801-2])

HSP 1 Score: 48.521 bits (114), Expect = 6.420e-6
Identity = 22/61 (36.07%), Postives = 32/61 (52.46%), Query Frame = 1
Query:  880 GSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQ 1062
            G +V L C  RG+ P ++TW  GK             GP L + ++    +GHYTC+VHN+
Sbjct:  143 GESVTLECRARGNPPPRFTWFHGKH------EIPDAVGPELLLVSVSPRDSGHYTCRVHNE 197          
BLAST of Smed-NDK vs. Ensembl Nematostella
Match: EDO43171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN6])

HSP 1 Score: 59.3066 bits (142), Expect = 5.885e-9
Identity = 53/173 (30.64%), Postives = 75/173 (43.35%), Query Frame = 1
Query:  592 KGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKL----CAVKTPKDSKYEPPCFVD-PIMRTG--KITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTY 1086
            +G+      MN  +  I+N R+         +DSGKY C+    FG    +  + V   S   +      + TP      PP  V  P+ R     + IR E GS +KL C   GS   K  W  +GK L +   N   +RG  L I +L+   +G YTC V N+ G +  TY
Sbjct:   86 RGEKSRFRSMNGHHLRIKNARV---------KDSGKYLCQAHNSFGMINASITLIVHPGSNASVYNTAAHIITPSPP---PPVKVQAPVFRRNIKALRIRLEEGSQLKLRCHANGSPQPKIQWHHNGKKLRSRRRNHVILRGWVLNIRSLRQSDSGRYTCIVKNKHGTIRRTY 246          
BLAST of Smed-NDK vs. Ensembl Nematostella
Match: EDO43236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ71])

HSP 1 Score: 48.9062 bits (115), Expect = 8.667e-6
Identity = 42/143 (29.37%), Postives = 63/143 (44.06%), Query Frame = 1
Query:  820 PPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGP--HLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYT---FRSKENISIIVEIECECKDLIIKWLK 1230
            PP F       G   I      T+KL C+  G+ P+ +TWL +GK + +  L   G++    +L + +L    TG YTC V N  G +N TY L V   P + P +  ++   T         +  IV +     D   +WLK
Sbjct:    4 PPYFAQQQKMKGTF-IAWPAWHTIKLKCKAEGTPPLTFTWLKNGKPITHRRLQ-PGLKTNQWYLRLRDLVPADTGDYTCVVSNPYGQINHTYTLQVVTKPRSRPILQRNLPRNTSIELGGNATLDCIVVVSGTLPDF--RWLK 142          
BLAST of Smed-NDK vs. Ensembl Medaka
Match: fgfrl1a (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101165069])

HSP 1 Score: 84.3445 bits (207), Expect = 1.708e-16
Identity = 90/354 (25.42%), Postives = 148/354 (41.81%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKD--------SKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH------LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDII 1512
            G  +KL CP+       + + P  +M  W   G+      +++ ++  +  +     K V ++D+G Y CK   GFGS  V + + VID S  +  A   P D         K   P F +P     ++  R E GS+V+L C   G+      WL  K     +    G  G        L + NL   ++G YTCQV N+AG +N TY + V    N  P ILT     N T     + S   ++  + K  +I+WLK   RLDP + E+ +     N+      + ++ +  G    R   +    +L +       +G Y+    N +     + ++  F+TV  D+  +
Sbjct:   38 GRTVKLSCPV-------ESDPPPLIM--WTKDGR-----NIHSGWTRFKVLQAALRIKEVETDDAGTYICKATNGFGSVNVNYTLIVIDDSSSRNGAGPVPADGEDTLELAGKLVRPRFTEPAKMRKRVIARPE-GSSVRLKCTASGNPRPDIVWL--KDSRPLVDEDSGAGGEGRKKKWTLILKNLLPEHSGKYTCQVSNRAGEINATYKVEVIQRTNCKP-ILTGTHPVNTTVDYGGSTSFQCKVRSDVKP-VIQWLK---RLDPGD-ENKF-----NSTLEVGDDRFVVLPAGEVWSRPDGSYLNKLL-ITRAKEDDAGMYICLGANTM----GYNFRSAFLTVLPDRKTL 358          
BLAST of Smed-NDK vs. Ensembl Medaka
Match: FGFRL1 (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101156129])

HSP 1 Score: 83.5741 bits (205), Expect = 3.135e-16
Identity = 91/357 (25.49%), Postives = 149/357 (41.74%), Query Frame = 1
Query:  652 RILKL---TKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS-SQEKLCAVKTPKDS----KYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKD--------IIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSAS--RSSHRCP 1662
            RIL++    K V ++D+G Y CK   GFGS  + + + VID    +K    +  K      K+  P F  P  +  K  I R VGS+V+L C   G+      WL   + L    +     +   L++ NL   ++G YTC+V NQAG +N TY + V    N+ P +  T   N T       S   ++  + K  +I+WLKRV+     ++E+ Y     N+    +   +  +  G    R   +    +L +       +G Y+    N +     + ++  F+TV  D                   V I +P  I+     V+++ C  R       + +A   +SSHR P
Sbjct:   72 RILRMGLKIKEVEADDAGTYICKATNGFGSVNINYTLIVIDDPGSDKTGKPEGAKSELSIEKFVRPRFSQP-TKMRKRVIARPVGSSVRLKCAASGNPRPDIIWLKDDRPLTEQEVGEGRQKKWTLSLRNLMPQHSGRYTCRVSNQAGEINATYKVEVIQRTNSKPVLTGTHPVNTTVDYGGTTSFQCKVRSDVKP-VIQWLKRVE----PHEENRY-----NSTIEVEDHRFAVLPAGEVWSRPDGSYLNKLL-ITRAKEEDAGMYICLGANTM----GYSFRSAFLTVLPDTKPPITHVFPAASTTLPWPVIIGIPAGIVFIFGAVLLWFCQSRKHCPPPSAPAAQVLQSSHRPP 412          
BLAST of Smed-NDK vs. Ensembl Medaka
Match: FGFRL1 (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101156129])

HSP 1 Score: 82.4185 bits (202), Expect = 7.316e-16
Identity = 91/357 (25.49%), Postives = 152/357 (42.58%), Query Frame = 1
Query:  652 RILKL---TKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS-SQEKLCAVKTPKDS----KYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKD-----IIGVKANLV---VYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSAS--RSSHRCP 1662
            RIL++    K V ++D+G Y CK   GFGS  + + + VID    +K    +  K      K+  P F  P  +  K  I R VGS+V+L C   G+      WL   + L    +     +   L++ NL   ++G YTC+V NQAG +N TY + V    N+ P +  T   N T       S   ++  + K  +I+WLKRV+     ++E+ Y     N+    +   +  +  G    R   +    +L +       +G Y+    N +     + ++  F+TV  D       +    +  +   V I +P  I+     V+++ C  R       + +A   +SSHR P
Sbjct:  120 RILRMGLKIKEVEADDAGTYICKATNGFGSVNINYTLIVIDDPGSDKTGKPEGAKSELSIEKFVRPRFSQPT-KMRKRVIARPVGSSVRLKCAASGNPRPDIIWLKDDRPLTEQEVGEGRQKKWTLSLRNLMPQHSGRYTCRVSNQAGEINATYKVEVIQRTNSKPVLTGTHPVNTTVDYGGTTSFQCKVRSDVKP-VIQWLKRVE----PHEENRY-----NSTIEVEDHRFAVLPAGEVWSRPDGSYLNKLL-ITRAKEEDAGMYICLGANTM----GYSFRSAFLTVLPDTKPPITHVFPAASTTLPWPVIIGIPAGIVFIFGAVLLWFCQSRKHCPPPSAPAAQVLQSSHRPP 460          
BLAST of Smed-NDK vs. Ensembl Medaka
Match: FGFRL1 (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101156129])

HSP 1 Score: 82.4185 bits (202), Expect = 7.882e-16
Identity = 91/357 (25.49%), Postives = 152/357 (42.58%), Query Frame = 1
Query:  652 RILKL---TKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDS-SQEKLCAVKTPKDS----KYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWL-SGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKIL-TDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKD-----IIGVKANLV---VYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSAS--RSSHRCP 1662
            RIL++    K V ++D+G Y CK   GFGS  + + + VID    +K    +  K      K+  P F  P  +  K  I R VGS+V+L C   G+      WL   + L    +     +   L++ NL   ++G YTC+V NQAG +N TY + V    N+ P +  T   N T       S   ++  + K  +I+WLKRV+     ++E+ Y     N+    +   +  +  G    R   +    +L +       +G Y+    N +     + ++  F+TV  D       +    +  +   V I +P  I+     V+++ C  R       + +A   +SSHR P
Sbjct:   91 RILRMGLKIKEVEADDAGTYICKATNGFGSVNINYTLIVIDDPGSDKTGKPEGAKSELSIEKFVRPRFSQP-TKMRKRVIARPVGSSVRLKCAASGNPRPDIIWLKDDRPLTEQEVGEGRQKKWTLSLRNLMPQHSGRYTCRVSNQAGEINATYKVEVIQRTNSKPVLTGTHPVNTTVDYGGTTSFQCKVRSDVKP-VIQWLKRVE----PHEENRY-----NSTIEVEDHRFAVLPAGEVWSRPDGSYLNKLL-ITRAKEEDAGMYICLGANTM----GYSFRSAFLTVLPDTKPPITHVFPAASTTLPWPVIIGIPAGIVFIFGAVLLWFCQSRKHCPPPSAPAAQVLQSSHRPP 431          
BLAST of Smed-NDK vs. Ensembl Medaka
Match: fgfrl1a (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101165069])

HSP 1 Score: 75.485 bits (184), Expect = 1.015e-13
Identity = 86/346 (24.86%), Postives = 144/346 (41.62%), Query Frame = 1
Query:  499 GEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPH------LTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS--NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDII 1512
            G  +KL CP+       + + P  +M  W   G+      +++ ++  +  +     K V ++D+G Y CK   GFGS  V + + VI          K    S +  P F +P     ++  R E GS+V+L C   G+      WL  K     +    G  G        L + NL   ++G YTCQV N+AG +N TY + V    N  P ILT     N T     + S   ++  + K  +I+WLK   RLDP + E+ +     N+      + ++ +  G    R   +    +L +       +G Y+    N +     + ++  F+TV  D+  +
Sbjct:   39 GRTVKLSCPV-------ESDPPPLIM--WTKDGR-----NIHSGWTRFKVLQAALRIKEVETDDAGTYICKATNGFGSVNVNYTLIVIGR------CTKNYLKSIFVRPRFTEPAKMRKRVIARPE-GSSVRLKCTASGNPRPDIVWL--KDSRPLVDEDSGAGGEGRKKKWTLILKNLLPEHSGKYTCQVSNRAGEINATYKVEVIQRTNCKP-ILTGTHPVNTTVDYGGSTSFQCKVRSDVKP-VIQWLK---RLDPGD-ENKF-----NSTLEVGDDRFVVLPAGEVWSRPDGSYLNKLL-ITRAKEDDAGMYICLGANTM----GYNFRSAFLTVLPDRKTL 345          
BLAST of Smed-NDK vs. Planmine SMEST
Match: SMESG000062038.1 (SMESG000062038.1)

HSP 1 Score: 1051.97 bits (2719), Expect = 0.000e+0
Identity = 524/524 (100.00%), Postives = 524/524 (100.00%), Query Frame = 1
Query:  394 MWSFFISWMIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFXXXXXXXXXXXXVAVPVSHYQA 1965
            MWSFFISWMIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFNNGNPYHHNNGYVAVPVSHYQA
Sbjct:    1 MWSFFISWMIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFNNGNPYHHNNGYVAVPVSHYQA 524          
BLAST of Smed-NDK vs. Planmine SMEST
Match: SMESG000062038.1 (SMESG000062038.1)

HSP 1 Score: 1033.48 bits (2671), Expect = 0.000e+0
Identity = 516/516 (100.00%), Postives = 516/516 (100.00%), Query Frame = 1
Query:  418 MIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFXXXXXXXXXXXXVAVPVSHYQA 1965
            MIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFNNGNPYHHNNGYVAVPVSHYQA
Sbjct:    1 MIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTSGMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGAQFNNGNPYHHNNGYVAVPVSHYQA 516          
BLAST of Smed-NDK vs. Planmine SMEST
Match: SMESG000077310.1 (SMESG000077310.1)

HSP 1 Score: 226.868 bits (577), Expect = 5.679e-63
Identity = 150/426 (35.21%), Postives = 234/426 (54.93%), Query Frame = 1
Query:  451 TIPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKY-EPPCFVDPIMRTGK---ITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVD---RLDPSNKEHSYGLSLPNAMESEKGEYYLTIDT----GVTTVRV-QPN-LFKTVLNMESVGTHHSGKYV---VTAINKIVNLKSFEYKVVFITVELDKDI-IGVKAN----LVVYIAVPMVILASSLGVIIYCCFR------RHSSGYGRSTSASRS 1647
            ++P++ P+  +IT  +G  L+L CPI  S + TD   PSNLM+ W+IK   E  V  +++YSF +  R   +TK V   DSG Y C+GVTGFG++E  FNV +++ +    C+V    +++  + PCF+D  M+       TI + V S+V+  C+  G+    Y W +GK  A+W++  E +R P+  I  L   +TGHYTC+V+N  G ++FT+ L+V D P+  PK + ++ N T     +  +   I C+C    ++WL+RV    R   SNK     + LP+A  SE GE + T+D     G+ T  + QPN L  + L   SV   ++GKYV   V+ +NK  ++    YK V++ V  D+   +  KAN    ++VYI+VP+ +L   + V+ YC  R      RHS   G+S  + RS
Sbjct:   22 SVPVINPYEMNITKETGSNLELVCPI--SSQNTDGG-PSNLMFSWSIKDIHENLVAADSRYSFPDGGRRALVTK-VKPADSGVYKCRGVTGFGNQEAIFNVNILEHNS---CSVDESSENQVKQRPCFLDQHMKLSMNKVTTIHKNVNSSVEFRCDAGGNPKPSYKWFNGKASADWLM--EDVRRPYFRIKVLNKEHTGHYTCKVYNAIGEISFTFGLVVKDSPSPQPKFVDELHNKTVLIGSSAELSASIICKCTPF-VQWLRRVPLNYRQTNSNKHKKTFIYLPHAAASESGENFETLDQDPVEGIETENITQPNGLVISKLKFRSVKPWNAGKYVLLTVSMLNK-QDVHEMTYKTVYLNVISDRTTSMNNKANNPPKIIVYISVPLGVLILCVLVVFYCFIRRKNLSSRHSMIGGQSMKSKRS 436          
BLAST of Smed-NDK vs. Planmine SMEST
Match: SMESG000009032.1 (SMESG000009032.1)

HSP 1 Score: 213.772 bits (543), Expect = 1.037e-58
Identity = 133/398 (33.42%), Postives = 222/398 (55.78%), Query Frame = 1
Query:  454 IPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYE-PPCFVDPIMRTGKIT---IRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRV-------QPNLFKTVLNMESVGTHHSGKYVV--TAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRH 1608
            IPI+  ++ ++++  G  LK+ CP+ ++ +  +          W + G  E  + M+ +Y F  NN++L++ K + SED+G Y CKGVTG+G RE +F ++V+D   EK C + T   +K +  PCF++ +M+  ++T   + ++VGS+V+ +C   G+   +Y W+ GK+ A+WI N   IR P L I N+K  Y G YTC+V+NQ G +++TY LIV +     PKI+  ++N T +  +    +  I C+C+  +I+W K+V  L    K     + LPNA + EK EY++ ++T  T  R+             ++L  +SV    SGKYV+  T  N  +N     YK V++ ++   D+   +  L+++IA+P+ IL    GVI YC  R H
Sbjct:   26 IPILHDYSSNVSVQIGSTLKINCPMSINSKENE-----GFFISWTVNGVDENMLSMDLRYEFKNNNQVLEV-KSIKSEDAGTYTCKGVTGYGVREASFYIKVLD---EKFCHIPTASITKQKYKPCFLNSLMQ-NELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFFVGTISCDCQP-VIQWFKKVTDLSKFTK----AIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMN-----YKTVYLDIQDSSDLKKNQPRLIIFIAIPIFILILCFGVIFYCWSRNH 403          
BLAST of Smed-NDK vs. Planmine SMEST
Match: SMESG000027359.1 (SMESG000027359.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.928e-10
Identity = 81/331 (24.47%), Postives = 129/331 (38.97%), Query Frame = 1
Query:  673 PVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQE---KLC--AVKTPKDSKYEPPCFVDPIMRTGKITIRREVGSTVKLSCEVRGSQPMKYTW--LSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAG---GLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLI-----IKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINKIVNLKSFEYKVVFITVELDKDIIGVKAN---LVVYIAVPMVILASSLGVIIYCCFRRHS 1611
            P T + SG Y CK  TGF + +    V++IDS  E   K C  +V  P     +  CF +   R      + ++G  V L C   G + +KY W  +    + N I     I    +     +    G Y C+V N  G      FT  L  T P  N   I     +       NI   V + CE K        IKW KR+    P +      L  PN +  ++  Y L  +T +    +  N  ++   +       SG Y   A++         +K+  I+   +   + V+      ++YI +P+V++ + +  IIYC  +  S
Sbjct:   80 PATVDKSGVYECKSTTGFTNTDTNVTVKIIDSQSEIVTKSCSNSVSPPIRDVSKGICFFNEEKR----KFQPKIGDHVTLDCTAVG-ENLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENE--GVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLV----TNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDS------LVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDAT---GGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSS 390          
The following BLAST results are available for this feature:
BLAST of Smed-NDK vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGFRL16.249e-1525.87fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL16.249e-1525.87fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL16.249e-1525.87fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL16.249e-1525.87fibroblast growth factor receptor like 1 [Source:H... [more]
HMCN11.347e-725.81hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
back to top
BLAST of Smed-NDK vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igcm-43.383e-1425.00ImmunoGlobulin-like Cell adhesion Molecule family ... [more]
pxn-11.389e-623.70Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
him-43.628e-623.91High Incidence of Males (Increased X chromosome lo... [more]
him-43.722e-623.91High Incidence of Males (Increased X chromosome lo... [more]
him-44.154e-624.64High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of Smed-NDK vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dscam37.026e-623.25gene:FBgn0261046 transcript:FBtr0113398[more]
Dscam37.414e-623.25gene:FBgn0261046 transcript:FBtr0113397[more]
Dscam37.697e-623.25gene:FBgn0261046 transcript:FBtr0330212[more]
Dscam37.832e-623.25gene:FBgn0261046 transcript:FBtr0330211[more]
back to top
BLAST of Smed-NDK vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfrl1b5.882e-2025.77fibroblast growth factor receptor like 1b [Source:... [more]
fgfrl1b6.592e-1925.77fibroblast growth factor receptor like 1b [Source:... [more]
fgfrl1b6.592e-1925.77fibroblast growth factor receptor like 1b [Source:... [more]
fgfrl1a4.632e-1825.53fibroblast growth factor receptor like 1a [Source:... [more]
ttn.21.185e-1025.31titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Smed-NDK vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcca9.797e-2025.41propionyl-CoA carboxylase subunit alpha [Source:Xe... [more]
pcca1.131e-1925.41propionyl-CoA carboxylase subunit alpha [Source:Xe... [more]
fgfr43.206e-825.25fibroblast growth factor receptor 4 [Source:NCBI g... [more]
eftud24.068e-823.53elongation factor Tu GTP binding domain containing... [more]
fgfr44.953e-828.50fibroblast growth factor receptor 4 [Source:NCBI g... [more]
back to top
BLAST of Smed-NDK vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fgfrl12.580e-1525.36fibroblast growth factor receptor-like 1 [Source:M... [more]
Fgfrl12.636e-924.89fibroblast growth factor receptor-like 1 [Source:M... [more]
Ttn9.301e-826.07titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.735e-726.07titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn2.132e-726.07titin [Source:MGI Symbol;Acc:MGI:98864][more]
back to top
BLAST of Smed-NDK vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T2H2|FGRL1_CHICK1.737e-1527.59Fibroblast growth factor receptor-like 1 OS=Gallus... [more]
sp|Q91V87|FGRL1_MOUSE1.805e-1425.36Fibroblast growth factor receptor-like 1 OS=Mus mu... [more]
sp|Q8N441|FGRL1_HUMAN3.001e-1425.87Fibroblast growth factor receptor-like 1 OS=Homo s... [more]
sp|Q7TQM3|FGRL1_RAT3.355e-1425.36Fibroblast growth factor receptor-like 1 OS=Rattus... [more]
sp|Q96RW7|HMCN1_HUMAN6.467e-725.81Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
back to top
BLAST of Smed-NDK vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D4P9370.000e+099.80Smed-NDK (Fragment) OS=Schmidtea mediterranea OX=7... [more]
Q8I0V70.000e+083.59NOU-DARAKE OS=Dugesia japonica OX=6161 GN=nou-dara... [more]
T1E1E10.000e+061.08NDK OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A4E0S3K63.490e-7734.47Fibroblast growth factor receptor 1 OS=Fasciola he... [more]
A0A504YYA18.655e-7733.05Fibroblast growth factor receptor 1 OS=Fasciola gi... [more]
back to top
BLAST of Smed-NDK vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfrl1b2.825e-1923.81fibroblast growth factor receptor like 1b [Source:... [more]
fgfrl1b3.151e-1923.74fibroblast growth factor receptor like 1b [Source:... [more]
fgfrl1a6.497e-1025.85fibroblast growth factor receptor like 1a [Source:... [more]
ENSAMXT00000037416.16.158e-724.38pep primary_assembly:Astyanax_mexicanus-2.0:19:235... [more]
ENSAMXT00000055272.19.706e-726.96neural cell adhesion molecule L1-like protein [Sou... [more]
back to top
BLAST of Smed-NDK vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000006750.12.881e-1323.13pep scaffold:Pmarinus_7.0:GL477426:19036:34193:1 g... [more]
ENSPMAT00000002502.15.833e-928.38pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-... [more]
ENSPMAT00000001917.11.659e-724.40pep scaffold:Pmarinus_7.0:GL476868:2429:11074:1 ge... [more]
malt26.420e-636.07MALT paracaspase 2 [Source:ZFIN;Acc:ZDB-GENE-02080... [more]
back to top
BLAST of Smed-NDK vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-NDK vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO431715.885e-930.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432368.667e-629.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Smed-NDK vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfrl1a1.708e-1625.42fibroblast growth factor receptor-like 1 [Source:N... [more]
FGFRL13.135e-1625.49fibroblast growth factor receptor-like 1 [Source:N... [more]
FGFRL17.316e-1625.49fibroblast growth factor receptor-like 1 [Source:N... [more]
FGFRL17.882e-1625.49fibroblast growth factor receptor-like 1 [Source:N... [more]
fgfrl1a1.015e-1324.86fibroblast growth factor receptor-like 1 [Source:N... [more]
back to top
BLAST of Smed-NDK vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062038.10.000e+0100.00SMESG000062038.1[more]
SMESG000062038.10.000e+0100.00SMESG000062038.1[more]
SMESG000077310.15.679e-6335.21SMESG000077310.1[more]
SMESG000009032.11.037e-5833.42SMESG000009032.1[more]
SMESG000027359.12.928e-1024.47SMESG000027359.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029487
GenBankADD84674.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029487 ID=SMED30029487|Name=Smed-NDK|organism=Schmidtea mediterranea sexual|type=transcript|length=2717bp
TTTCTATGTAATATAGGGAAAAAAAAAAATCTAAATGACAAGAATGCAGT
TTGTGTATTACTTTTAATGCAGCATATTTATTATGTTGCATTTACAGAGG
AAGAAGTCTCAATTAAGTATAATCCAATCTGATGTTGTCTAGCTTTGTGA
TTTGATTGGTCAATTAGGTGAAAATTATTTTCAAAAGCGCGTTTTGCTTC
CATCAAATTATTATTCTAATTACCAGTAAGAATTAATATTTGAATTTCAA
ATTCGTATTCGCATTTCAATAATATTAAAAAAAAACAACAGCAAAATTTT
CTCTGATACCAAAAATCAATTAAAAATAAATCAAATCAATTTCTCGAAGA
TTTTCAATTTGGATTTTAATATTATCACTAACAAAAAAAAGTTATGTGGA
GCTTCTTTATTTCCTGGATGATATTCAGCTACATCAAATCTATACATTGC
ACAATACCGATTGTCAAACCCTTCAATCCTGACATTACGTTAAATAGCGG
TGAAGAATTGAAGTTGGAGTGTCCGATTGTGATGTCAAGAGAAGGAACCG
ACGTGAATTATCCATCCAATCTCATGTATGAATGGAACATAAAGGGTCAA
ACCGAAGTCTCAGTTCAAATGAATACGAAATATTCTTTCATTGAAAATAA
TCGGATTTTGAAATTAACGAAGCCCGTCACGAGTGAAGACAGTGGGAAAT
ATTTTTGCAAAGGGGTCACTGGATTCGGCTCAAGAGAAGTGGCCTTCAAT
GTCGAAGTCATTGATTCATCTCAAGAGAAATTGTGTGCTGTGAAAACTCC
GAAAGATTCTAAATATGAACCTCCGTGTTTCGTTGATCCAATAATGAGAA
CTGGTAAAATAACAATTCGTAGAGAAGTAGGATCAACAGTAAAATTGTCG
TGTGAAGTTAGAGGTAGCCAACCAATGAAGTATACTTGGTTGAGTGGAAA
GACATTGGCGAATTGGATTCTTAACACGGAGGGTATCAGAGGTCCTCATT
TAACAATACCGAATTTGAAAACTCACTATACTGGTCATTATACATGTCAA
GTGCATAATCAAGCTGGCGGATTGAACTTTACGTATCATTTAATAGTCAC
AGATCCACCAAATAACTCACCAAAAATCTTGACAGACATTTCAAATTATA
CTTTTCGTTCAAAAGAAAATATTTCAATCATTGTGGAAATAGAATGCGAA
TGCAAAGATTTAATAATAAAATGGTTGAAAAGGGTTGACAGATTAGATCC
GTCAAATAAAGAGCATTCTTATGGACTGAGTTTACCGAATGCGATGGAAA
GTGAAAAGGGAGAATATTACCTCACAATAGATACCGGTGTCACAACAGTA
CGAGTTCAGCCTAACCTGTTTAAAACTGTGCTCAATATGGAATCTGTGGG
AACTCATCACAGTGGGAAATACGTTGTCACAGCTATAAACAAAATTGTCA
ATCTTAAAAGCTTTGAATATAAAGTTGTATTTATAACTGTAGAATTAGAT
AAAGATATAATTGGAGTTAAGGCCAATTTAGTAGTTTATATCGCTGTTCC
CATGGTGATTCTTGCATCTAGTCTTGGAGTAATTATTTATTGTTGTTTTC
GGCGTCATTCGTCAGGATATGGACGAAGTACATCAGCAAGTCGTTCATCA
CATAGATGTCCTAACGGTTCAGCATTACCCAGTTTAACAAACGGTTCAAA
TACAGGCTCAGAGAAACTGAAATCTCCCTCAACAACGACATCGGGAATGG
TTGTCGGCTACAATTCATACAAATATGTATATCCATCTCAAGCTCCATCG
TCAAATTACGACCAGTATTCTGTTCTTAGTGTTTCACATTCATCACAAAC
TCCACCACAATACTTTCAACCACAGAACGCTGTTGCCGGAGCACAATTTA
ACAATGGTAACCCTTATCATCACAATAATGGGTATGTCGCTGTACCAGTT
AGCCATTATCAAGCCTAATGACAATTTTTCAATTCATATTTTTTATGGTC
AGCCTACTTTTCAATGATCTCAAATTGTTAATTTATTGAAATATAAATCG
AACCCGACCTGCTGAAAGGGTTTTTTTTAGATATTTTGTACATATTCTCT
ACTGATTGAAATGAGCTGGTTTAATTTCAAATGGAAAAAAACTTGTTATA
CATATCATTGTCGATCTAATTTTCATCGCATATAATCTTTTTGGATTTTG
TCATCATTATCAAATTCGGAAAATTTTCGCAATGACGCAATCTCTCTCAA
TTATTGGAAAACAAAACATGTTAAGTTCATTAAAAAGATTTAACTTTTTT
TTCCAATTAAAACAAACAAACAATTTCTACCATTTATCGCGGTTACCTAT
GATTTTTTATTATAATATGCATTTTATCAATTAAAACAAAAATGATTATT
GTGTATGATGATGTGAATATTAGTGATTTTTATGCGTTGCAGTTTGTCAG
CTTTAAAATTTATGAGATTTAACATATTTGTCAGCTTTTATTTCAATTTG
TCATGTTGAAAAAATCAGAGTCGAAAATTGTATTTTTTTGACAGGCCAAA
CAGGGTGAATGATTTTGTTGATAGAAAAATTGGAGTTGATATATTATTTT
TACAATGTTTTGAGCTCACTTAACAGGGTATATTGTTTATAATCGAAATT
GTCATTATGCTACATACAGGATTTTTTTTTGTTTTTATTGTAATTATTTA
TAGTTTATAGATAAACC
back to top

protein sequence of SMED30029487-orf-1

>SMED30029487-orf-1 ID=SMED30029487-orf-1|Name=SMED30029487-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=525bp
MWSFFISWMIFSYIKSIHCTIPIVKPFNPDITLNSGEELKLECPIVMSRE
GTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDS
GKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYEPPCFVDPI
MRTGKITIRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRG
PHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDIS
NYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNA
MESEKGEYYLTIDTGVTTVRVQPNLFKTVLNMESVGTHHSGKYVVTAINK
IVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYC
CFRRHSSGYGRSTSASRSSHRCPNGSALPSLTNGSNTGSEKLKSPSTTTS
GMVVGYNSYKYVYPSQAPSSNYDQYSVLSVSHSSQTPPQYFQPQNAVAGA
QFNNGNPYHHNNGYVAVPVSHYQA*
back to top
Aliases
The feature 'Smed-NDK' has the following synonyms
Synonym
NDK
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0003109anterior pole cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR007110Ig-like_dom
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR013098Ig_I-set
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 161..225
e-value: 5.1E-5
score: 32.7
coord: 34..112
e-value: 1.6
score: 5.3
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 249..322
e-value: 14.0
score: 10.2
coord: 155..236
e-value: 1.4E-8
score: 44.5
coord: 28..123
e-value: 0.0033
score: 26.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 27..125
e-value: 6.0E-9
score: 37.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 139..242
e-value: 6.1E-13
score: 50.8
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 159..235
e-value: 1.4E-8
score: 34.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 412..446
NoneNo IPR availablePANTHERPTHR19890:SF14FGF RECEPTOR-LIKE PROTEIN 1Acoord: 89..425
NoneNo IPR availablePANTHERPTHR19890FIBROBLAST GROWTH FACTOR RECEPTORcoord: 89..425
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.668
NoneNo IPR availableTMHMMTMhelixcoord: 380..402
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 22..105
score: 10.39
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 149..236
score: 9.319
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 23..124
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 156..240