RILP-like protein 1

Overview
NameRILP-like protein 1
Smed IDSMED30029482
Length (bp)1215
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RILP-like protein 1 (SMED30029482) t-SNE clustered cells

Violin plots show distribution of expression levels for RILP-like protein 1 (SMED30029482) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RILP-like protein 1 (SMED30029482) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RILP-like protein 1 (SMED30029482) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029482

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30029482h1SMcG0010483 dd_Smed_v4_13765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029482h1SMcG0010483 dd_Smed_v4_13765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029482h1SMcG0010483 dd_Smed_v6_13765_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RILP-like protein 1 vs. Ensembl Human
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:HGNC Symbol;Acc:HGNC:26814])

HSP 1 Score: 66.6254 bits (161), Expect = 1.980e-11
Identity = 91/351 (25.93%), Postives = 164/351 (46.72%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE----RH---SQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSI----------------QHSNDDVFIDECLKTDKISQSNVPDI-------------NFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDE--VQGPINKEPVDKMSPSYCQQSGIRKYSSTA 1026
            VY+IA  + ++ + + +     AI  L+ K+V VLE LE    RH    +L E++ +        + RIE E          ++K+LE +E+ W  E+ +L+  + +LQEEN  + T L  ++K   F+ + F +   +    + V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA +   ++ +                +HS +    +E  +T+ + + ++ D               F+ +E+++ L +   LKS+V   +  L  Y+   +EE+    Q P    P+     S   +SGI++   TA
Sbjct:   27 VYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKER--------KHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNL--SHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNG---EEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPP----PIAHPRTSPQPESGIKRLIFTA 360          
BLAST of RILP-like protein 1 vs. Ensembl Human
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:HGNC Symbol;Acc:HGNC:26814])

HSP 1 Score: 66.6254 bits (161), Expect = 2.461e-11
Identity = 92/361 (25.48%), Postives = 171/361 (47.37%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE----RH---SQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSI----------------QHSNDDVFIDECLKTDKISQSNVPDI-------------NFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDE--VQGPINKEPVDKMSPSYCQQSGIRK-YSSTAKFKKQWSDA 1053
            VY+IA  + ++ + + +     AI  L+ K+V VLE LE    RH    +L E++ +        + RIE E          ++K+LE +E+ W  E+ +L+  + +LQEEN  + T L  ++K   F+ + F +   +    + V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA +   ++ +                +HS +    +E  +T+ + + ++ D               F+ +E+++ L +   LKS+V   +  L  Y+   +EE+    Q P    P+     S   +SGI++ +S  ++ KK+ ++ 
Sbjct:   27 VYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERK--------HQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNL--SHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNG---EEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPP----PIAHPRTSPQPESGIKRLFSFFSRDKKRLANT 370          
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Match: rilp-1 (RILP (Rab7-Interacting Lysosomal Protein) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFB9])

HSP 1 Score: 67.3958 bits (163), Expect = 4.314e-12
Identity = 82/365 (22.47%), Postives = 168/365 (46.03%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQ--LKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNI-------NAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVF-----IDECLKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSV-----------------------------IEEDE--VQGPINKEPVDKMSPSYCQQ--SGIRKYSSTAKFKKQWSDA 1053
            VY++A  + ND + L ++     +  ++ K+++ LE LE  +   + + +EI  L  A++R+E E   + Q+ L +E++LE++E+++  +  +L + ++ L  EN ++ T +      P       S  +   +++  L+LKE   +Q +EIK L+K       D D  Q Q  NL N        N E+   + + +   + ++EEK+ +  ++    +  + SN ++       D   K  +++  +  +  F+  E++E +++   LK  V+E E  L  ++                                ++ D+  V GP+ KEP +K+ P   ++  SG+RK+      ++ WSD 
Sbjct:   11 VYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSL---PNHADSPVSTSMREADLKMLLELKEMSSQQKDEIKALQK-------DVDTYQCQVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRL----EKTEESNIELKKLVKETDRACKDMQLANQDNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRNPLQPDTSSAQSLGVDGDDLPVYGPMPKEPDEKLHPWKYERKDSGVRKFIQFPLLQRLWSDG 361          
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Match: rilp-1 (RILP (Rab7-Interacting Lysosomal Protein) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFB9])

HSP 1 Score: 67.0106 bits (162), Expect = 6.962e-12
Identity = 82/365 (22.47%), Postives = 168/365 (46.03%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQ--LKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNI-------NAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVF-----IDECLKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSV-----------------------------IEEDE--VQGPINKEPVDKMSPSYCQQ--SGIRKYSSTAKFKKQWSDA 1053
            VY++A  + ND + L ++     +  ++ K+++ LE LE  +   + + +EI  L  A++R+E E   + Q+ L +E++LE++E+++  +  +L + ++ L  EN ++ T +      P       S  +   +++  L+LKE   +Q +EIK L+K       D D  Q Q  NL N        N E+   + + +   + ++EEK+ +  ++    +  + SN ++       D   K  +++  +  +  F+  E++E +++   LK  V+E E  L  ++                                ++ D+  V GP+ KEP +K+ P   ++  SG+RK+      ++ WSD 
Sbjct:   20 VYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSL---PNHADSPVSTSMREADLKMLLELKEMSSQQKDEIKALQK-------DVDTYQCQVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRL----EKTEESNIELKKLVKETDRACKDMQLANQDNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRNPLQPDTSSAQSLGVDGDDLPVYGPMPKEPDEKLHPWKYERKDSGVRKFIQFPLLQRLWSDG 370          
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Match: rilp-1 (RILP (Rab7-Interacting Lysosomal Protein) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFB9])

HSP 1 Score: 67.0106 bits (162), Expect = 6.962e-12
Identity = 82/365 (22.47%), Postives = 168/365 (46.03%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQ--LKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNI-------NAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVF-----IDECLKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSV-----------------------------IEEDE--VQGPINKEPVDKMSPSYCQQ--SGIRKYSSTAKFKKQWSDA 1053
            VY++A  + ND + L ++     +  ++ K+++ LE LE  +   + + +EI  L  A++R+E E   + Q+ L +E++LE++E+++  +  +L + ++ L  EN ++ T +      P       S  +   +++  L+LKE   +Q +EIK L+K       D D  Q Q  NL N        N E+   + + +   + ++EEK+ +  ++    +  + SN ++       D   K  +++  +  +  F+  E++E +++   LK  V+E E  L  ++                                ++ D+  V GP+ KEP +K+ P   ++  SG+RK+      ++ WSD 
Sbjct:   20 VYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSL---PNHADSPVSTSMREADLKMLLELKEMSSQQKDEIKALQK-------DVDTYQCQVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRL----EKTEESNIELKKLVKETDRACKDMQLANQDNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRNPLQPDTSSAQSLGVDGDDLPVYGPMPKEPDEKLHPWKYERKDSGVRKFIQFPLLQRLWSDG 370          
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Match: rilp-1 (RILP (Rab7-Interacting Lysosomal Protein) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFB9])

HSP 1 Score: 67.0106 bits (162), Expect = 6.962e-12
Identity = 82/365 (22.47%), Postives = 168/365 (46.03%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQ--LKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNI-------NAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVF-----IDECLKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSV-----------------------------IEEDE--VQGPINKEPVDKMSPSYCQQ--SGIRKYSSTAKFKKQWSDA 1053
            VY++A  + ND + L ++     +  ++ K+++ LE LE  +   + + +EI  L  A++R+E E   + Q+ L +E++LE++E+++  +  +L + ++ L  EN ++ T +      P       S  +   +++  L+LKE   +Q +EIK L+K       D D  Q Q  NL N        N E+   + + +   + ++EEK+ +  ++    +  + SN ++       D   K  +++  +  +  F+  E++E +++   LK  V+E E  L  ++                                ++ D+  V GP+ KEP +K+ P   ++  SG+RK+      ++ WSD 
Sbjct:   20 VYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSL---PNHADSPVSTSMREADLKMLLELKEMSSQQKDEIKALQK-------DVDTYQCQVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRL----EKTEESNIELKKLVKETDRACKDMQLANQDNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRNPLQPDTSSAQSLGVDGDDLPVYGPMPKEPDEKLHPWKYERKDSGVRKFIQFPLLQRLWSDG 370          
BLAST of RILP-like protein 1 vs. Ensembl Fly
Match: Rilpl (gene:FBgn0024985 transcript:FBtr0332292)

HSP 1 Score: 55.4546 bits (132), Expect = 5.616e-8
Identity = 53/221 (23.98%), Postives = 105/221 (47.51%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDM----KTLLEQANKKPKFNSKRFSQQLEIQNVQL-----------KLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI 717
            VY++A ++  + + + +     A++ L+ KI+N LE LE  +   E +   I  L+  + ++E E + K + R  ++K+LE +EE W +E+ EL+  +  LQ+EN  +    + L   + +     +      + + N +L           +LKE I KQ +E+K  ++E+  +  + + +  Q   L     +    H   +   K L EE+ +  AQ+
Sbjct:   25 VYDLASDIGKEYERIMDRFGTDAVSGLMPKIINTLELLEALATKNERENATIQELRDKVAQLESEKLEKAEFRRRFDKELELIEEQWRSETNELVDLVSSLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQVLQRLKEQIYKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERADFLAQL 245          
BLAST of RILP-like protein 1 vs. Ensembl Fly
Match: Rilpl (gene:FBgn0024985 transcript:FBtr0332291)

HSP 1 Score: 55.0694 bits (131), Expect = 5.988e-8
Identity = 53/221 (23.98%), Postives = 105/221 (47.51%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDM----KTLLEQANKKPKFNSKRFSQQLEIQNVQL-----------KLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI 717
            VY++A ++  + + + +     A++ L+ KI+N LE LE  +   E +   I  L+  + ++E E + K + R  ++K+LE +EE W +E+ EL+  +  LQ+EN  +    + L   + +     +      + + N +L           +LKE I KQ +E+K  ++E+  +  + + +  Q   L     +    H   +   K L EE+ +  AQ+
Sbjct:   25 VYDLASDIGKEYERIMDRFGTDAVSGLMPKIINTLELLEALATKNERENATIQELRDKVAQLESEKLEKAEFRRRFDKELELIEEQWRSETNELVDLVSSLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQVLQRLKEQIYKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERADFLAQL 245          
BLAST of RILP-like protein 1 vs. Ensembl Fly
Match: Rilpl (gene:FBgn0024985 transcript:FBtr0070225)

HSP 1 Score: 55.0694 bits (131), Expect = 6.960e-8
Identity = 53/221 (23.98%), Postives = 105/221 (47.51%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDM----KTLLEQANKKPKFNSKRFSQQLEIQNVQL-----------KLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI 717
            VY++A ++  + + + +     A++ L+ KI+N LE LE  +   E +   I  L+  + ++E E + K + R  ++K+LE +EE W +E+ EL+  +  LQ+EN  +    + L   + +     +      + + N +L           +LKE I KQ +E+K  ++E+  +  + + +  Q   L     +    H   +   K L EE+ +  AQ+
Sbjct:   25 VYDLASDIGKEYERIMDRFGTDAVSGLMPKIINTLELLEALATKNERENATIQELRDKVAQLESEKLEKAEFRRRFDKELELIEEQWRSETNELVDLVSSLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQVLQRLKEQIYKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERADFLAQL 245          
BLAST of RILP-like protein 1 vs. Ensembl Zebrafish
Match: rilp (Rab interacting lysosomal protein [Source:ZFIN;Acc:ZDB-GENE-100408-4])

HSP 1 Score: 56.6102 bits (135), Expect = 2.529e-8
Identity = 65/226 (28.76%), Postives = 110/226 (48.67%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQ-------EENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMS--KRLIEEKVNIEAQILINKKSIQHSN 750
            VYEIA  +  +++ L +S  K ++  L+ +IV VLE LE  +   +  + + + L  A + ++ +   K   +   E         WH    +L   +E LQ       EEN ++ T ++  +      SK    Q + + V LKLKE +DKQ +E++   +EI+    + +A+Q+Q   L  INAE+   H  N I +  K  +E K ++EA +   +K IQ  N
Sbjct:   35 VYEIAKVVGAEVEKLIDSYGKSSVEGLVSRIVKVLELLESFAARNQSHKCKEEELLKAFETLQLQQQKKRHVKECEESSSSAESRDWHQTEKKLKNNLEVLQSQVHQLKEENQELLTRIQCTH------SKEDRTQRQEREVMLKLKEVVDKQRDELRAKVQEISSMSKEVEALQEQQERLMKINAEL--RHKQNIIHTQMKSAVERKADLEADLCEKQKEIQRLN 252          
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Match: tnip3 (TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:XB-GENE-1008480])

HSP 1 Score: 67.0106 bits (162), Expect = 1.521e-11
Identity = 95/346 (27.46%), Postives = 159/346 (45.95%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELER-------HSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQAN---KKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEA------------QILINK-----KSIQHSNDDVFIDEC------LKTDKIS----QSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKYSSTA 1026
            VY+IA  +  + + + +      I  L+ K+V VLE LE        + ++ E++ +        + RIE E          ++K+LE +E+ W  E+ +L+  + +LQEEN  + + L Q +    + +F       + E Q V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA            ++ I K     K  QH+N +    E       L+T+K+S     SN P   F+ +E+++ L +   LK++V   +  L  Y+    E DE        PV        Q+SGI++   TA
Sbjct:   19 VYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINPEMEELRLELDRLRLERMDRIEKEKK--------HQKELELVEDVWRGEAQDLLNQIAQLQEENKQLVSNLSQKDINLTEEEFQKHEGMSERERQ-VMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEIGKLRDKLKGEQHTNGEEIKTETLNEESILETEKLSLDLKDSNRP--RFTLQELRDVLHERNELKAKVFMLQEELAYYKSE--EADEEHKLPQSSPVIDSKAPIPQESGIKRLIFTA 351          
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Match: tnip3 (TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:XB-GENE-1008480])

HSP 1 Score: 66.6254 bits (161), Expect = 1.869e-11
Identity = 94/344 (27.33%), Postives = 163/344 (47.38%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELER-------HSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQAN---KKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEA------------QILINK-----KSIQHSNDDVFIDEC------LKTDKIS----QSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKYSS 1020
            VY+IA  +  + + + +      I  L+ K+V VLE LE        + ++ E++ +        + RIE E          ++K+LE +E+ W  E+ +L+  + +LQEEN  + + L Q +    + +F       + E Q V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA            ++ I K     K  QH+N +    E       L+T+K+S     SN P   F+ +E+++ L +   LK++V   +  L  Y+    +E E + P +   +D  +P   Q+SGI++  S
Sbjct:   19 VYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINPEMEELRLELDRLRLERMDRIEKEKK--------HQKELELVEDVWRGEAQDLLNQIAQLQEENKQLVSNLSQKDINLTEEEFQKHEGMSERERQ-VMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEIGKLRDKLKGEQHTNGEEIKTETLNEESILETEKLSLDLKDSNRP--RFTLQELRDVLHERNELKAKVFMLQEELAYYKSEEADE-EHKLPQSSPVIDSKAP-IPQESGIKRLFS 349          
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Match: tnip3 (TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:XB-GENE-1008480])

HSP 1 Score: 62.7734 bits (151), Expect = 3.601e-10
Identity = 92/338 (27.22%), Postives = 159/338 (47.04%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELER-------HSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQAN---KKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEA------------QILINK-----KSIQHSNDDVFIDEC------LKTDKIS----QSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSG 1002
            VY+IA  +  + + + +      I  L+ K+V VLE LE        + ++ E++ +        + RIE E          ++K+LE +E+ W  E+ +L+  + +LQEEN  + + L Q +    + +F       + E Q V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA            ++ I K     K  QH+N +    E       L+T+K+S     SN P   F+ +E+++ L +   LK++V   +  L  Y+    +E E + P +   +D  +P   Q+SG
Sbjct:   19 VYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINPEMEELRLELDRLRLERMDRIEKEKK--------HQKELELVEDVWRGEAQDLLNQIAQLQEENKQLVSNLSQKDINLTEEEFQKHEGMSERERQ-VMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEIGKLRDKLKGEQHTNGEEIKTETLNEESILETEKLSLDLKDSNRP--RFTLQELRDVLHERNELKAKVFMLQEELAYYKSEEADE-EHKLPQSSPVIDSKAP-IPQESG 343          
BLAST of RILP-like protein 1 vs. Ensembl Mouse
Match: Rilpl1 (Rab interacting lysosomal protein-like 1 [Source:MGI Symbol;Acc:MGI:1922945])

HSP 1 Score: 72.7886 bits (177), Expect = 1.414e-13
Identity = 63/214 (29.44%), Postives = 116/214 (54.21%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE----RHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI 717
            VY+IA  + ++ + + +     +I  L+ K+V VLE LE    RH         E+D L++ + R+  E +++ ++   ++K+LE +E+ W  E+ +L+  + +LQEEN  + T L   +K   F+ + F +Q  +    + V  +LKE +DKQ +E++   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA +
Sbjct:   27 VYDIASLVGHEFERVIDQHGCESIARLMPKVVRVLEILEVLVSRHHVA-----PELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLN--HKDVGFSEEEFQKQEGMSERERQVMKRLKEVVDKQRDELRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADL 233          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9JJC6|RIPL1_MOUSE (RILP-like protein 1 OS=Mus musculus OX=10090 GN=Rilpl1 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 9.892e-13
Identity = 63/214 (29.44%), Postives = 116/214 (54.21%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE----RHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI 717
            VY+IA  + ++ + + +     +I  L+ K+V VLE LE    RH         E+D L++ + R+  E +++ ++   ++K+LE +E+ W  E+ +L+  + +LQEEN  + T L   +K   F+ + F +Q  +    + V  +LKE +DKQ +E++   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA +
Sbjct:   27 VYDIASLVGHEFERVIDQHGCESIARLMPKVVRVLEILEVLVSRHHVA-----PELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLN--HKDVGFSEEEFQKQEGMSERERQVMKRLKEVVDKQRDELRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADL 233          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|Q17QG3|RIPL1_BOVIN (RILP-like protein 1 OS=Bos taurus OX=9913 GN=RILPL1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.505e-12
Identity = 97/358 (27.09%), Postives = 171/358 (47.77%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE----RH---SQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEA-----------------------QILINKKSIQHSNDDVFIDECLKTDKISQSNVPDIN---FSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDE--VQGPINKEPVDKMSPSYCQQSGIRK-YSSTAKFKKQWSDA 1053
            VY+IA  + ++ + + +     AI  LI K+V VLE LE    RH    +L E++ +        + RIE E          ++K+LE +E+ W  E+ +L+  + +LQEEN  + T L  ++K   F+ + F +   +    + V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA                       Q  +N+   +    ++  +EC+   +    ++ D N   F+ +E+++ L +   LKS+V   +  L  Y+   IEE+    Q P    P  +MSP    +SGI++ +S  ++ KK+ ++ 
Sbjct:   27 VYDIASLVGHEFERVIDQHGCEAIARLIPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERK--------HQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNL--SHKDVSFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGELNQNGEEEPVAELGGEECVSEAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENQIPQPPPIAHP--RMSPQ--PESGIKRLFSFFSRDKKRLANT 370          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|D3ZUQ0|RIPL1_RAT (RILP-like protein 1 OS=Rattus norvegicus OX=10116 GN=Rilpl1 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.148e-12
Identity = 63/214 (29.44%), Postives = 114/214 (53.27%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE----RHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI 717
            VY+IA  + ++ + + +     AI  L+ K+V VLE LE    RH         E+D L++ + R+  E +++ ++   ++K+LE +E+ W  E+ +L+  + +LQEEN  + T L   +K   F+ +   +   +    + V  +LKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA +
Sbjct:   27 VYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVA-----PELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLN--HKDVGFSEEELQKHEGMSERERQVMKRLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADL 233          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|A0PJP4|RIPL1_XENTR (RILP-like protein 1 OS=Xenopus tropicalis OX=8364 GN=rilpl1 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 9.992e-11
Identity = 94/344 (27.33%), Postives = 163/344 (47.38%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELER-------HSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQAN---KKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEA------------QILINK-----KSIQHSNDDVFIDEC------LKTDKIS----QSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKYSS 1020
            VY+IA  +  + + + +      I  L+ K+V VLE LE        + ++ E++ +        + RIE E          ++K+LE +E+ W  E+ +L+  + +LQEEN  + + L Q +    + +F       + E Q V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA            ++ I K     K  QH+N +    E       L+T+K+S     SN P   F+ +E+++ L +   LK++V   +  L  Y+    +E E + P +   +D  +P   Q+SGI++  S
Sbjct:   19 VYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINPEMEELRLELDRLRLERMDRIEKEKK--------HQKELELVEDVWRGEAQDLLNQIAQLQEENKQLVSNLSQKDINLTEEEFQKHEGMSERERQ-VMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEIGKLRDKLKGEQHTNGEEIKTETLNEESILETEKLSLDLKDSNRP--RFTLQELRDVLHERNELKAKVFMLQEELAYYKSEEADE-EHKLPQSSPVIDSKAP-IPQESGIKRLFS 349          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|Q5EBL4|RIPL1_HUMAN (RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.182e-10
Identity = 92/361 (25.48%), Postives = 171/361 (47.37%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE----RH---SQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSI----------------QHSNDDVFIDECLKTDKISQSNVPDI-------------NFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDE--VQGPINKEPVDKMSPSYCQQSGIRK-YSSTAKFKKQWSDA 1053
            VY+IA  + ++ + + +     AI  L+ K+V VLE LE    RH    +L E++ +        + RIE E          ++K+LE +E+ W  E+ +L+  + +LQEEN  + T L  ++K   F+ + F +   +    + V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LIE+KV +EA +   ++ +                +HS +    +E  +T+ + + ++ D               F+ +E+++ L +   LKS+V   +  L  Y+   +EE+    Q P    P+     S   +SGI++ +S  ++ KK+ ++ 
Sbjct:   27 VYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERK--------HQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNL--SHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNG---EEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPP----PIAHPRTSPQPESGIKRLFSFFSRDKKRLANT 370          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A419QG41 (RILP-like protein 1 OS=Clonorchis sinensis OX=79923 GN=Rilpl1 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 9.630e-37
Identity = 103/349 (29.51%), Postives = 182/349 (52.15%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMK-TLLEQANKK--PKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVF--------------------------------------IDECLKTDKISQSNVPDIN---FSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKY 1014
            VY+IA  +  + + + +     +++ L+ K+++VLEELE  +  ++ + +E+  L++A++R+E E   +  +R   EK+ E+LEE+W  E+ EL++ +++L+EEN  ++  + EQ   K  P    +R +  +E   + L+LKE ID+Q  E++ L +++AQR +D DAMQQQ   L+ +NA +   H  +K  + +L+ EK ++E  +   ++ IQ   D V                                       + E L T+    +N  D N   F+ +E+++ L +   LKS +IE E  L +YR +   E  VQGPIN+EP DK      + SGI ++
Sbjct: 1926 VYDIAASIGKEFEAIIDRHGPDSVSSLMPKVISVLEELEDFASRFDSEGRELVTLQLAVRRLELEKCERANDRTRSEKEFEQLEETWQKETRELLQLIDRLKEENAQLREAVREQRESKDAPSDFRQRTTGAIEEIQLMLRLKEVIDRQKIELRGLSRQLAQRNVDLDAMQQQATRLAKLNAVLRRRHYVSKKQTDQLLSEKHDLEMTLRTKEELIQQMRDHVCQSPTDRAADRSLTCGMTASLIKELASPGTPPAPLTESQLIERLNTEDKMITNGSDPNKPRFTVQELRDLLTERNELKSRLIEVEEELSVYRRAGDSEPPVQGPINREPSDKAFGRVERSSGIAQF 2274          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A1S8WG73 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_10773 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 9.898e-35
Identity = 103/338 (30.47%), Postives = 180/338 (53.25%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMK-TLLEQANKK--PKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDV------------------------------FIDECLKTDKISQSNVPDIN---FSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGI 1005
            VY+IA  +  + + + +     +++ L+ K+++VLEELE  +  ++ + +E+  L++A++R+E E   +  +R   EK+ E+LEE+W  E+ EL++ +++L+EEN  ++  + EQ   K  P    +R +  +E   + L+LKE ID+Q  E++ L +++AQR +D DAMQQQ   L+ +NA +   H  +K  + +L+ EK ++E  +   ++ IQ   D V                               + E L T+    +N  D N   F+ +E+++ L +   LKS +IE E  L +YR +   E  VQGPIN+EP DK      + SGI
Sbjct:   49 VYDIAASIGKEFEAIIDRHGPDSVSSLMPKVISVLEELEDFASRFDSEGRELVTLQLAVRRLELEKCERVNDRTRSEKEFEQLEETWQKETRELLQLIDRLKEENAQLREAVREQRESKDAPADFRQRTTGAIEEIQLMLRLKEVIDRQKIELRGLSRQLAQRNVDLDAMQQQATRLAKLNAVLRRRHYVSKKQTDQLLSEKHDLEVTLRTKEELIQQMRDHVCQSPTDRAADRSLTCGMTASLIKELASPGTPLIERLNTEDKMITNGSDPNKPRFTVQELRDLLTERNELKSRLIEVEEELSVYRRAGDSEPPVQGPINREPSDKAFGRVERSSGI 386          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A4S2MBL7 (Uncharacterized protein (Fragment) OS=Opisthorchis felineus OX=147828 GN=CRM22_001230 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.510e-34
Identity = 105/349 (30.09%), Postives = 182/349 (52.15%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMK-TLLEQANKK--PKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDV--------------------FIDEC------------------LKTDKISQSNVPDIN---FSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKY 1014
            VY+IA  +  + + + +     +++ L+ K++NVLEELE  +  ++ + +E+  L++A++R+E E   +  +R   EK+ E+LEE+W  E+ EL++ +++L+EEN  ++  + EQ   K  P    +R +  +E   + L+LKE ID+Q  E++ L +++AQR +D DAMQQQ   L+ +NA +   H  +K  + +L+ EK ++E  +   ++ IQ   D V                     I E                   L T+    +N  D N   F+ +E+++ L +   LKS +IE E  L +YR +   E  VQGPIN+EP DK      + SGI ++
Sbjct:   50 VYDIAASIGKEFEAIIDRHGPDSVSSLMPKVINVLEELEDFASRFDSEGRELVTLQLAVRRLELEKCERANDRTRSEKEFEQLEETWQKETRELIQLIDRLKEENAQLREAVREQRESKDAPSDFRQRTTGAIEEIQLMLRLKEVIDRQKIELRGLSRQLAQRNVDLDAMQQQATRLAKLNAVLRRRHYVSKKQTDQLLSEKHDLEMTLRAKEELIQQMRDHVCQSPTDRAADRSLTCGMTASLIKELASPGTPHAPLTESQLIERLNTEDKMITNGSDPNKPRFTVQELRDLLTERNELKSRLIEVEEELSVYRRAGDSEPPVQGPINREPSDKAFGRVERSSGIAQF 398          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A5J4NMQ0 (RILP-like protein 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0008428 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 6.521e-34
Identity = 96/321 (29.91%), Postives = 175/321 (54.52%), Query Frame = 1
Query:  181 IHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKF--NSKRFSQQL-------EIQNVQ--LKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVFIDE-----------C----------------------------------LKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKM 975
            + K+++VLEELE  +  ++ + +E+  LK+A+ R+E E V++  ++   EK++E+LEE+W  E+ EL++ +++L+EEN  +K  L++  +K ++  ++++ +QQL        IQ +Q  L+LKE ID+Q  E++ L +++AQ+ +D DAMQQQ   L+ +NA +   HC  K  + +L+ EK +++  +   ++ IQH  D ++I             C                                  + TD  + S  P   F+  E++E L +   LKS +IE E  L +Y+ +  ++  VQGPIN+EP++K+
Sbjct:    1 MPKVISVLEELEDFAARFDSEGREVVTLKLAVHRLELEKVDRANDKCKNEKEMEQLEETWQTETRELLQLIDRLKEENTQLKGALKEKREKKEYPPSTRQSAQQLLFLFTDGAIQEIQLMLRLKEVIDRQKVELRGLYRQLAQKNVDLDAMQQQATRLAKLNAVLRRRHCVCKRQADQLLNEKNDLQLALKTKEQLIQHMRDHIYIQSNDQLPSPMGPTCGMSASMINELGSPGTPPATLTEAQLIERLNVEGKMITDGHNSSRKP--RFTVHELRELLTERNELKSRLIELEEELAVYKRAGDDDPPVQGPINREPIEKL 319          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A267G642 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026493g1 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.208e-33
Identity = 101/359 (28.13%), Postives = 189/359 (52.65%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNS--------------------KRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVFIDEC-------LKTDKISQSNVPDIN----------------FSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKYSSTAKFKKQWS 1047
            VY+ A  +  D + + +     A+  L+ K+++VLEELE  +  +E + KE+ +L+  + R+E E V+++ +R  +E++LE++EE W  E+ ELM  + +LQE+N  ++  L+ A +  +  +                    K+ S++     V +KLK T++ Q ++I+ L++E+AQR  D +A+Q Q   L+ +NAEI   HC +K  ++ L+E K ++E ++   ++ ++   D V   E        L T    +  +  +N                F+  E++E L +   LK+++IE E  L +YR +  ++  VQGPINKEP +K+ P      GI+++     F++++S
Sbjct:   12 VYDAASAIGKDFELIIDRYGVDAVAGLMPKVISVLEELEDLATRHETESKELVDLQRVVDRLETEKVSRQGDRSRFERELEQIEELWRNETQELMDVVSRLQEDNRRLQQELQTAKEGGESTTVQQQQQQTLQQQQAGGSLLKKQSSKETAELQVLVKLKATVEAQRDQIRSLQRELAQRQADVEALQSQSDRLARMNAEIRRRHCVSKRQAQHLLESKADLEVRLQAKEQLLREMKDCVVGPEAGAGAEANLMTSMTEEQLIEKLNSEGKMIIDRSDPNRPRFTITELREVLMERNELKTKLIEVEEELSVYRQAGDDDAPVQGPINKEPDEKLYPDKSTDIGIKQF-----FRRKFS 365          
BLAST of RILP-like protein 1 vs. Ensembl Cavefish
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:NCBI gene;Acc:103045747])

HSP 1 Score: 63.929 bits (154), Expect = 9.177e-11
Identity = 88/342 (25.73%), Postives = 161/342 (47.08%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE----RHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI-----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEA------QILIN--------KKSIQHSNDDVFIDECLKTDKISQSNVPD------------INFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSP---SYCQQSGIRK 1011
            VY+IA  +  + + + +     A++ L+ K+V VLE LE    R+S        E + L++ + ++  E +++ ++   + K+LE +E+ W  E+ +L+  + +LQEEN   KTLL   + K    ++   Q+ E      + V  KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++           K LIE+KV +EA      Q L N        ++ +Q  N     +E       +Q  + D              F+ +E+++ L +   LK++V   +  +  Y+    E++E  GP   +P   + P   +   +SGI++
Sbjct:   22 VYDIAAVVGQEFERIIDQYGCEALSRLMPKVVRVLEILEVLVSRNS-----ISPETEELRLELDKLRLERMDRMEKERKHMKELELVEDVWRGEAQDLLSQIAQLQEEN---KTLLNNLSVKDCSMTEEDIQRQEGMSERERQVMKKLKEVVDKQRDEIRAKDRELTLKNEDIEALQQQQNRLMKINHDLRHKITMVDAQGKALIEQKVELEAFAQARQQELGNLRQEVARLRERLQGENTSSEAEEPAAPPSPAQEALCDEEAGLDPKDPNRPRFTLQELRDVLHERNELKAKVFMLQEEIAYYKSE--EQEEEAGPPTPDPSPTLRPRSRTGQPESGIKR 353          
BLAST of RILP-like protein 1 vs. Ensembl Cavefish
Match: rilp (RILP-like protein 1 [Source:NCBI gene;Acc:103044209])

HSP 1 Score: 54.6842 bits (130), Expect = 8.789e-8
Identity = 64/252 (25.40%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYE----------KDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVFIDECLKTDKISQSNVPDINFS 825
            VYEIA  + ++++ L +   K ++  L+ KIV VLE LE  +   +  R + + L   +K  E   V ++++R   E          KD ++ E+ W  +  EL   + +LQE+N ++   L          SK    Q + + V LKLKE +DKQ +E++   +E +    + +A+Q+Q      +N E+       +   K  +E + ++EA +   +K I+     +   E   T   + +N P I+ +
Sbjct:   29 VYEIAKLVGSEVEKLIDHYGKASVEGLVPKIVKVLELLESFAARNQTLRCKEEEL---LKAFETLQVQQQKKRTARESEESNNNADLKDWQQKEQKWRLKVEELQAQVLQLQEDNQELLGSL----------SKEDRTQRQEREVMLKLKEVVDKQRDELRAKVQETSSMSKEVEALQEQLDRFMKMNGELRHKQSMMQAQLKSSVERRADMEADLCEKQKEIERLTTQL---EKASTHIAASTNNPTIDLT 264          
BLAST of RILP-like protein 1 vs. Ensembl Sea Lamprey
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:HGNC Symbol;Acc:HGNC:26814])

HSP 1 Score: 57.7658 bits (138), Expect = 1.508e-9
Identity = 60/214 (28.04%), Postives = 105/214 (49.07%), Query Frame = 1
Query:  100 VYEIAYEL----ENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI 717
            VY+IA  L    E  L   +E  +  A+  L+  ++ VLE LE  + +      E   L+  ++  + E +        ++++LE +E  W     E++  M +LQEEN  + + L + +          +Q   +    ++V +KLKE +DKQ +EI+   ++I+Q+  D +A+QQQ   L  IN E+       +   K LIE+KV +EA +
Sbjct:   24 VYDIAALLGRGFERALAAGTEGGE--AVHELMAPVIRVLEMLEALA-VRNGADTESTTLREQLESAKRETITLSARDSRHKQELELVETYWREREEEMLGCMTELQEENRKLDSALRRRDTDNADTEVEETQAEGLTEKERDVMIKLKEVVDKQRDEIRAKDRDISQKNEDVEALQQQLSRLIKINNELRHKLAVMEAQGKSLIEQKVELEADL 234          
BLAST of RILP-like protein 1 vs. Ensembl Nematostella
Match: EDO39686 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9D5])

HSP 1 Score: 57.7658 bits (138), Expect = 2.862e-9
Identity = 61/206 (29.61%), Postives = 105/206 (50.97%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI 717
            VYE A  +  D++ + +     A+  L+ K+V VLEELE      E ++ E   LK+  +R+  E   +  +R   +++L   +    A +L+ M  + KL+EEN  ++ +  QA+   K  +   S   + + V  ++KETID Q E I+L   EI  +  D DAM++Q   L+NIN  +  N    +   + L +EK  ++A+ 
Sbjct:   10 VYEQASVIGQDIEKIIDQYGHEAVLDLMPKVVRVLEELEILVSERENEKLEFAELKMENERLYLEIKKEASQRRKLDEELYSTQIDGEANNLKTM--VAKLKEENKKLR-MEYQASMNEKLTATYVSAPGDAE-VMRRMKETIDSQREAIRLRNTEIDNQRSDIDAMEEQIDRLTNINESLRRNLSAKQTRIRMLAKEKAELQAEF 211          
BLAST of RILP-like protein 1 vs. Ensembl Medaka
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:NCBI gene;Acc:101169547])

HSP 1 Score: 67.0106 bits (162), Expect = 8.907e-12
Identity = 91/361 (25.21%), Postives = 164/361 (45.43%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELE-----RHSQLYEMKRKEIDNLKV-AIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEI----QNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEA-------------QILINKKSIQHSNDDVFIDECLKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEP--VDKMSPSYCQQSGIRKYSSTAKFKKQWSDADLTHR*SN*FLFKIHIYI 1107
            VY++A  +  + + + +     A++ L+ K+V VLE LE     R S   E  R E+D L++  ++R+E E  +++        +LE++E+ W  E+ +L+  + +LQEEN   K LL   +     N +   +   +    + V +KLKE +DKQ +EI+   +E+  +  D +A+QQQ   L  IN ++       +   K LI +KV +EA             Q +   +           +E      +   N P   F+ +E+++ L +   LK++V   +  L  Y+    EE+ V    +  P   ++   S  Q+SGI++  S     K+ S        S+  L+K  +Y 
Sbjct:   26 VYDMAAVVGQEFERIIDQYGCEALSRLMPKVVRVLEILEVMVSRRMSPETEELRLELDRLRMERLERLEKEKRHRQ--------ELERVEDVWRGEAQDLLSQIAQLQEEN---KALLSNMSINDTMNEEDLQRHEGMTEREKQVMVKLKEVVDKQRDEIRAKDRELTLKNEDVEALQQQQSRLMKINHDLRHKTSVVEAQGKALIGQKVELEAAAQAQAQEVCALRQEVARLRERLQGGPPALCEEDSGGLDLRDPNRP--RFTLQELRDVLHERNELKAKVFLLQEELTYYKSDEAEEEIVTPSPSPSPELRNRSRSSPPQESGIKRLFSFFSRDKRRSSQQSGQLHSSFSLWKDDVYT 373          
BLAST of RILP-like protein 1 vs. Planmine SMEST
Match: SMESG000002944.1 (SMESG000002944.1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 311/311 (100.00%), Postives = 311/311 (100.00%), Query Frame = 1
Query:   82 MRGESFVYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVFIDECLKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKY 1014
            MRGESFVYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVFIDECLKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKY
Sbjct:    1 MRGESFVYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQILINKKSIQHSNDDVFIDECLKTDKISQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKY 311          
BLAST of RILP-like protein 1 vs. Planmine SMEST
Match: SMESG000009316.1 (SMESG000009316.1)

HSP 1 Score: 180.644 bits (457), Expect = 2.676e-52
Identity = 124/364 (34.07%), Postives = 202/364 (55.49%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKP-----KFNSKRF--SQQLEIQN----VQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI-----LINK--KSIQHS-------NDDVF-------------------------IDECLKTDKISQ---------SNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKY 1014
            VY++A E+  D + + +     A++ L+ K++ VLEELE ++Q YE + K+I NL+  ++++E E + + QER  YEKDLE++EE+WH E+ ELM  +EKLQE+N  +   L++  +       K   + F   QQ  I N    + ++LKE  D+Q  EI+ LKKE+AQ+C+D DAMQQQ   L+ +NAE+   HC +K  S +L+EEK +++ ++     +I K  + + HS       N D+                          + E    D+I+          +N     F+  E++  L +   LKS++IE E  L +Y+++  EE +VQGP+N+EP +KMSP   ++SGI+K+
Sbjct:   45 VYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKF 408          
BLAST of RILP-like protein 1 vs. Planmine SMEST
Match: SMESG000009316.1 (SMESG000009316.1)

HSP 1 Score: 179.874 bits (455), Expect = 3.757e-52
Identity = 120/355 (33.80%), Postives = 203/355 (57.18%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQL--KLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI-----LINK--KSIQHS-------NDDVF-------------------------IDECLKTDKISQ---------SNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKY 1014
            VY++A E+  D + + +     A++ L+ K++ VLEELE ++Q YE + K+I NL+  ++++E E + + QER  YEKDLE++EE+WH E+ ELM  +EKLQE+N  +   L++  +  +    + ++ +  +++QL  +LKE  D+Q  EI+ LKKE+AQ+C+D DAMQQQ   L+ +NAE+   HC +K  S +L+EEK +++ ++     +I K  + + HS       N D+                          + E    D+I+          +N     F+  E++  L +   LKS++IE E  L +Y+++  EE +VQGP+N+EP +KMSP   ++SGI+K+
Sbjct:   45 VYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITK-VSNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKF 398          
BLAST of RILP-like protein 1 vs. Planmine SMEST
Match: SMESG000009316.1 (SMESG000009316.1)

HSP 1 Score: 179.104 bits (453), Expect = 1.020e-51
Identity = 123/363 (33.88%), Postives = 203/363 (55.92%), Query Frame = 1
Query:  100 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKP-----KFNSKRF--SQQLEIQN----VQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQI-----LINK--KSIQHSND---------------DVFIDECLKTD--------KISQSNVPD------------------INFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRK 1011
            VY++A E+  D + + +     A++ L+ K++ VLEELE ++Q YE + K+I NL+  ++++E E + + QER  YEKDLE++EE+WH E+ ELM  +EKLQE+N  +   L++  +       K   + F   QQ  I N    + ++LKE  D+Q  EI+ LKKE+AQ+C+D DAMQQQ   L+ +NAE+   HC +K  S +L+EEK +++ ++     +I K  + + HS+                DV I   +  +        ++S++ + D                    F+  E++  L +   LKS++IE E  L +Y+++  EE +VQGP+N+EP +KMSP   ++SGI+K
Sbjct:   45 VYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQK 407          
The following BLAST results are available for this feature:
BLAST of RILP-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RILPL11.980e-1125.93Rab interacting lysosomal protein like 1 [Source:H... [more]
RILPL12.461e-1125.48Rab interacting lysosomal protein like 1 [Source:H... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rilp-14.314e-1222.47RILP (Rab7-Interacting Lysosomal Protein) homolog ... [more]
rilp-16.962e-1222.47RILP (Rab7-Interacting Lysosomal Protein) homolog ... [more]
rilp-16.962e-1222.47RILP (Rab7-Interacting Lysosomal Protein) homolog ... [more]
rilp-16.962e-1222.47RILP (Rab7-Interacting Lysosomal Protein) homolog ... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rilpl5.616e-823.98gene:FBgn0024985 transcript:FBtr0332292[more]
Rilpl5.988e-823.98gene:FBgn0024985 transcript:FBtr0332291[more]
Rilpl6.960e-823.98gene:FBgn0024985 transcript:FBtr0070225[more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rilp2.529e-828.76Rab interacting lysosomal protein [Source:ZFIN;Acc... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tnip31.521e-1127.46TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:... [more]
tnip31.869e-1127.33TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:... [more]
tnip33.601e-1027.22TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rilpl11.414e-1329.44Rab interacting lysosomal protein-like 1 [Source:M... [more]
back to top
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JJC6|RIPL1_MOUSE9.892e-1329.44RILP-like protein 1 OS=Mus musculus OX=10090 GN=Ri... [more]
sp|Q17QG3|RIPL1_BOVIN3.505e-1227.09RILP-like protein 1 OS=Bos taurus OX=9913 GN=RILPL... [more]
sp|D3ZUQ0|RIPL1_RAT8.148e-1229.44RILP-like protein 1 OS=Rattus norvegicus OX=10116 ... [more]
sp|A0PJP4|RIPL1_XENTR9.992e-1127.33RILP-like protein 1 OS=Xenopus tropicalis OX=8364 ... [more]
sp|Q5EBL4|RIPL1_HUMAN1.182e-1025.48RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RIL... [more]
back to top
BLAST of RILP-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419QG419.630e-3729.51RILP-like protein 1 OS=Clonorchis sinensis OX=7992... [more]
A0A1S8WG739.898e-3530.47Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4S2MBL71.510e-3430.09Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A5J4NMQ06.521e-3429.91RILP-like protein 1 OS=Paragonimus westermani OX=3... [more]
A0A267G6422.208e-3328.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RILPL19.177e-1125.73Rab interacting lysosomal protein like 1 [Source:N... [more]
rilp8.789e-825.40RILP-like protein 1 [Source:NCBI gene;Acc:10304420... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RILPL11.508e-928.04Rab interacting lysosomal protein like 1 [Source:H... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RILP-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO396862.862e-929.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RILPL18.907e-1225.21Rab interacting lysosomal protein like 1 [Source:N... [more]
back to top
BLAST of RILP-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000002944.10.000e+0100.00SMESG000002944.1[more]
SMESG000009316.12.676e-5234.07SMESG000009316.1[more]
SMESG000009316.13.757e-5233.80SMESG000009316.1[more]
SMESG000009316.11.020e-5133.88SMESG000009316.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029482 ID=SMED30029482|Name=RILP-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1215bp
ATTGAATATTTGAAACTATTTTCTTGTACATTTTAATAAATTATTTTTTA
AAAACGCTGTAAATTTTTGTAGTGTTAATCCATGCGAGGTGAAAGTTTTG
TTTATGAAATCGCTTATGAATTGGAAAATGACTTAAAAAATCTAAGTGAA
TCCTTAGATAAGATTGCAATTACACCGCTTATTCACAAAATTGTCAACGT
TCTTGAAGAGTTGGAACGCCATTCACAGTTATACGAAATGAAAAGAAAAG
AAATCGATAATTTAAAAGTAGCAATTAAACGAATAGAGGATGAAGCTGTG
AATAAAGAACAAGAACGTTTGTTCTATGAAAAGGACCTTGAAAAACTAGA
GGAATCCTGGCATGCTGAATCCTTGGAATTAATGAAAACAATGGAAAAAT
TGCAAGAAGAAAACAATGATATGAAAACGTTATTGGAACAAGCAAATAAG
AAACCTAAATTCAATTCCAAGAGATTTAGCCAACAACTTGAAATTCAAAA
TGTCCAACTAAAGCTCAAAGAAACAATAGATAAGCAGGTTGAGGAAATCA
AACTATTGAAAAAGGAAATTGCTCAAAGATGTATAGATTTTGATGCGATG
CAACAGCAATGTCTCAATCTCAGCAATATCAATGCGGAAATTTGTGAGAA
TCACTGCAACAATAAAATCATGTCGAAAAGATTAATTGAGGAAAAAGTTA
ACATTGAGGCTCAGATTCTTATTAACAAGAAATCTATTCAGCATAGCAAT
GACGATGTTTTTATTGATGAATGCTTGAAAACTGATAAAATTTCTCAAAG
TAATGTACCCGATATCAATTTCAGTTGGGAGGAAGTTCAGGAATATCTGC
AAGATTGTCGTAGATTGAAGTCAGAAGTTATTGAGAAAGAGGGTCGATTG
CTTATATATCGGCATAGCGTTATAGAAGAGGATGAGGTTCAAGGTCCAAT
CAATAAAGAACCGGTAGATAAAATGAGTCCATCTTATTGTCAACAAAGTG
GCATTAGAAAATATTCTTCGACAGCTAAATTTAAGAAACAATGGTCAGAT
GCAGACTTGACACACAGGTGATCGAACTAATTTTTGTTTAAAATCCATAT
ATATATATATATATAACCAGCAAATGCACTGTGGTCATAAAAACAATAAA
AAGCGATCGGAGCGTCCCAAATGATTTCAACGAGTTAATAATACAGATGA
ACAATCTACCTTGTG
back to top

protein sequence of SMED30029482-orf-1

>SMED30029482-orf-1 ID=SMED30029482-orf-1|Name=SMED30029482-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=330bp
MRGESFVYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQL
YEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLEL
MKTMEKLQEENNDMKTLLEQANKKPKFNSKRFSQQLEIQNVQLKLKETID
KQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKR
LIEEKVNIEAQILINKKSIQHSNDDVFIDECLKTDKISQSNVPDINFSWE
EVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSP
SYCQQSGIRKYSSTAKFKKQWSDADLTHR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0031267small GTPase binding
GO:0051959dynein light intermediate chain binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019143JNK/Rab-associated_protein-1_N
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0036064ciliary basal body
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 97..124
NoneNo IPR availableCOILSCoilCoilcoord: 252..272
NoneNo IPR availableCOILSCoilCoilcoord: 41..92
NoneNo IPR availableCOILSCoilCoilcoord: 142..162
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 310..329
NoneNo IPR availablePANTHERPTHR21502ZINC FINGER PROTEIN DZIP1coord: 7..218
NoneNo IPR availablePANTHERPTHR21502:SF6RILP-LIKE PROTEIN 1coord: 7..218
IPR019143JNK/Rab-associated protein-1, N-terminalPFAMPF09744Jnk-SapK_ap_Ncoord: 7..152
e-value: 1.4E-13
score: 51.4