MICOS complex subunit MIC10

Overview
NameMICOS complex subunit MIC10
Smed IDSMED30029473
Length (bp)479
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MICOS complex subunit MIC10 (SMED30029473) t-SNE clustered cells

Violin plots show distribution of expression levels for MICOS complex subunit MIC10 (SMED30029473) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MICOS complex subunit MIC10 (SMED30029473) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MICOS complex subunit MIC10 (SMED30029473) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029473

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029473h1SMcG0018193 SmedASXL_006271SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MICOS complex subunit MIC10 vs. Ensembl Human
Match: MICOS10 (mitochondrial contact site and cristae organizing system subunit 10 [Source:HGNC Symbol;Acc:HGNC:32068])

HSP 1 Score: 65.4698 bits (158), Expect = 3.208e-14
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQ 280
            + ELG K DRC++D  +K   G G+G+V S+ FFKRR  PL FGS +GLGMA +NC +D + P  L+ GK  K+
Sbjct:    3 ESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPY-LLHGKYVKE 75          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Human
Match: MICOS10-NBL1 (MICOS10-NBL1 readthrough [Source:HGNC Symbol;Acc:HGNC:48338])

HSP 1 Score: 58.9214 bits (141), Expect = 6.743e-12
Identity = 34/69 (49.28%), Postives = 46/69 (66.67%), Query Frame = 2
Query:   77 KIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQS 283
            K DRC++D  +K   G G+G+V S+ FFKRR  PL FGS +GLGMA +NC +D + P  L+ GK  K+ 
Sbjct:    2 KWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPY-LLHGKYVKEQ 69          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Human
Match: MICOS10 (mitochondrial contact site and cristae organizing system subunit 10 [Source:HGNC Symbol;Acc:HGNC:32068])

HSP 1 Score: 51.9878 bits (123), Expect = 2.711e-9
Identity = 28/74 (37.84%), Postives = 38/74 (51.35%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQ 280
            + ELG K DRC++D  +K                  R  PL FGS +GLGMA +NC +D + P  L+ GK  K+
Sbjct:    3 ESELGRKWDRCLADAVVKI----------------GRMWPLAFGSGMGLGMAYSNCQHDFQAPY-LLHGKYVKE 59          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Human
Match: MICOS10-NBL1 (MICOS10-NBL1 readthrough [Source:HGNC Symbol;Acc:HGNC:48338])

HSP 1 Score: 50.0618 bits (118), Expect = 1.738e-8
Identity = 23/42 (54.76%), Postives = 29/42 (69.05%), Query Frame = 2
Query:  155 FFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQ 280
            FFKRR  PL FGS +GLGMA +NC +D + P  L+ GK  K+
Sbjct:   27 FFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPY-LLHGKYVKE 67          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Celegans
Match: F54A3.5 (MICOS complex subunit Mic10 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4K0])

HSP 1 Score: 59.6918 bits (143), Expect = 3.031e-12
Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSL 256
            ++E+G KIDRC +D  +K   G  +G+VASV FFK R  P+ FGS +GLG   +NC +D   P  L
Sbjct:   14 EDEVGQKIDRCFADSLLKVTGGVAIGIVASVAFFKSRSWPIWFGSGVGLGTGWSNCRHDFASPYVL 79          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Fly
Match: CG12479 (gene:FBgn0040871 transcript:FBtr0073869)

HSP 1 Score: 46.595 bits (109), Expect = 2.140e-7
Identity = 23/65 (35.38%), Postives = 39/65 (60.00%), Query Frame = 2
Query:   44 MSAKIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDL 238
            MS   ++ L   I+RC+SD  +K + G  +G V +++FF+RR  P+  G+  G+G+A   C  +L
Sbjct:    1 MSTTPEDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGTGFGVGVAYRGCEKEL 65          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Zebrafish
Match: micos10 (mitochondrial contact site and cristae organizing system subunit 10 [Source:ZFIN;Acc:ZDB-GENE-060825-325])

HSP 1 Score: 61.6178 bits (148), Expect = 5.546e-13
Identity = 34/66 (51.52%), Postives = 46/66 (69.70%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSL 256
            ++ELG K DRC++D  IK   G G+G+V SV+FFKRR  P+  G+ +GLGMA +NC NDL+    L
Sbjct:    3 EKELGQKWDRCLADCAIKVGTGLGLGIVFSVVFFKRRTSPIALGTGIGLGMAYSNCQNDLRSHYQL 68          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Mouse
Match: Micos10 (mitochondrial contact site and cristae organizing system subunit 10 [Source:MGI Symbol;Acc:MGI:1913628])

HSP 1 Score: 63.5438 bits (153), Expect = 8.714e-14
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQ 280
            + ELG K DRC++D  +K   G G+G+V S+ FFKRR  PL FGS +GLGMA +NC +D + P  L+ GK  K+
Sbjct:    3 ESELGRKWDRCMADTVVKLGTGFGLGIVFSLTFFKRRMWPLAFGSGVGLGMAYSNCQHDFQAPY-LLHGKYVKE 75          
BLAST of MICOS complex subunit MIC10 vs. UniProt/SwissProt
Match: sp|Q5TGZ0|MIC10_HUMAN (MICOS complex subunit MIC10 OS=Homo sapiens OX=9606 GN=MICOS10 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.540e-13
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQ 280
            + ELG K DRC++D  +K   G G+G+V S+ FFKRR  PL FGS +GLGMA +NC +D + P  L+ GK  K+
Sbjct:    3 ESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPY-LLHGKYVKE 75          
BLAST of MICOS complex subunit MIC10 vs. UniProt/SwissProt
Match: sp|Q7TNS2|MIC10_MOUSE (MICOS complex subunit Mic10 OS=Mus musculus OX=10090 GN=Micos10 PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 6.096e-13
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQ 280
            + ELG K DRC++D  +K   G G+G+V S+ FFKRR  PL FGS +GLGMA +NC +D + P  L+ GK  K+
Sbjct:    3 ESELGRKWDRCMADTVVKLGTGFGLGIVFSLTFFKRRMWPLAFGSGVGLGMAYSNCQHDFQAPY-LLHGKYVKE 75          
BLAST of MICOS complex subunit MIC10 vs. UniProt/SwissProt
Match: sp|B2RYW8|MIC10_RAT (MICOS complex subunit Mic10 OS=Rattus norvegicus OX=10116 GN=Micos10 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.249e-12
Identity = 36/74 (48.65%), Postives = 49/74 (66.22%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQ 280
            + E G K DRC++D  +K   G G+G+V S+ FFKRR  PL FGS +GLGMA +NC +D + P  L+ GK  K+
Sbjct:    3 ESEPGRKWDRCMADALVKLGTGFGLGMVFSLTFFKRRKWPLAFGSGVGLGMAYSNCQHDFQAPY-LLHGKYVKE 75          
BLAST of MICOS complex subunit MIC10 vs. UniProt/SwissProt
Match: sp|Q9N4K0|MIC10_CAEEL (MICOS complex subunit Mic10 OS=Caenorhabditis elegans OX=6239 GN=F54A3.5 PE=3 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 3.856e-11
Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSL 256
            ++E+G KIDRC +D  +K   G  +G+VASV FFK R  P+ FGS +GLG   +NC +D   P  L
Sbjct:   14 EDEVGQKIDRCFADSLLKVTGGVAIGIVASVAFFKSRSWPIWFGSGVGLGTGWSNCRHDFASPYVL 79          
BLAST of MICOS complex subunit MIC10 vs. TrEMBL
Match: Q5BSC7 (MICOS complex subunit MIC10 OS=Schistosoma japonicum OX=6182 GN=EWB00_004079 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.046e-17
Identity = 45/73 (61.64%), Postives = 54/73 (73.97%), Query Frame = 2
Query:   53 KIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKI 271
            K ++ LG K+DRCISD  IKT  G   G++ SV+F KRRP PLIFG+  GLGM I+NCNND KQPL LVS +I
Sbjct:    6 KSEDILGFKLDRCISDTLIKTGAGLFGGIIFSVVFAKRRPWPLIFGTGFGLGMGISNCNNDFKQPLPLVSHRI 78          
BLAST of MICOS complex subunit MIC10 vs. TrEMBL
Match: A0A183BGC3 (MICOS complex subunit MIC10 OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS18258 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.313e-17
Identity = 45/80 (56.25%), Postives = 60/80 (75.00%), Query Frame = 2
Query:   47 SAKIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQSI 286
            SAK ++ LG+++DRCISD  IKT  GA +G++ SV+  K +P P++FG+ LGLGM+IANCNND KQPL LVS +I   S 
Sbjct:    4 SAKSEDILGLRLDRCISDTLIKTGSGAFMGIIFSVLLAKSKPWPVVFGTGLGLGMSIANCNNDFKQPLPLVSHRIKVSSF 83          
BLAST of MICOS complex subunit MIC10 vs. TrEMBL
Match: C1LK15 (MICOS complex subunit MIC10 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.364e-17
Identity = 44/70 (62.86%), Postives = 52/70 (74.29%), Query Frame = 2
Query:   53 KIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVS 262
            K ++ LG K+DRCISD  IKT  G   G++ SV+F KRRP PLIFG+  GLGM I+NCNND KQPL LVS
Sbjct:    6 KSEDILGFKLDRCISDTLIKTGAGLFGGIIFSVVFAKRRPWPLIFGTGFGLGMGISNCNNDFKQPLPLVS 75          
BLAST of MICOS complex subunit MIC10 vs. TrEMBL
Match: A0A146MHV0 (MICOS complex subunit MIC10 OS=Schistosoma mansoni OX=6183 GN=c797_g1_i1 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.806e-17
Identity = 44/73 (60.27%), Postives = 53/73 (72.60%), Query Frame = 2
Query:   53 KIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKI 271
            K ++ LG K+DRCISD  IKT  G   G++ SV+  KRRP PLIFG+  GLGM I+NCNND KQPL LVS +I
Sbjct:    6 KSEDILGFKLDRCISDTLIKTGAGLFGGIIFSVVLAKRRPWPLIFGTGFGLGMGISNCNNDFKQPLPLVSHRI 78          
BLAST of MICOS complex subunit MIC10 vs. TrEMBL
Match: A0A146MGH5 (MICOS complex subunit MIC10 OS=Schistosoma mansoni OX=6183 GN=c797_g1_i2 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.370e-17
Identity = 44/73 (60.27%), Postives = 53/73 (72.60%), Query Frame = 2
Query:   53 KIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKI 271
            K ++ LG K+DRCISD  IKT  G   G++ SV+  KRRP PLIFG+  GLGM I+NCNND KQPL LVS +I
Sbjct:    6 KSEDILGFKLDRCISDTLIKTGAGLFGGIIFSVVLAKRRPWPLIFGTGFGLGMGISNCNNDFKQPLPLVSHRI 78          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Cavefish
Match: ENSAMXT00000030462.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:18042672:18051540:1 gene:ENSAMXG00000040088.1 transcript:ENSAMXT00000030462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 7.413e-16
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 2
Query:   62 EELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSL 256
            E+ G K DRC+SD  +KT++G GVG + SV+FFKRR  P+ FG+ +GLGMA +NC +D K P  L
Sbjct:    2 EDSGRKWDRCVSDSAVKTVLGLGVGALFSVLFFKRRSWPIAFGAGMGLGMAYSNCQHDFKSPYLL 66          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Cavefish
Match: micos10 (MICOS complex subunit MIC10 [Source:NCBI gene;Acc:103047888])

HSP 1 Score: 65.855 bits (159), Expect = 1.141e-14
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQ 280
            ++ELG K DRC++D  IK   G G+G+V SV+FFKRR  P+ FG+  GLGMA +NC NDL+ P  + S    +Q
Sbjct:    3 EKELGQKWDRCLADAAIKVGAGLGLGIVFSVVFFKRRTFPIAFGTGTGLGMAYSNCQNDLRSPYLVHSNATKEQ 76          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Medaka
Match: ENSORLT00000035437.1 (pep primary_assembly:ASM223467v1:7:1586357:1587485:1 gene:ENSORLG00000024698.1 transcript:ENSORLT00000035437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 6.190e-15
Identity = 41/83 (49.40%), Postives = 52/83 (62.65%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQSILELAQTT 307
            + ELG K+DRC++DG IK   G G+G+V SV+FFKR   P+ FGS  GLGMA ANC NDL+    L     H+   + LA  T
Sbjct:    3 ERELGRKLDRCLADGVIKLGTGLGLGIVFSVLFFKRHAWPISFGSGAGLGMAYANCQNDLRWHYLL-----HRNPKVALADET 80          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Medaka
Match: ENSORLT00000027538.1 (mitochondrial contact site and cristae organizing system subunit 10 [Source:NCBI gene;Acc:101167281])

HSP 1 Score: 65.0846 bits (157), Expect = 1.274e-13
Identity = 37/78 (47.44%), Postives = 52/78 (66.67%), Query Frame = 2
Query:   53 KIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQSI 286
            K+ +E G K DRC++D  +KT+ G GVGVV SV+F KRR  P+ FGS LGLGM  +NC +D + P      +IH +++
Sbjct:   77 KMADEYGRKWDRCLADTAVKTVTGLGVGVVFSVLFLKRRTWPVSFGSGLGLGMGYSNCQHDFRLPY-----RIHGRTV 149          
BLAST of MICOS complex subunit MIC10 vs. Ensembl Medaka
Match: ENSORLT00000029141.1 (pep primary_assembly:ASM223467v1:7:1586357:1587485:1 gene:ENSORLG00000024698.1 transcript:ENSORLT00000029141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 2.630e-9
Identity = 31/83 (37.35%), Postives = 39/83 (46.99%), Query Frame = 2
Query:   59 DEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQSILELAQTT 307
            + ELG K+DRC++DG IK                     P+ FGS  GLGMA ANC NDL+    L     H+   + LA  T
Sbjct:    3 ERELGRKLDRCLADGVIKL----------------GHAWPISFGSGAGLGMAYANCQNDLRWHYLL-----HRNPKVALADET 64          
BLAST of MICOS complex subunit MIC10 vs. Planmine SMEST
Match: SMESG000039213.1 (SMESG000039213.1)

HSP 1 Score: 233.032 bits (593), Expect = 9.010e-80
Identity = 141/141 (100.00%), Postives = 141/141 (100.00%), Query Frame = 2
Query:   44 MSAKIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQSILELAQTTGSQITKTSNVTDINTMKGDGASRTXXXXXXXXXXXXXDPASFSVKGCKKRTKN 466
            MSAKIDEELGMKIDRCISDGFIKTIVGAGVGVVASVMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQSILELAQTTGSQITKTSNVTDINTMKGDGASRTEKSNEKSNEKNSEDPASFSVKGCKKRTKN
Sbjct:    1 MSAKIDEELGMKIDRCISDGFIKTIVGAGVGVVASVMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHKQSILELAQTTGSQITKTSNVTDINTMKGDGASRTEKSNEKSNEKNSEDPASFSVKGCKKRTKN 141          
BLAST of MICOS complex subunit MIC10 vs. Planmine SMEST
Match: SMESG000009106.1 (SMESG000009106.1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.119e-18
Identity = 37/76 (48.68%), Postives = 54/76 (71.05%), Query Frame = 2
Query:   50 AKIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKIHK 277
             K ++ELG+K+DRC SD  +K   G  +G+V S + FKR+PG ++F + +G+GMA+ANCNND K P S+V  +I K
Sbjct:    4 VKTEDELGVKVDRCFSDAVVKIAGGVSIGIVGSFLLFKRKPGIILFSTGIGIGMALANCNNDFKMPCSVVHNQIIK 79          
BLAST of MICOS complex subunit MIC10 vs. Planmine SMEST
Match: SMESG000009106.1 (SMESG000009106.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.870e-18
Identity = 36/74 (48.65%), Postives = 53/74 (71.62%), Query Frame = 2
Query:   50 AKIDEELGMKIDRCISDGFIKTIXXXXXXXXXXXMFFKRRPGPLIFGSALGLGMAIANCNNDLKQPLSLVSGKI 271
             K ++ELG+K+DRC SD  +K   G  +G+V S + FKR+PG ++F + +G+GMA+ANCNND K P S+V  +I
Sbjct:    4 VKTEDELGVKVDRCFSDAVVKIAGGVSIGIVGSFLLFKRKPGIILFSTGIGIGMALANCNNDFKMPCSVVHNQI 77          
The following BLAST results are available for this feature:
BLAST of MICOS complex subunit MIC10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MICOS103.208e-1450.00mitochondrial contact site and cristae organizing ... [more]
MICOS10-NBL16.743e-1249.28MICOS10-NBL1 readthrough [Source:HGNC Symbol;Acc:H... [more]
MICOS102.711e-937.84mitochondrial contact site and cristae organizing ... [more]
MICOS10-NBL11.738e-854.76MICOS10-NBL1 readthrough [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F54A3.53.031e-1246.97MICOS complex subunit Mic10 [Source:UniProtKB/Swi... [more]
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG124792.140e-735.38gene:FBgn0040871 transcript:FBtr0073869[more]
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
micos105.546e-1351.52mitochondrial contact site and cristae organizing ... [more]
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Micos108.714e-1450.00mitochondrial contact site and cristae organizing ... [more]
back to top
BLAST of MICOS complex subunit MIC10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5TGZ0|MIC10_HUMAN1.540e-1350.00MICOS complex subunit MIC10 OS=Homo sapiens OX=960... [more]
sp|Q7TNS2|MIC10_MOUSE6.096e-1350.00MICOS complex subunit Mic10 OS=Mus musculus OX=100... [more]
sp|B2RYW8|MIC10_RAT1.249e-1248.65MICOS complex subunit Mic10 OS=Rattus norvegicus O... [more]
sp|Q9N4K0|MIC10_CAEEL3.856e-1146.97MICOS complex subunit Mic10 OS=Caenorhabditis eleg... [more]
back to top
BLAST of MICOS complex subunit MIC10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5BSC71.046e-1761.64MICOS complex subunit MIC10 OS=Schistosoma japonic... [more]
A0A183BGC31.313e-1756.25MICOS complex subunit MIC10 OS=Echinostoma caproni... [more]
C1LK155.364e-1762.86MICOS complex subunit MIC10 OS=Schistosoma japonic... [more]
A0A146MHV08.806e-1760.27MICOS complex subunit MIC10 OS=Schistosoma mansoni... [more]
A0A146MGH59.370e-1760.27MICOS complex subunit MIC10 OS=Schistosoma mansoni... [more]
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000030462.17.413e-1653.85pep primary_assembly:Astyanax_mexicanus-2.0:22:180... [more]
micos101.141e-1450.00MICOS complex subunit MIC10 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MICOS complex subunit MIC10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000035437.16.190e-1549.40pep primary_assembly:ASM223467v1:7:1586357:1587485... [more]
ENSORLT00000027538.11.274e-1347.44mitochondrial contact site and cristae organizing ... [more]
ENSORLT00000029141.12.630e-937.35pep primary_assembly:ASM223467v1:7:1586357:1587485... [more]
back to top
BLAST of MICOS complex subunit MIC10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000039213.19.010e-80100.00SMESG000039213.1[more]
SMESG000009106.11.119e-1848.68SMESG000009106.1[more]
SMESG000009106.11.870e-1848.65SMESG000009106.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029473 ID=SMED30029473|Name=MICOS complex subunit MIC10|organism=Schmidtea mediterranea sexual|type=transcript|length=479bp
ATTTTGGATTTTAATTAATTTTAAATTAAGTGAAGGATAATTGATGTCAG
CGAAAATAGACGAAGAACTCGGAATGAAAATCGATCGGTGTATATCAGAT
GGATTTATTAAAACGATTGTCGGAGCTGGAGTTGGAGTCGTAGCGTCAGT
TATGTTTTTTAAAAGAAGACCAGGACCTCTAATTTTTGGATCAGCTTTAG
GATTAGGAATGGCAATTGCAAATTGCAATAATGATCTTAAGCAACCGCTA
TCCCTTGTTTCAGGCAAAATACATAAACAATCTATTTTGGAACTAGCTCA
AACAACTGGAAGCCAAATAACTAAAACATCTAATGTAACTGATATCAATA
CAATGAAGGGTGACGGAGCTAGTCGAACTGAAAAAAGTAATGAAAAAAGT
AATGAAAAAAATAGTGAAGATCCAGCTAGTTTCAGTGTAAAAGGATGTAA
AAAGAGAACAAAAAATTAACGAATTTGGC
back to top

protein sequence of SMED30029473-orf-1

>SMED30029473-orf-1 ID=SMED30029473-orf-1|Name=SMED30029473-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=142bp
MSAKIDEELGMKIDRCISDGFIKTIVGAGVGVVASVMFFKRRPGPLIFGS
ALGLGMAIANCNNDLKQPLSLVSGKIHKQSILELAQTTGSQITKTSNVTD
INTMKGDGASRTEKSNEKSNEKNSEDPASFSVKGCKKRTKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR007512Mic10
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0061617MICOS complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007512MICOS complex subunit Mic10PFAMPF04418DUF543coord: 6..64
e-value: 7.3E-14
score: 51.5
IPR007512MICOS complex subunit Mic10PANTHERPTHR21304UNCHARACTERIZEDcoord: 6..78
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 93..141
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 93..109
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 110..124
NoneNo IPR availablePANTHERPTHR21304:SF5MICOS COMPLEX SUBUNIT MIC10coord: 6..78
NoneNo IPR availableTMHMMTMhelixcoord: 20..39